FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24814

FusionGeneSummary for NR6A1_DEAF1

check button Fusion gene summary
Fusion gene informationFusion gene name: NR6A1_DEAF1
Fusion gene ID: 24814
HgeneTgene
Gene symbol

NR6A1

DEAF1

Gene ID

2649

10522

Gene namenuclear receptor subfamily 6 group A member 1DEAF1, transcription factor
SynonymsCT150|GCNF|GCNF1|NR61|RTR|hGCNF|hRTRMRD24|NUDR|SPN|ZMYND5
Cytomap

9q33.3

11p15.5

Type of geneprotein-codingprotein-coding
Descriptionnuclear receptor subfamily 6 group A member 1germ cell nuclear factor variant 1retinoic acid receptor-related testis-associated receptorretinoid receptor-related testis-specific receptordeformed epidermal autoregulatory factor 1 homolognuclear DEAF-1-related transcriptional regulatorsuppressinzinc finger MYND domain-containing protein 5
Modification date2018052320180523
UniProtAcc

Q15406

O75398

Ensembl transtripts involved in fusion geneENST00000487099, ENST00000373584, 
ENST00000416460, ENST00000344523, 
ENST00000338675, ENST00000382409, 
ENST00000525904, 
Fusion gene scores* DoF score3 X 3 X 4=367 X 3 X 6=126
# samples 47
** MAII scorelog2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(7/126*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NR6A1 [Title/Abstract] AND DEAF1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneDEAF1

GO:0000122

negative regulation of transcription by RNA polymerase II

24726472

TgeneDEAF1

GO:0033599

regulation of mammary gland epithelial cell proliferation

18826651

TgeneDEAF1

GO:0045892

negative regulation of transcription, DNA-templated

24726472

TgeneDEAF1

GO:0045893

positive regulation of transcription, DNA-templated

24726472


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-XF-A9SY-01ANR6A1chr9

127533299

-DEAF1chr11

654051

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000487099ENST00000338675NR6A1chr9

127533299

-DEAF1chr11

654051

-
In-frameENST00000487099ENST00000382409NR6A1chr9

127533299

-DEAF1chr11

654051

-
5CDS-5UTRENST00000487099ENST00000525904NR6A1chr9

127533299

-DEAF1chr11

654051

-
In-frameENST00000373584ENST00000338675NR6A1chr9

127533299

-DEAF1chr11

654051

-
In-frameENST00000373584ENST00000382409NR6A1chr9

127533299

-DEAF1chr11

654051

-
5CDS-5UTRENST00000373584ENST00000525904NR6A1chr9

127533299

-DEAF1chr11

654051

-
In-frameENST00000416460ENST00000338675NR6A1chr9

127533299

-DEAF1chr11

654051

-
In-frameENST00000416460ENST00000382409NR6A1chr9

127533299

-DEAF1chr11

654051

-
5CDS-5UTRENST00000416460ENST00000525904NR6A1chr9

127533299

-DEAF1chr11

654051

-
In-frameENST00000344523ENST00000338675NR6A1chr9

127533299

-DEAF1chr11

654051

-
In-frameENST00000344523ENST00000382409NR6A1chr9

127533299

-DEAF1chr11

654051

-
5CDS-5UTRENST00000344523ENST00000525904NR6A1chr9

127533299

-DEAF1chr11

654051

-

Top

FusionProtFeatures for NR6A1_DEAF1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NR6A1

