FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24578

FusionGeneSummary for NOMO1_MYH11

check button Fusion gene summary
Fusion gene informationFusion gene name: NOMO1_MYH11
Fusion gene ID: 24578
HgeneTgene
Gene symbol

NOMO1

MYH11

Gene ID

23420

4629

Gene nameNODAL modulator 1myosin heavy chain 11
SynonymsNomo|PM5AAT4|FAA4|SMHC|SMMHC
Cytomap

16p13.11

16p13.11

Type of geneprotein-codingprotein-coding
Descriptionnodal modulator 1nodal modulator 3pM5 protein 3pM5 protein, telomeric copymyosin-11myosin heavy chain, smooth muscle isoformmyosin, heavy chain 11, smooth musclemyosin, heavy polypeptide 11, smooth muscle
Modification date2018052320180519
UniProtAcc

Q15155

P35749

Ensembl transtripts involved in fusion geneENST00000287667, ENST00000566883, 
ENST00000396324, ENST00000452625, 
ENST00000576790, ENST00000300036, 
ENST00000573908, 
Fusion gene scores* DoF score2 X 2 X 2=811 X 15 X 6=990
# samples 221
** MAII scorelog2(2/8*10)=1.32192809488736log2(21/990*10)=-2.23703919730085
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NOMO1 [Title/Abstract] AND MYH11 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-E2-A1LE-01ANOMO1chr16

14983072

+MYH11chr16

15917268

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000287667ENST00000396324NOMO1chr16

14983072

+MYH11chr16

15917268

-
In-frameENST00000287667ENST00000452625NOMO1chr16

14983072

+MYH11chr16

15917268

-
In-frameENST00000287667ENST00000576790NOMO1chr16

14983072

+MYH11chr16

15917268

-
In-frameENST00000287667ENST00000300036NOMO1chr16

14983072

+MYH11chr16

15917268

-
5CDS-intronENST00000287667ENST00000573908NOMO1chr16

14983072

+MYH11chr16

15917268

-
intron-3CDSENST00000566883ENST00000396324NOMO1chr16

14983072

+MYH11chr16

15917268

-
intron-3CDSENST00000566883ENST00000452625NOMO1chr16

14983072

+MYH11chr16

15917268

-
intron-3CDSENST00000566883ENST00000576790NOMO1chr16

14983072

+MYH11chr16

15917268

-
intron-3CDSENST00000566883ENST00000300036NOMO1chr16

14983072

+MYH11chr16

15917268

-
intron-intronENST00000566883ENST00000573908NOMO1chr16

14983072

+MYH11chr16

15917268

-

Top

FusionProtFeatures for NOMO1_MYH11


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NOMO1

Q15155

MYH11

P35749

May antagonize Nodal signaling. {ECO:0000250}. Muscle contraction.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMYH11chr16:14983072chr16:15917268ENST00000300036-141844_19341151973Coiled coilOntology_term=ECO:0000255
TgeneMYH11chr16:14983072chr16:15917268ENST00000396324-142844_19341151980Coiled coilOntology_term=ECO:0000255
TgeneMYH11chr16:14983072chr16:15917268ENST00000452625-143844_19341152132Coiled coilOntology_term=ECO:0000255
TgeneMYH11chr16:14983072chr16:15917268ENST00000576790-142844_19341151912Coiled coilOntology_term=ECO:0000255
TgeneMYH11chr16:14983072chr16:15917268ENST00000300036-141786_8151151973DomainIQ
TgeneMYH11chr16:14983072chr16:15917268ENST00000396324-142786_8151151980DomainIQ
TgeneMYH11chr16:14983072chr16:15917268ENST00000452625-143786_8151152132DomainIQ
TgeneMYH11chr16:14983072chr16:15917268ENST00000576790-142786_8151151912DomainIQ
TgeneMYH11chr16:14983072chr16:15917268ENST00000300036-141178_1851151973Nucleotide bindingATP
TgeneMYH11chr16:14983072chr16:15917268ENST00000396324-142178_1851151980Nucleotide bindingATP
TgeneMYH11chr16:14983072chr16:15917268ENST00000452625-143178_1851152132Nucleotide bindingATP
TgeneMYH11chr16:14983072chr16:15917268ENST00000576790-142178_1851151912Nucleotide bindingATP
TgeneMYH11chr16:14983072chr16:15917268ENST00000300036-1411935_19721151973RegionNote=C-terminal
TgeneMYH11chr16:14983072chr16:15917268ENST00000300036-141661_6831151973RegionActin-binding
TgeneMYH11chr16:14983072chr16:15917268ENST00000300036-141762_7761151973RegionActin-binding
TgeneMYH11chr16:14983072chr16:15917268ENST00000396324-1421935_19721151980RegionNote=C-terminal
TgeneMYH11chr16:14983072chr16:15917268ENST00000396324-142661_6831151980RegionActin-binding
TgeneMYH11chr16:14983072chr16:15917268ENST00000396324-142762_7761151980RegionActin-binding
TgeneMYH11chr16:14983072chr16:15917268ENST00000452625-1431935_19721152132RegionNote=C-terminal
TgeneMYH11chr16:14983072chr16:15917268ENST00000452625-143661_6831152132RegionActin-binding
TgeneMYH11chr16:14983072chr16:15917268ENST00000452625-143762_7761152132RegionActin-binding
TgeneMYH11chr16:14983072chr16:15917268ENST00000576790-1421935_19721151912RegionNote=C-terminal
TgeneMYH11chr16:14983072chr16:15917268ENST00000576790-142661_6831151912RegionActin-binding
TgeneMYH11chr16:14983072chr16:15917268ENST00000576790-142762_7761151912RegionActin-binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNOMO1chr16:14983072chr16:15917268ENST00000287667+29311177_122211481223Topological domainCytoplasmic
HgeneNOMO1chr16:14983072chr16:15917268ENST00000287667+293132_115511481223Topological domainExtracellular
HgeneNOMO1chr16:14983072chr16:15917268ENST00000287667+29311156_117611481223TransmembraneHelical
TgeneMYH11chr16:14983072chr16:15917268ENST00000300036-14131_811151973DomainMyosin N-terminal SH3-like
TgeneMYH11chr16:14983072chr16:15917268ENST00000300036-14185_7831151973DomainMyosin motor
TgeneMYH11chr16:14983072chr16:15917268ENST00000396324-14231_811151980DomainMyosin N-terminal SH3-like
TgeneMYH11chr16:14983072chr16:15917268ENST00000396324-14285_7831151980DomainMyosin motor
TgeneMYH11chr16:14983072chr16:15917268ENST00000452625-14331_811152132DomainMyosin N-terminal SH3-like
TgeneMYH11chr16:14983072chr16:15917268ENST00000452625-14385_7831152132DomainMyosin motor
TgeneMYH11chr16:14983072chr16:15917268ENST00000576790-14231_811151912DomainMyosin N-terminal SH3-like
TgeneMYH11chr16:14983072chr16:15917268ENST00000576790-14285_7831151912DomainMyosin motor