Q15406

DEAF1

O75398

Orphan nuclear receptor. Binds to a response elementcontaining the sequence 5'-TCAAGGTCA-3'. May be involved in theregulation of gene expression in germ cell development duringgametogenesis (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneDEAF1chr9:127533299chr11:654051ENST00000338675-811504_540426491Zinc fingerMYND-type
TgeneDEAF1chr9:127533299chr11:654051ENST00000382409-912504_540501566Zinc fingerMYND-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNR6A1chr9:127533299chr11:654051ENST00000344523-11057_13233480DNA bindingNuclear receptor
HgeneNR6A1chr9:127533299chr11:654051ENST00000373584-11057_13233477DNA bindingNuclear receptor
HgeneNR6A1chr9:127533299chr11:654051ENST00000416460-11057_13233476DNA bindingNuclear receptor
HgeneNR6A1chr9:127533299chr11:654051ENST00000487099-11057_13233481DNA bindingNuclear receptor
HgeneNR6A1chr9:127533299chr11:654051ENST00000344523-110249_48033480DomainNR LBD
HgeneNR6A1chr9:127533299chr11:654051ENST00000373584-110249_48033477DomainNR LBD
HgeneNR6A1chr9:127533299chr11:654051ENST00000416460-110249_48033476DomainNR LBD
HgeneNR6A1chr9:127533299chr11:654051ENST00000487099-110249_48033481DomainNR LBD
HgeneNR6A1chr9:127533299chr11:654051ENST00000344523-11060_8033480Zinc fingerNR C4-type
HgeneNR6A1chr9:127533299chr11:654051ENST00000344523-11096_12033480Zinc fingerNR C4-type
HgeneNR6A1chr9:127533299chr11:654051ENST00000373584-11060_8033477Zinc fingerNR C4-type
HgeneNR6A1chr9:127533299chr11:654051ENST00000373584-11096_12033477Zinc fingerNR C4-type
HgeneNR6A1chr9:127533299chr11:654051ENST00000416460-11060_8033476Zinc fingerNR C4-type
HgeneNR6A1chr9:127533299chr11:654051ENST00000416460-11096_12033476Zinc fingerNR C4-type
HgeneNR6A1chr9:127533299chr11:654051ENST00000487099-11060_8033481Zinc fingerNR C4-type
HgeneNR6A1chr9:127533299chr11:654051ENST00000487099-11096_12033481Zinc fingerNR C4-type
TgeneDEAF1chr9:127533299chr11:654051ENST00000338675-8112_122426491Compositional biasNote=Ala-rich
TgeneDEAF1chr9:127533299chr11:654051ENST00000338675-811383_439426491Compositional biasNote=Pro-rich
TgeneDEAF1chr9:127533299chr11:654051ENST00000382409-9122_122501566Compositional biasNote=Ala-rich
TgeneDEAF1chr9:127533299chr11:654051ENST00000382409-912383_439501566Compositional biasNote=Pro-rich
TgeneDEAF1chr9:127533299chr11:654051ENST00000338675-811193_273426491DomainSAND
TgeneDEAF1chr9:127533299chr11:654051ENST00000382409-912193_273501566DomainSAND
TgeneDEAF1chr9:127533299chr11:654051ENST00000338675-811301_316426491MotifNuclear localization signal
TgeneDEAF1chr9:127533299chr11:654051ENST00000382409-912301_316501566MotifNuclear localization signal


Top

FusionGeneSequence for NR6A1_DEAF1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NR6A1_ENST00000487099_chr9_127533299_-_DEAF1_ENST00000338675_chr11_654051_-_98aa
MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNAVLRXLRPGGYERVHRLPQGQLLLHLLPTQGLEGSPAHMRPVSSCHRPGRRSPRGXK

>In-frame_NR6A1_ENST00000487099_chr9_127533299_-_DEAF1_ENST00000382409_chr11_654051_-_98aa
MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNAVLRXLRPGGYERVHRLPQGQLLLHLLPTQGLEGSPAHMRPVSSCHRPGRRSPRGXK

>In-frame_NR6A1_ENST00000373584_chr9_127533299_-_DEAF1_ENST00000338675_chr11_654051_-_98aa
MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNAVLRXLRPGGYERVHRLPQGQLLLHLLPTQGLEGSPAHMRPVSSCHRPGRRSPRGXK

>In-frame_NR6A1_ENST00000373584_chr9_127533299_-_DEAF1_ENST00000382409_chr11_654051_-_98aa
MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNAVLRXLRPGGYERVHRLPQGQLLLHLLPTQGLEGSPAHMRPVSSCHRPGRRSPRGXK

>In-frame_NR6A1_ENST00000416460_chr9_127533299_-_DEAF1_ENST00000338675_chr11_654051_-_98aa
MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNAVLRXLRPGGYERVHRLPQGQLLLHLLPTQGLEGSPAHMRPVSSCHRPGRRSPRGXK

>In-frame_NR6A1_ENST00000416460_chr9_127533299_-_DEAF1_ENST00000382409_chr11_654051_-_98aa
MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNAVLRXLRPGGYERVHRLPQGQLLLHLLPTQGLEGSPAHMRPVSSCHRPGRRSPRGXK