Top

FusionGeneSequence for NOMO1_MYH11


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NOMO1_ENST00000287667_chr16_14983072_+_MYH11_ENST00000396324_chr16_15917268_-_3013aa
MLVGQGAGPLGPAVVTAAVVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPLTDKGDFIL
KIEPPLGWSFEPTTVELHVDGVSDICTKGGDINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGD
TEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSSLVTKEDVLGCNVSPVPGFQPQDESLVTLCY
TVSREDGSFSFTSLPSGGYTVIPFTRGERITFDVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGRVLNGPEGDGVPEAVVTLNNQIKVKTK
ADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVCGQISIIRFPDTVKQMNKYKVVLSSQDKDKSLVTVETDAH
GSFCFKAKPGTYKVQVMVPEAETRAGLTLKPQTFPLTVTNRPMMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKV
NAMTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEDDMSAVEFRQTGYMLRCSLSHAITLEFTQDGNGRENVGITNLSKGVNRFCLSK
PGVYKVTPRSCHRFEQAFYTTDTSSPSILTLTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIEARRQE
REKNGNEEGEERMTKPPVQEMVDELQGPFSTDFSYWARSGEKITVTPSSKELLFTPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPE
LEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTSQKEGTVLTAVEGTIGDFKATALAGVSFEIKAEDDQPLPGVLLSLSGG
LFRSNLLTQDNGILTFSNLSPGQTYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCTGTVSSLNGEPEQGVAMEAVGQNDCSI
YGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKS
ENLDNPIQTVSLGQSLFFHFPPLLRDGENTVVLLDSTLPRSQTDYILPQVSFTAVGYHKHITLIFNPTTYSGLFCVVVNPTKHLPIYSEK
IVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFAYGELEKQLLQ
ANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETTLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFL
SNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVSSVLQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPR
IKVGRDVVQKAQTKEQADFAVEALAKATTERLFRWILTRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHT
MFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECWFPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHT
AGKVDTNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRN
TTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNL
YRIGQSKIFFRTGVLAHLEEERDLKITDVIMAFQAMCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQ
EEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAETELTAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQ
LQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKN
KHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHI
SDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTE
QLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAE
GKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEAL
EEGKKRFQKEIENLTQQYEEKAAATDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEARE
KETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQ
ALKGQFERDLQARDEQNEEKRRQLQRQLHETETELEDERKQRALAAAAKKKLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRE
LEDARASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQG
NMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAA
TKSLKQKDKKLKEILLQVEDERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGREVNALKSKLRR

>In-frame_NOMO1_ENST00000287667_chr16_14983072_+_MYH11_ENST00000452625_chr16_15917268_-_2979aa
MLVGQGAGPLGPAVVTAAVVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPLTDKGDFIL
KIEPPLGWSFEPTTVELHVDGVSDICTKGGDINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGD
TEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSSLVTKEDVLGCNVSPVPGFQPQDESLVTLCY
TVSREDGSFSFTSLPSGGYTVIPFTRGERITFDVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGRVLNGPEGDGVPEAVVTLNNQIKVKTK
ADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVCGQISIIRFPDTVKQMNKYKVVLSSQDKDKSLVTVETDAH
GSFCFKAKPGTYKVQVMVPEAETRAGLTLKPQTFPLTVTNRPMMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKV
NAMTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEDDMSAVEFRQTGYMLRCSLSHAITLEFTQDGNGRENVGITNLSKGVNRFCLSK
PGVYKVTPRSCHRFEQAFYTTDTSSPSILTLTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIEARRQE
REKNGNEEGEERMTKPPVQEMVDELQGPFSTDFSYWARSGEKITVTPSSKELLFTPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPE
LEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTSQKEGTVLTAVEGTIGDFKATALAGVSFEIKAEDDQPLPGVLLSLSGG
LFRSNLLTQDNGILTFSNLSPGQTYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCTGTVSSLNGEPEQGVAMEAVGQNDCSI
YGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKS
ENLDNPIQTVSLGQSLFFHFPPLLRDGENTVVLLDSTLPRSQTDYILPQVSFTAVGYHKHITLIFNPTTYSGLFCVVVNPTKHLPIYSEK
IVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFAYGELEKQLLQ
ANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETTLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFL
SNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVSSVLQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPR
IKVGRDVVQKAQTKEQADFAVEALAKATTERLFRWILTRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHT
MFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECWFPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHT
AGKVDTNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRN
TTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNL
YRIGQSKIFFRTGVLAHLEEERDLKITDVIMAFQAMCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQ
EEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAETELTAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQ
LQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKN
KHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHI
SDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTE
QLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAE
GKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEAL
EEGKKRFQKEIENLTQQYEEKAAATDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEARE
KETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQ
ALKGQFERDLQARDEQNEEKRRQLQRQLHETETELEDERKQRALAAAAKKKLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRE
LEDARASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQG
NMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAA
TKSLKQKDKKLKEILLQVEDERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGREVNALKSKLRG

>In-frame_NOMO1_ENST00000287667_chr16_14983072_+_MYH11_ENST00000576790_chr16_15917268_-_2972aa
MLVGQGAGPLGPAVVTAAVVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPLTDKGDFIL
KIEPPLGWSFEPTTVELHVDGVSDICTKGGDINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGD
TEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSSLVTKEDVLGCNVSPVPGFQPQDESLVTLCY
TVSREDGSFSFTSLPSGGYTVIPFTRGERITFDVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGRVLNGPEGDGVPEAVVTLNNQIKVKTK
ADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVCGQISIIRFPDTVKQMNKYKVVLSSQDKDKSLVTVETDAH
GSFCFKAKPGTYKVQVMVPEAETRAGLTLKPQTFPLTVTNRPMMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKV
NAMTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEDDMSAVEFRQTGYMLRCSLSHAITLEFTQDGNGRENVGITNLSKGVNRFCLSK
PGVYKVTPRSCHRFEQAFYTTDTSSPSILTLTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIEARRQE
REKNGNEEGEERMTKPPVQEMVDELQGPFSTDFSYWARSGEKITVTPSSKELLFTPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPE
LEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTSQKEGTVLTAVEGTIGDFKATALAGVSFEIKAEDDQPLPGVLLSLSGG
LFRSNLLTQDNGILTFSNLSPGQTYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCTGTVSSLNGEPEQGVAMEAVGQNDCSI
YGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKS
ENLDNPIQTVSLGQSLFFHFPPLLRDGENTVVLLDSTLPRSQTDYILPQVSFTAVGYHKHITLIFNPTTYSGLFCVVVNPTKHLPIYSEK
IVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITGELEKQLLQANPILEA
FGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETTLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPI
PAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVSSVLQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDV
VQKAQTKEQADFAVEALAKATTERLFRWILTRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFILEQE
EYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECWFPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHTAGKVDTN
ASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRNTTPNFVR
CIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSK
IFFRTGVLAHLEEERDLKITDVIMAFQAMCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAK
EDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAETELTAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKK
MAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESMIS
ELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDL
DSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKR
AKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLA
KDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRF
QKEIENLTQQYEEKAAATDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEAREKETKALS
LARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQALKGQFE
RDLQARDEQNEEKRRQLQRQLHETETELEDERKQRALAAAAKKKLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARAS
RDEIFATAKENEKKAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQGNMEAMSD
RVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQK
DKKLKEILLQVEDERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGREVNALKSKLRGPPPQETS

>In-frame_NOMO1_ENST00000287667_chr16_14983072_+_MYH11_ENST00000300036_chr16_15917268_-_3006aa
MLVGQGAGPLGPAVVTAAVVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPLTDKGDFIL
KIEPPLGWSFEPTTVELHVDGVSDICTKGGDINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGD
TEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSSLVTKEDVLGCNVSPVPGFQPQDESLVTLCY
TVSREDGSFSFTSLPSGGYTVIPFTRGERITFDVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGRVLNGPEGDGVPEAVVTLNNQIKVKTK
ADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVCGQISIIRFPDTVKQMNKYKVVLSSQDKDKSLVTVETDAH
GSFCFKAKPGTYKVQVMVPEAETRAGLTLKPQTFPLTVTNRPMMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKV
NAMTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEDDMSAVEFRQTGYMLRCSLSHAITLEFTQDGNGRENVGITNLSKGVNRFCLSK
PGVYKVTPRSCHRFEQAFYTTDTSSPSILTLTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIEARRQE
REKNGNEEGEERMTKPPVQEMVDELQGPFSTDFSYWARSGEKITVTPSSKELLFTPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPE
LEGVEIVISEKGASSPLITVFTDDKGAYSVGPLHSDLEYTVTSQKEGTVLTAVEGTIGDFKATALAGVSFEIKAEDDQPLPGVLLSLSGG
LFRSNLLTQDNGILTFSNLSPGQTYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTAYSCTGTVSSLNGEPEQGVAMEAVGQNDCSI
YGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKS
ENLDNPIQTVSLGQSLFFHFPPLLRDGENTVVLLDSTLPRSQTDYILPQVSFTAVGYHKHITLIFNPTTYSGLFCVVVNPTKHLPIYSEK
IVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAVVASSHKGKKDTSITGELEKQLLQANPILEA
FGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETTLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPI
PAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVSSVLQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDV
VQKAQTKEQADFAVEALAKATTERLFRWILTRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFILEQE
EYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECWFPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHTAGKVDTN
ASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRNTTPNFVR
CIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSK
IFFRTGVLAHLEEERDLKITDVIMAFQAMCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAK
EDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAETELTAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKK
MAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESMIS
ELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAELKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDL
DSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKR
AKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLA
KDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRF
QKEIENLTQQYEEKAAATDKLEKTKNRLQQELDDLVVDLDNQRQLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEAREKETKALS
LARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQALKGQFE
RDLQARDEQNEEKRRQLQRQLHETETELEDERKQRALAAAAKKKLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARAS
RDEIFATAKENEKKAKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQGNMEAMSD
RVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSKLHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQK
DKKLKEILLQVEDERKMAEQYKEQAEKGNARVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGREVNALKSKLRRGNETSFV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NOMO1_ENST00000287667_chr16_14983072_+_MYH11_ENST00000396324_chr16_15917268_-_9039nt
ATGCTGGTGGGCCAGGGCGCGGGGCCGCTGGGGCCCGCGGTGGTCACCGCCGCGGTGGTGCTGCTGCTGAGCGGCGTGGGGCCGGCGCAC
GGCTCGGAGGACATCGTGGTGGGCTGCGGTGGCTTCGTCAAGTCGGACGTGGAGATCAACTACTCTCTCATCGAGATAAAGCTGTACACC
AAGCATGGGACTTTGAAATACCAGACAGACTGTGCCCCTAATAATGGTTACTTTATGATCCCTTTGTATGATAAGGGGGATTTCATTCTG
AAGATTGAGCCTCCCCTAGGGTGGAGTTTTGAGCCGACGACCGTGGAGCTCCATGTGGATGGAGTCAGTGACATCTGCACAAAGGGTGGG
GACATCAACTTTGTCTTCACTGGGTTCTCTGTGAATGGCAAGGTCCTCAGCAAAGGGCAGCCCCTGGGTCCTGCGGGAGTTCAGGTGTCT
CTGAGAAACACTGGGACCGAAGCAAAGATCCAGTCCACAGTTACACAGCCTGGCGGAAAGTTTGCATTTTTTAAAGTTCTGCCTGGAGAT
TATGAAATCCTCGCAACTCATCCAACCTGGGCGTTGAAAGAGGCAAGCACCACAGTGCGTGTAACCAACTCCAATGCCAATGCGGCCAGT
CCCCTCATAGTTGCTGGCTACAATGTGTCTGGCTCTGTCCGAAGTGATGGGGAGCCCATGAAAGGCGTGAAGTTTCTTCTCTTTTCTTCT
TTAGTAACTAAAGAGGATGTCCTGGGCTGCAATGTCTCACCAGTGCCTGGGTTCCAGCCCCAAGACGAGAGTCTGGTGTATTTGTGCTAC
ACGGTCTCCAGAGAAGATGGCTCGTTCTCTTTCTATTCCTTGCCAAGTGGGGGCTACACTGTGATTCCGTTCTATCGAGGGGAGAGGATT
ACCTTTGATGTGGCGCCTTCCAGACTTGACTTCACAGTGGAGCATGACAGCTTGAAAATCGAGCCCGTGTTCCACGTCATGGGATTCTCC