>In-frame_NR6A1_ENST00000344523_chr9_127533299_-_DEAF1_ENST00000338675_chr11_654051_-_98aa
MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNAVLRXLRPGGYERVHRLPQGQLLLHLLPTQGLEGSPAHMRPVSSCHRPGRRSPRGXK

>In-frame_NR6A1_ENST00000344523_chr9_127533299_-_DEAF1_ENST00000382409_chr11_654051_-_98aa
MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNAVLRXLRPGGYERVHRLPQGQLLLHLLPTQGLEGSPAHMRPVSSCHRPGRRSPRGXK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NR6A1_ENST00000487099_chr9_127533299_-_DEAF1_ENST00000338675_chr11_654051_-_295nt
ATGGAGCGGGACGAACCGCCGCCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGCTCCCTCCGCCG
CCGCGCAACGCAGTCCTGCGTTAACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTG
CCAACGCAAGGACTGGAAGGATCACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCACGTGGCTGAAAG

>In-frame_NR6A1_ENST00000487099_chr9_127533299_-_DEAF1_ENST00000382409_chr11_654051_-_295nt
ATGGAGCGGGACGAACCGCCGCCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGCTCCCTCCGCCG
CCGCGCAACGCAGTCCTGCGTTAACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTG
CCAACGCAAGGACTGGAAGGATCACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCACGTGGCTGAAAG

>In-frame_NR6A1_ENST00000373584_chr9_127533299_-_DEAF1_ENST00000338675_chr11_654051_-_295nt
ATGGAGCGGGACGAACCGCCGCCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGCTCCCTCCGCCG
CCGCGCAACGCAGTCCTGCGTTAACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTG
CCAACGCAAGGACTGGAAGGATCACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCACGTGGCTGAAAG

>In-frame_NR6A1_ENST00000373584_chr9_127533299_-_DEAF1_ENST00000382409_chr11_654051_-_295nt
ATGGAGCGGGACGAACCGCCGCCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGCTCCCTCCGCCG
CCGCGCAACGCAGTCCTGCGTTAACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTG
CCAACGCAAGGACTGGAAGGATCACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCACGTGGCTGAAAG

>In-frame_NR6A1_ENST00000416460_chr9_127533299_-_DEAF1_ENST00000338675_chr11_654051_-_295nt
ATGGAGCGGGACGAACCGCCGCCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGCTCCCTCCGCCG
CCGCGCAACGCAGTCCTGCGTTAACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTG
CCAACGCAAGGACTGGAAGGATCACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCACGTGGCTGAAAG

>In-frame_NR6A1_ENST00000416460_chr9_127533299_-_DEAF1_ENST00000382409_chr11_654051_-_295nt
ATGGAGCGGGACGAACCGCCGCCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGCTCCCTCCGCCG
CCGCGCAACGCAGTCCTGCGTTAACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTG
CCAACGCAAGGACTGGAAGGATCACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCACGTGGCTGAAAG

>In-frame_NR6A1_ENST00000344523_chr9_127533299_-_DEAF1_ENST00000338675_chr11_654051_-_295nt
ATGGAGCGGGACGAACCGCCGCCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGCTCCCTCCGCCG
CCGCGCAACGCAGTCCTGCGTTAACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTG
CCAACGCAAGGACTGGAAGGATCACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCACGTGGCTGAAAG

>In-frame_NR6A1_ENST00000344523_chr9_127533299_-_DEAF1_ENST00000382409_chr11_654051_-_295nt
ATGGAGCGGGACGAACCGCCGCCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGCTCCCTCCGCCG
CCGCGCAACGCAGTCCTGCGTTAACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTG
CCAACGCAAGGACTGGAAGGATCACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCACGTGGCTGAAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_NR6A1_ENST00000487099_chr9_127533299_-_DEAF1_ENST00000338675_chr11_654051_-_770nt
GCGGCGCGGAGCCGGGCGGCTCGGGGCCCAGAGAGAGCCGCGGCCGGGAGCTCGCGGGCTCCTGACAACCTCCTCCCCTCGGCGGACGAC
GACCACGGCGACTAGGGCGCCGGTCATGGCGGAGCAACAAACCCGGCGCGGACCCTAGGCACCACCGCATGGAGCGGGACGAACCGCCGC
CTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGCTCCCTCCGCCGCCGCGCAACGCAGTCCTGCGTT
AACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTGCCAACGCAAGGACTGGAAGGAT
CACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCACGTGGCTGAAAGCGTGATGGAGAAGGTGACCGTG
TGAGGCTCCATCGGCCGCCCTGGGAGCTGGGGCCCCTCGCACTCCTGTGAGGCTTTTGCAGGTCGAAGGCCCCCCTGAGGACTCTGGGGG
GACGTTGAGAAGAGGGGTGTGGGAAGGTAAAGAAACTTGCTGGACAAGTCATTAACACACTTTAAGCGAATGGTGCCCTGGGAAGCGCAC
TCCCCCTGCCCGGGCCCCCTGCCCGCTCGCGGACAGATTTTTTATCCCTGGGATCATGAGCGTCCGGTCTTGCCCACAGGGCCTGTGCTG

>In-frame_NR6A1_ENST00000487099_chr9_127533299_-_DEAF1_ENST00000382409_chr11_654051_-_770nt
GCGGCGCGGAGCCGGGCGGCTCGGGGCCCAGAGAGAGCCGCGGCCGGGAGCTCGCGGGCTCCTGACAACCTCCTCCCCTCGGCGGACGAC
GACCACGGCGACTAGGGCGCCGGTCATGGCGGAGCAACAAACCCGGCGCGGACCCTAGGCACCACCGCATGGAGCGGGACGAACCGCCGC
CTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGCTCCCTCCGCCGCCGCGCAACGCAGTCCTGCGTT
AACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTGCCAACGCAAGGACTGGAAGGAT
CACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCACGTGGCTGAAAGCGTGATGGAGAAGGTGACCGTG
TGAGGCTCCATCGGCCGCCCTGGGAGCTGGGGCCCCTCGCACTCCTGTGAGGCTTTTGCAGGTCGAAGGCCCCCCTGAGGACTCTGGGGG
GACGTTGAGAAGAGGGGTGTGGGAAGGTAAAGAAACTTGCTGGACAAGTCATTAACACACTTTAAGCGAATGGTGCCCTGGGAAGCGCAC
TCCCCCTGCCCGGGCCCCCTGCCCGCTCGCGGACAGATTTTTTATCCCTGGGATCATGAGCGTCCGGTCTTGCCCACAGGGCCTGTGCTG

>In-frame_NR6A1_ENST00000373584_chr9_127533299_-_DEAF1_ENST00000338675_chr11_654051_-_790nt
GCGGCGCGGAGGGGCGCGGAGCGGCGCGGAGCCGGGCGGCTCGGGGCCCAGAGAGAGCCGCGGCCGGGAGCTCGCGGGCTCCTGACAACC
TCCTCCCCTCGGCGGACGACGACCACGGCGACTAGGGCGCCGGTCATGGCGGAGCAACAAACCCGGCGCGGACCCTAGGCACCACCGCAT
GGAGCGGGACGAACCGCCGCCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGCTCCCTCCGCCGCC
GCGCAACGCAGTCCTGCGTTAACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTGCC
AACGCAAGGACTGGAAGGATCACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCACGTGGCTGAAAGCG
TGATGGAGAAGGTGACCGTGTGAGGCTCCATCGGCCGCCCTGGGAGCTGGGGCCCCTCGCACTCCTGTGAGGCTTTTGCAGGTCGAAGGC
CCCCCTGAGGACTCTGGGGGGACGTTGAGAAGAGGGGTGTGGGAAGGTAAAGAAACTTGCTGGACAAGTCATTAACACACTTTAAGCGAA
TGGTGCCCTGGGAAGCGCACTCCCCCTGCCCGGGCCCCCTGCCCGCTCGCGGACAGATTTTTTATCCCTGGGATCATGAGCGTCCGGTCT

>In-frame_NR6A1_ENST00000373584_chr9_127533299_-_DEAF1_ENST00000382409_chr11_654051_-_790nt
GCGGCGCGGAGGGGCGCGGAGCGGCGCGGAGCCGGGCGGCTCGGGGCCCAGAGAGAGCCGCGGCCGGGAGCTCGCGGGCTCCTGACAACC
TCCTCCCCTCGGCGGACGACGACCACGGCGACTAGGGCGCCGGTCATGGCGGAGCAACAAACCCGGCGCGGACCCTAGGCACCACCGCAT
GGAGCGGGACGAACCGCCGCCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGCTCCCTCCGCCGCC
GCGCAACGCAGTCCTGCGTTAACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTGCC
AACGCAAGGACTGGAAGGATCACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCACGTGGCTGAAAGCG
TGATGGAGAAGGTGACCGTGTGAGGCTCCATCGGCCGCCCTGGGAGCTGGGGCCCCTCGCACTCCTGTGAGGCTTTTGCAGGTCGAAGGC
CCCCCTGAGGACTCTGGGGGGACGTTGAGAAGAGGGGTGTGGGAAGGTAAAGAAACTTGCTGGACAAGTCATTAACACACTTTAAGCGAA
TGGTGCCCTGGGAAGCGCACTCCCCCTGCCCGGGCCCCCTGCCCGCTCGCGGACAGATTTTTTATCCCTGGGATCATGAGCGTCCGGTCT

>In-frame_NR6A1_ENST00000416460_chr9_127533299_-_DEAF1_ENST00000338675_chr11_654051_-_803nt
GTGCTGAGGGGGCGCGGCGCGGAGGGGCGCGGAGCGGCGCGGAGCCGGGCGGCTCGGGGCCCAGAGAGAGCCGCGGCCGGGAGCTCGCGG
GCTCCTGACAACCTCCTCCCCTCGGCGGACGACGACCACGGCGACTAGGGCGCCGGTCATGGCGGAGCAACAAACCCGGCGCGGACCCTA
GGCACCACCGCATGGAGCGGGACGAACCGCCGCCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGC
TCCCTCCGCCGCCGCGCAACGCAGTCCTGCGTTAACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGC
TCCACCTTCTGCCAACGCAAGGACTGGAAGGATCACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCAC
GTGGCTGAAAGCGTGATGGAGAAGGTGACCGTGTGAGGCTCCATCGGCCGCCCTGGGAGCTGGGGCCCCTCGCACTCCTGTGAGGCTTTT
GCAGGTCGAAGGCCCCCCTGAGGACTCTGGGGGGACGTTGAGAAGAGGGGTGTGGGAAGGTAAAGAAACTTGCTGGACAAGTCATTAACA
CACTTTAAGCGAATGGTGCCCTGGGAAGCGCACTCCCCCTGCCCGGGCCCCCTGCCCGCTCGCGGACAGATTTTTTATCCCTGGGATCAT

>In-frame_NR6A1_ENST00000416460_chr9_127533299_-_DEAF1_ENST00000382409_chr11_654051_-_803nt
GTGCTGAGGGGGCGCGGCGCGGAGGGGCGCGGAGCGGCGCGGAGCCGGGCGGCTCGGGGCCCAGAGAGAGCCGCGGCCGGGAGCTCGCGG
GCTCCTGACAACCTCCTCCCCTCGGCGGACGACGACCACGGCGACTAGGGCGCCGGTCATGGCGGAGCAACAAACCCGGCGCGGACCCTA
GGCACCACCGCATGGAGCGGGACGAACCGCCGCCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGC
TCCCTCCGCCGCCGCGCAACGCAGTCCTGCGTTAACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGC
TCCACCTTCTGCCAACGCAAGGACTGGAAGGATCACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCAC
GTGGCTGAAAGCGTGATGGAGAAGGTGACCGTGTGAGGCTCCATCGGCCGCCCTGGGAGCTGGGGCCCCTCGCACTCCTGTGAGGCTTTT
GCAGGTCGAAGGCCCCCCTGAGGACTCTGGGGGGACGTTGAGAAGAGGGGTGTGGGAAGGTAAAGAAACTTGCTGGACAAGTCATTAACA
CACTTTAAGCGAATGGTGCCCTGGGAAGCGCACTCCCCCTGCCCGGGCCCCCTGCCCGCTCGCGGACAGATTTTTTATCCCTGGGATCAT