GTCACCGGGAGGGTCTTGAACGGACCCGAAGGAGATGGTGTTCCAGAAGCAGTAGTCACCCTGAATAACCAAATCAAAGTTAAAACAAAA
GCTGATGGCTCATTCCGCCTTGAGAACATAACCACAGGGACATACACCATCCATGCTCAGAAAGAGCACCTCTACTTTGAAACGGTCACC
ATCAAAATTGCACCGAACACACCTCAGCTGGCTGACATTATTGCAACAGGGTTCAGTGTCTGTGGTCAGATATCAATCATTCGCTTCCCC
GACACCGTCAAGCAGATGAATAAATACAAAGTTGTCCTGTCATCTCAAGACAAGGACAAGTCTTTGGTCACCGTGGAGACAGATGCTCAT
GGATCATTTTGTTTTAAAGCAAAACCAGGGACTTACAAAGTGCAGGTGATGGTTCCTGAGGCAGAAACCAGAGCAGGGCTGACGTTGAAA
CCCCAGACATTTCCTCTTACTGTGACCAACAGGCCCATGATGGATGTGGCCTTTGTACAGTTCTTGGCATCAGTTTCTGGGAAAGTCTCT
TGTTTGGACACCTGTGGTGACTTGCTGGTGACTCTACAGTCCCTGAGCCGCCAGGGTGAGAAGCGGAGCCTCCAGCTCTCCGGCAAGGTC
AACGCCATGACTTTCACCTTTGACAACGTGCTCCCTGGAAAATACAAAATAAGCATCATGCATGAGGATTGGTGCTGGAAGAACAAGAGC
CTGGAGGTGGAAGTGCTGGAGGATGACATGTCTGCAGTTGAGTTCAGGCAGACGGGCTACATGCTGAGATGTTCCCTGTCTCACGCCATC
ACTCTGGAATTTTATCAGGATGGAAATGGGCGTGAGAATGTGGGGATTTATAACCTCTCCAAAGGAGTCAACCGATTCTGCCTGTCCAAG
CCTGGTGTGTACAAAGTGACCCCTCGCTCCTGCCACCGGTTTGAGCAAGCGTTCTACACCTATGACACGTCTTCACCTAGTATCTTGACA
TTGACAGCCATTCGCCACCATGTCCTTGGAACTATCACCACCGACAAAATGATGGATGTCACTGTGACTATCAAGTCTTCCATCGACAGT
GAACCCGCCTTGGTCTTAGGCCCTCTGAAGTCTGTGCAGGAGCTGCGGAGGGAGCAGCAGCTGGCTGAGATCGAGGCCCGCAGGCAGGAG
AGGGAGAAAAACGGCAATGAGGAAGGCGAAGAAAGAATGACCAAGCCTCCCGTGCAGGAGATGGTAGATGAGTTACAAGGCCCCTTCTCG
TATGATTTCTCTTACTGGGCGCGGTCTGGAGAGAAAATCACTGTTACACCGTCATCTAAAGAGCTGCTCTTTTATCCCCCTTCAATGGAA
GCCGTTGTCAGTGGAGAAAGCTGCCCAGGGAAGCTGATCGAGATCCATGGGAAGGCAGGCCTGTTTTTAGAAGGCCAGATCCACCCCGAG
TTGGAAGGAGTCGAGATTGTCATCAGTGAAAAGGGGGCAAGTTCACCGCTGATCACAGTCTTTACTGATGACAAAGGTGCCTACAGTGTT
GGCCCCCTGCACAGTGACCTGGAGTACACGGTGACCTCACAGAAGGAGGGCTATGTTCTGACTGCGGTGGAAGGAACCATCGGAGACTTC
AAGGCCTATGCCCTGGCAGGCGTAAGCTTTGAGATAAAAGCTGAGGATGACCAGCCCCTCCCGGGAGTCCTCTTATCCCTGAGCGGTGGC
CTGTTTCGTTCCAACCTCTTGACCCAGGACAACGGCATTCTGACATTCTCAAACCTGAGCCCTGGCCAGTATTACTTCAAACCCATGATG
AAGGAGTTCCGGTTTGAGCCATCCTCACAGATGATCGAGGTGCAGGAAGGCCAGAACCTGAAGATCACCATCACGGGGTACCGAACCGCT
TACAGTTGCTATGGCACAGTGTCTTCCTTAAACGGAGAGCCCGAACAAGGGGTTGCCATGGAAGCGGTGGGCCAGAACGACTGCAGCATT
TACGGAGAAGACACCGTGACAGACGAAGAGGGCAAGTTCAGATTACGTGGATTGCTGCCGGGATGTGTGTACCACGTTCAGCTCAAGGCA
GAAGGCAACGACCACATTGAGCGGGCGCTCCCCCACCATAGGGTGATTGAGGTTGGGAATAATGACATCGATGATGTAAACATCATAGTT
TTCCGGCAGATTAATCAATTTGATTTAAGTGGAAATGTGATCACTTCCTCTGAATACCTTCCTACATTATGGGTCAAGCTTTACAAAAGC
GAAAACCTCGACAATCCAATCCAGACAGTTTCCCTTGGCCAGTCCCTGTTCTTCCATTTCCCCCCACTGCTCAGAGACGGCGAGAACTAT
GTTGTGCTTCTGGACTCCACACTCCCCAGATCCCAGTATGACTACATCTTGCCTCAAGTTTCTTTCACCGCAGTGGGCTACCATAAACAC
ATCACCTTGATTTTTAATCCCACGACGTACTCTGGCCTCTTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAG
ATCGTCGACATGTACAAGGGCAAGAAGAGGCACGAGATGCCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAA
GATCGGGAGGACCAGTCCATTCTATGCACAGGCGAGTCTGGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTG
GTGGCCTCCTCCCACAAGGGCAAGAAAGACACAAGTATCACGCAAGGCCCATCTTTTGCCTACGGAGAGCTGGAAAAGCAGCTTCTACAA
GCAAACCCGATTCTGGAGGCTTTCGGCAACGCCAAAACAGTGAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTC
GACGTCACGGGTTACATCGTGGGAGCCAACATTGAGACCTATCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACA
TTCCACATCTTTTACTACATGATTGCTGGAGCCAAGGAGAAGATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTC
TCCAATGGCTTTGTGCCCATCCCAGCAGCCCAGGATGATGAGATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAG
GAGGAGCAGCTATCCATATTGAAGGTGGTATCATCGGTCCTGCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCG
TCCATGCCAGATAACACAGCTGCTCAGAAAGTTTGCCACCTCATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGT
ATCAAGGTTGGGCGAGATGTGGTACAGAAAGCTCAGACAAAAGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAG
CGCCTTTTCCGCTGGATACTCACCCGCGTGAACAAAGCCCTGGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATA
GCTGGATTTGAGATCTTTGAGGTGAACTCCTTCGAGCAGCTGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACC
ATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGCATCGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAG
CTCATCGAGCGACCGAACAACCCTCCAGGTGTGCTGGCCCTGCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTG
GAGAAGCTGTGCACGGAGCAGGGCAGCCACCCCAAGTTCCAGAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTAT
GCTGGGAAGGTGGACTATAATGCGAGTGCCTGGCTGACCAAGAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCC
TCCGACAAGTTTGTGGCCGACCTGTGGAAGGACGTGGACCGCATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCC
AGCGCCTCCAAGACCAAGAAGGGCATGTTCCGCACAGTGGGGCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAAC
ACCACGCCCAACTTCGTGCGCTGCATCATCCCCAACCACGAGAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGG
TGCAATGGGGTGCTGGAAGGCATTCGCATCTGCCGGCAGGGCTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATC
CTGGCGGCGAATGCCATCCCCAAAGGCTTCATGGACGGGAAGCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTA
TACAGGATAGGGCAGAGCAAAATCTTCTTCCGAACTGGCGTCCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATC
ATGGCCTTCCAGGCGATGTGTCGTGGCTACTTGGCCAGAAAGGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAG
AGGAACTGCGCCGCCTACCTCAAGCTGCGGAACTGGCAGTGGTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAG
GAGGAGGAGATGCAGGCCAAGGAGGATGAACTGCAGAAGACCAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAG
AAGCACTCGCAGCTGACCGAGGAGAAGAACCTGCTACAGGAACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGG
GTGCGGCTGGCGGCCAAGAAGCAGGAGCTGGAGGAGATACTGCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAG
CTACAGGCTGAAAGGAAGAAGATGGCCCAGCAGATGCTGGACCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAA
CTTGAGAAGGTCACGGCTGAGGCCAAGATCAAGAAACTGGAGGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAA
CGAAAACTCCTTGAGGAGAGGATTAGTGACTTAACGACAAATCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAAC
AAGCATGAATCTATGATTTCAGAACTGGAAGTGCGGCTAAAGAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTG
GAGGGTGATGCCAGCGACTTCCACGAGCAGATCGCTGACCTCCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAG
GAGCTGCAGGCGGCCCTGGCCAGGCTTGACGATGAAATCGCTCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATC
TCAGACCTCCAGGAGGACCTGGACTCAGAGCGGGCCGCCAGGAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCC
CTAAAGACAGAGCTGGAAGACACACTGGACAGCACAGCCACTCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAG
AAGGCCCTGGATGAAGAGACGCGGTCCCATGAGGCTCAGGTCCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAG
CAGCTTGAGCAGTTCAAGAGGGCCAAGGCGAACCTAGACAAGAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTG
CGGGTCCTGGGCCAGGCCAAGCAGGAGGTGGAACATAAGAAGAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGAT
GGGGAGCGGGCCCGGGCGGAGCTCAATGACAAAGTCCACAAGCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAG
GGGAAGGCCATTAAGCTGGCCAAGGACGTGGCGTCCCTCAGTTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAG
AAGCTCAACGTGTCTACGAAGCTGCGCCAGCTGGAGGAGGAGCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAG
AACCTGGAGCGCCACATCTCCACTCTCAACATCCAGCTCTCCGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTG
GAAGAGGGGAAGAAGAGGTTCCAGAAGGAGATCGAGAACCTCACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAG
ACCAAGAACAGGCTTCAGCAGGAGCTGGACGACCTGGTTGTTGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAG
AGGAAATTTGATCAGTTGTTAGCCGAGGAGAAAAACATCTCTTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAG
AAGGAAACCAAGGCCCTGTCCCTGGCTCGGGCCCTTGAAGAGGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAA
GCCGAAATGGAAGACCTGGTCAGCTCCAAGGATGACGTGGGCAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAG
ATGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGACGAGCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAG
GCGCTCAAGGGCCAGTTCGAAAGGGATCTCCAAGCCCGGGACGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAG
TATGAGACGGAACTGGAAGACGAGCGAAAGCAACGTGCCCTGGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAG
CTTCAGGCCGACTCTGCCATCAAGGGGAGGGAGGAAGCCATCAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAG
CTGGAAGATGCCCGTGCCTCCAGAGATGAGATCTTTGCCACAGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATG
CAGCTACAAGAGGACCTCGCCGCCGCTGAGAGGGCTCGCAAACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGC
CTGTCGGGAAGGAACGCACTCCAGGACGAGAAGCGCCGCCTGGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGC
AACATGGAGGCCATGAGCGACCGGGTCCGCAAAGCCACACAGCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCC
CAGAAGAATGAGAGTGCCCGGCAGCAGCTCGAGCGGCAGAACAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCC
AAGTTCAAGTCCACCATCGCGGCGCTGGAGGCCAAGATTGCACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCC
ACCAAGTCGCTGAAGCAGAAAGACAAGAAGCTGAAGGAAATCTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAG
CAGGCAGAGAAAGGCAATGCCAGGGTCAAGCAGCTCAAGAGGCAGCTGGAGGAGGCAGAGGAGGAGTCCCAGCGCATCAACGCCAACCGC
AGGAAGCTGCAGCGGGAGCTGGATGAGGCCACGGAGAGCAACGAGGCCATGGGCCGCGAGGTGAACGCACTCAAGAGCAAGCTCAGGCGA
GGAAACGAGACCTCTTTCGTTCCTTCTAGAAGGTCTGGAGGACGTAGAGTTATTGAAAATGCAGATGGTTCTGAGGAGGAAACGGACACT