>In-frame_NR6A1_ENST00000344523_chr9_127533299_-_DEAF1_ENST00000338675_chr11_654051_-_780nt
GGGGCGCGGAGCGGCGCGGAGCCGGGCGGCTCGGGGCCCAGAGAGAGCCGCGGCCGGGAGCTCGCGGGCTCCTGACAACCTCCTCCCCTC
GGCGGACGACGACCACGGCGACTAGGGCGCCGGTCATGGCGGAGCAACAAACCCGGCGCGGACCCTAGGCACCACCGCATGGAGCGGGAC
GAACCGCCGCCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGCTCCCTCCGCCGCCGCGCAACGCA
GTCCTGCGTTAACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTGCCAACGCAAGGA
CTGGAAGGATCACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCACGTGGCTGAAAGCGTGATGGAGAA
GGTGACCGTGTGAGGCTCCATCGGCCGCCCTGGGAGCTGGGGCCCCTCGCACTCCTGTGAGGCTTTTGCAGGTCGAAGGCCCCCCTGAGG
ACTCTGGGGGGACGTTGAGAAGAGGGGTGTGGGAAGGTAAAGAAACTTGCTGGACAAGTCATTAACACACTTTAAGCGAATGGTGCCCTG
GGAAGCGCACTCCCCCTGCCCGGGCCCCCTGCCCGCTCGCGGACAGATTTTTTATCCCTGGGATCATGAGCGTCCGGTCTTGCCCACAGG

>In-frame_NR6A1_ENST00000344523_chr9_127533299_-_DEAF1_ENST00000382409_chr11_654051_-_780nt
GGGGCGCGGAGCGGCGCGGAGCCGGGCGGCTCGGGGCCCAGAGAGAGCCGCGGCCGGGAGCTCGCGGGCTCCTGACAACCTCCTCCCCTC
GGCGGACGACGACCACGGCGACTAGGGCGCCGGTCATGGCGGAGCAACAAACCCGGCGCGGACCCTAGGCACCACCGCATGGAGCGGGAC
GAACCGCCGCCTAGCGGAGGGGGAGGCGGCGGGGGCTCGGCGGGGTTCCTGGAGCCTCCCGCCGCGCTCCCTCCGCCGCCGCGCAACGCA
GTCCTGCGTTAACTGCGGCCGGGAGGCTATGAGCGAGTGCACCGGCTGCCACAAGGTCAACTACTGCTCCACCTTCTGCCAACGCAAGGA
CTGGAAGGATCACCAGCACATATGCGGCCAGTCAGCAGCTGTCACCGTCCAGGCAGACGAAGTCCACGTGGCTGAAAGCGTGATGGAGAA
GGTGACCGTGTGAGGCTCCATCGGCCGCCCTGGGAGCTGGGGCCCCTCGCACTCCTGTGAGGCTTTTGCAGGTCGAAGGCCCCCCTGAGG
ACTCTGGGGGGACGTTGAGAAGAGGGGTGTGGGAAGGTAAAGAAACTTGCTGGACAAGTCATTAACACACTTTAAGCGAATGGTGCCCTG
GGAAGCGCACTCCCCCTGCCCGGGCCCCCTGCCCGCTCGCGGACAGATTTTTTATCCCTGGGATCATGAGCGTCCGGTCTTGCCCACAGG


Top

FusionGenePPI for NR6A1_DEAF1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NR6A1NR6A1, UIMC1, NSD1, NCOA1, DNMT3LDEAF1LMO4, ASCC2, RAD23B, AIMP2, TK1, FHL1, CDKN1A, CDC37, PIN1, HRAS, PPP1CA, PPP1CC, GSK3A, GSK3B, PELI1, IRF3, IRF7, CREB1, CDKN2A, HRSP12, PELI2, BSPRY, SP1, SUB1, SP3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneDEAF1chr9:127533299chr11:654051ENST00000338675-811403_478426491LMO4
TgeneDEAF1chr9:127533299chr11:654051ENST00000382409-912403_478501566LMO4


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NR6A1_DEAF1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NR6A1_DEAF1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneDEAF1C0041696Unipolar Depression5PSYGENET
TgeneDEAF1C1269683Major Depressive Disorder5PSYGENET
TgeneDEAF1C0011570Mental Depression4PSYGENET
TgeneDEAF1C0011581Depressive disorder4PSYGENET
TgeneDEAF1C4014414MENTAL RETARDATION, AUTOSOMAL DOMINANT 242UNIPROT
TgeneDEAF1C3714756Intellectual Disability1CTD_human;HPO