>In-frame_NOMO1_ENST00000287667_chr16_14983072_+_MYH11_ENST00000452625_chr16_15917268_-_8937nt
ATGCTGGTGGGCCAGGGCGCGGGGCCGCTGGGGCCCGCGGTGGTCACCGCCGCGGTGGTGCTGCTGCTGAGCGGCGTGGGGCCGGCGCAC
GGCTCGGAGGACATCGTGGTGGGCTGCGGTGGCTTCGTCAAGTCGGACGTGGAGATCAACTACTCTCTCATCGAGATAAAGCTGTACACC
AAGCATGGGACTTTGAAATACCAGACAGACTGTGCCCCTAATAATGGTTACTTTATGATCCCTTTGTATGATAAGGGGGATTTCATTCTG
AAGATTGAGCCTCCCCTAGGGTGGAGTTTTGAGCCGACGACCGTGGAGCTCCATGTGGATGGAGTCAGTGACATCTGCACAAAGGGTGGG
GACATCAACTTTGTCTTCACTGGGTTCTCTGTGAATGGCAAGGTCCTCAGCAAAGGGCAGCCCCTGGGTCCTGCGGGAGTTCAGGTGTCT
CTGAGAAACACTGGGACCGAAGCAAAGATCCAGTCCACAGTTACACAGCCTGGCGGAAAGTTTGCATTTTTTAAAGTTCTGCCTGGAGAT
TATGAAATCCTCGCAACTCATCCAACCTGGGCGTTGAAAGAGGCAAGCACCACAGTGCGTGTAACCAACTCCAATGCCAATGCGGCCAGT
CCCCTCATAGTTGCTGGCTACAATGTGTCTGGCTCTGTCCGAAGTGATGGGGAGCCCATGAAAGGCGTGAAGTTTCTTCTCTTTTCTTCT
TTAGTAACTAAAGAGGATGTCCTGGGCTGCAATGTCTCACCAGTGCCTGGGTTCCAGCCCCAAGACGAGAGTCTGGTGTATTTGTGCTAC
ACGGTCTCCAGAGAAGATGGCTCGTTCTCTTTCTATTCCTTGCCAAGTGGGGGCTACACTGTGATTCCGTTCTATCGAGGGGAGAGGATT
ACCTTTGATGTGGCGCCTTCCAGACTTGACTTCACAGTGGAGCATGACAGCTTGAAAATCGAGCCCGTGTTCCACGTCATGGGATTCTCC
GTCACCGGGAGGGTCTTGAACGGACCCGAAGGAGATGGTGTTCCAGAAGCAGTAGTCACCCTGAATAACCAAATCAAAGTTAAAACAAAA
GCTGATGGCTCATTCCGCCTTGAGAACATAACCACAGGGACATACACCATCCATGCTCAGAAAGAGCACCTCTACTTTGAAACGGTCACC
ATCAAAATTGCACCGAACACACCTCAGCTGGCTGACATTATTGCAACAGGGTTCAGTGTCTGTGGTCAGATATCAATCATTCGCTTCCCC
GACACCGTCAAGCAGATGAATAAATACAAAGTTGTCCTGTCATCTCAAGACAAGGACAAGTCTTTGGTCACCGTGGAGACAGATGCTCAT
GGATCATTTTGTTTTAAAGCAAAACCAGGGACTTACAAAGTGCAGGTGATGGTTCCTGAGGCAGAAACCAGAGCAGGGCTGACGTTGAAA
CCCCAGACATTTCCTCTTACTGTGACCAACAGGCCCATGATGGATGTGGCCTTTGTACAGTTCTTGGCATCAGTTTCTGGGAAAGTCTCT
TGTTTGGACACCTGTGGTGACTTGCTGGTGACTCTACAGTCCCTGAGCCGCCAGGGTGAGAAGCGGAGCCTCCAGCTCTCCGGCAAGGTC
AACGCCATGACTTTCACCTTTGACAACGTGCTCCCTGGAAAATACAAAATAAGCATCATGCATGAGGATTGGTGCTGGAAGAACAAGAGC
CTGGAGGTGGAAGTGCTGGAGGATGACATGTCTGCAGTTGAGTTCAGGCAGACGGGCTACATGCTGAGATGTTCCCTGTCTCACGCCATC
ACTCTGGAATTTTATCAGGATGGAAATGGGCGTGAGAATGTGGGGATTTATAACCTCTCCAAAGGAGTCAACCGATTCTGCCTGTCCAAG
CCTGGTGTGTACAAAGTGACCCCTCGCTCCTGCCACCGGTTTGAGCAAGCGTTCTACACCTATGACACGTCTTCACCTAGTATCTTGACA
TTGACAGCCATTCGCCACCATGTCCTTGGAACTATCACCACCGACAAAATGATGGATGTCACTGTGACTATCAAGTCTTCCATCGACAGT
GAACCCGCCTTGGTCTTAGGCCCTCTGAAGTCTGTGCAGGAGCTGCGGAGGGAGCAGCAGCTGGCTGAGATCGAGGCCCGCAGGCAGGAG
AGGGAGAAAAACGGCAATGAGGAAGGCGAAGAAAGAATGACCAAGCCTCCCGTGCAGGAGATGGTAGATGAGTTACAAGGCCCCTTCTCG
TATGATTTCTCTTACTGGGCGCGGTCTGGAGAGAAAATCACTGTTACACCGTCATCTAAAGAGCTGCTCTTTTATCCCCCTTCAATGGAA
GCCGTTGTCAGTGGAGAAAGCTGCCCAGGGAAGCTGATCGAGATCCATGGGAAGGCAGGCCTGTTTTTAGAAGGCCAGATCCACCCCGAG
TTGGAAGGAGTCGAGATTGTCATCAGTGAAAAGGGGGCAAGTTCACCGCTGATCACAGTCTTTACTGATGACAAAGGTGCCTACAGTGTT
GGCCCCCTGCACAGTGACCTGGAGTACACGGTGACCTCACAGAAGGAGGGCTATGTTCTGACTGCGGTGGAAGGAACCATCGGAGACTTC
AAGGCCTATGCCCTGGCAGGCGTAAGCTTTGAGATAAAAGCTGAGGATGACCAGCCCCTCCCGGGAGTCCTCTTATCCCTGAGCGGTGGC
CTGTTTCGTTCCAACCTCTTGACCCAGGACAACGGCATTCTGACATTCTCAAACCTGAGCCCTGGCCAGTATTACTTCAAACCCATGATG
AAGGAGTTCCGGTTTGAGCCATCCTCACAGATGATCGAGGTGCAGGAAGGCCAGAACCTGAAGATCACCATCACGGGGTACCGAACCGCT
TACAGTTGCTATGGCACAGTGTCTTCCTTAAACGGAGAGCCCGAACAAGGGGTTGCCATGGAAGCGGTGGGCCAGAACGACTGCAGCATT
TACGGAGAAGACACCGTGACAGACGAAGAGGGCAAGTTCAGATTACGTGGATTGCTGCCGGGATGTGTGTACCACGTTCAGCTCAAGGCA
GAAGGCAACGACCACATTGAGCGGGCGCTCCCCCACCATAGGGTGATTGAGGTTGGGAATAATGACATCGATGATGTAAACATCATAGTT
TTCCGGCAGATTAATCAATTTGATTTAAGTGGAAATGTGATCACTTCCTCTGAATACCTTCCTACATTATGGGTCAAGCTTTACAAAAGC
GAAAACCTCGACAATCCAATCCAGACAGTTTCCCTTGGCCAGTCCCTGTTCTTCCATTTCCCCCCACTGCTCAGAGACGGCGAGAACTAT
GTTGTGCTTCTGGACTCCACACTCCCCAGATCCCAGTATGACTACATCTTGCCTCAAGTTTCTTTCACCGCAGTGGGCTACCATAAACAC
ATCACCTTGATTTTTAATCCCACGACGTACTCTGGCCTCTTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAG
ATCGTCGACATGTACAAGGGCAAGAAGAGGCACGAGATGCCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAA
GATCGGGAGGACCAGTCCATTCTATGCACAGGCGAGTCTGGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTG
GTGGCCTCCTCCCACAAGGGCAAGAAAGACACAAGTATCACGCAAGGCCCATCTTTTGCCTACGGAGAGCTGGAAAAGCAGCTTCTACAA
GCAAACCCGATTCTGGAGGCTTTCGGCAACGCCAAAACAGTGAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTC
GACGTCACGGGTTACATCGTGGGAGCCAACATTGAGACCTATCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACA
TTCCACATCTTTTACTACATGATTGCTGGAGCCAAGGAGAAGATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTC
TCCAATGGCTTTGTGCCCATCCCAGCAGCCCAGGATGATGAGATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAG
GAGGAGCAGCTATCCATATTGAAGGTGGTATCATCGGTCCTGCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCG
TCCATGCCAGATAACACAGCTGCTCAGAAAGTTTGCCACCTCATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGT
ATCAAGGTTGGGCGAGATGTGGTACAGAAAGCTCAGACAAAAGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAG
CGCCTTTTCCGCTGGATACTCACCCGCGTGAACAAAGCCCTGGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATA
GCTGGATTTGAGATCTTTGAGGTGAACTCCTTCGAGCAGCTGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACC
ATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGCATCGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAG
CTCATCGAGCGACCGAACAACCCTCCAGGTGTGCTGGCCCTGCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTG
GAGAAGCTGTGCACGGAGCAGGGCAGCCACCCCAAGTTCCAGAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTAT
GCTGGGAAGGTGGACTATAATGCGAGTGCCTGGCTGACCAAGAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCC
TCCGACAAGTTTGTGGCCGACCTGTGGAAGGACGTGGACCGCATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCC
AGCGCCTCCAAGACCAAGAAGGGCATGTTCCGCACAGTGGGGCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAAC
ACCACGCCCAACTTCGTGCGCTGCATCATCCCCAACCACGAGAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGG
TGCAATGGGGTGCTGGAAGGCATTCGCATCTGCCGGCAGGGCTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATC
CTGGCGGCGAATGCCATCCCCAAAGGCTTCATGGACGGGAAGCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTA
TACAGGATAGGGCAGAGCAAAATCTTCTTCCGAACTGGCGTCCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATC
ATGGCCTTCCAGGCGATGTGTCGTGGCTACTTGGCCAGAAAGGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAG
AGGAACTGCGCCGCCTACCTCAAGCTGCGGAACTGGCAGTGGTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAG
GAGGAGGAGATGCAGGCCAAGGAGGATGAACTGCAGAAGACCAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAG
AAGCACTCGCAGCTGACCGAGGAGAAGAACCTGCTACAGGAACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGG
GTGCGGCTGGCGGCCAAGAAGCAGGAGCTGGAGGAGATACTGCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAG
CTACAGGCTGAAAGGAAGAAGATGGCCCAGCAGATGCTGGACCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAA
CTTGAGAAGGTCACGGCTGAGGCCAAGATCAAGAAACTGGAGGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAA
CGAAAACTCCTTGAGGAGAGGATTAGTGACTTAACGACAAATCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAAC
AAGCATGAATCTATGATTTCAGAACTGGAAGTGCGGCTAAAGAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTG
GAGGGTGATGCCAGCGACTTCCACGAGCAGATCGCTGACCTCCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAG
GAGCTGCAGGCGGCCCTGGCCAGGCTTGACGATGAAATCGCTCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATC
TCAGACCTCCAGGAGGACCTGGACTCAGAGCGGGCCGCCAGGAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCC
CTAAAGACAGAGCTGGAAGACACACTGGACAGCACAGCCACTCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAG
AAGGCCCTGGATGAAGAGACGCGGTCCCATGAGGCTCAGGTCCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAG
CAGCTTGAGCAGTTCAAGAGGGCCAAGGCGAACCTAGACAAGAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTG
CGGGTCCTGGGCCAGGCCAAGCAGGAGGTGGAACATAAGAAGAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGAT
GGGGAGCGGGCCCGGGCGGAGCTCAATGACAAAGTCCACAAGCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAG
GGGAAGGCCATTAAGCTGGCCAAGGACGTGGCGTCCCTCAGTTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAG
AAGCTCAACGTGTCTACGAAGCTGCGCCAGCTGGAGGAGGAGCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAG
AACCTGGAGCGCCACATCTCCACTCTCAACATCCAGCTCTCCGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTG
GAAGAGGGGAAGAAGAGGTTCCAGAAGGAGATCGAGAACCTCACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAG
ACCAAGAACAGGCTTCAGCAGGAGCTGGACGACCTGGTTGTTGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAG
AGGAAATTTGATCAGTTGTTAGCCGAGGAGAAAAACATCTCTTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAG
AAGGAAACCAAGGCCCTGTCCCTGGCTCGGGCCCTTGAAGAGGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAA
GCCGAAATGGAAGACCTGGTCAGCTCCAAGGATGACGTGGGCAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAG
ATGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGACGAGCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAG
GCGCTCAAGGGCCAGTTCGAAAGGGATCTCCAAGCCCGGGACGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAG
TATGAGACGGAACTGGAAGACGAGCGAAAGCAACGTGCCCTGGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAG
CTTCAGGCCGACTCTGCCATCAAGGGGAGGGAGGAAGCCATCAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAG
CTGGAAGATGCCCGTGCCTCCAGAGATGAGATCTTTGCCACAGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATG
CAGCTACAAGAGGACCTCGCCGCCGCTGAGAGGGCTCGCAAACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGC
CTGTCGGGAAGGAACGCACTCCAGGACGAGAAGCGCCGCCTGGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGC
AACATGGAGGCCATGAGCGACCGGGTCCGCAAAGCCACACAGCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCC
CAGAAGAATGAGAGTGCCCGGCAGCAGCTCGAGCGGCAGAACAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCC
AAGTTCAAGTCCACCATCGCGGCGCTGGAGGCCAAGATTGCACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCC
ACCAAGTCGCTGAAGCAGAAAGACAAGAAGCTGAAGGAAATCTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAG
CAGGCAGAGAAAGGCAATGCCAGGGTCAAGCAGCTCAAGAGGCAGCTGGAGGAGGCAGAGGAGGAGTCCCAGCGCATCAACGCCAACCGC
AGGAAGCTGCAGCGGGAGCTGGATGAGGCCACGGAGAGCAACGAGGCCATGGGCCGCGAGGTGAACGCACTCAAGAGCAAGCTCAGAGGG

>In-frame_NOMO1_ENST00000287667_chr16_14983072_+_MYH11_ENST00000576790_chr16_15917268_-_8916nt
ATGCTGGTGGGCCAGGGCGCGGGGCCGCTGGGGCCCGCGGTGGTCACCGCCGCGGTGGTGCTGCTGCTGAGCGGCGTGGGGCCGGCGCAC
GGCTCGGAGGACATCGTGGTGGGCTGCGGTGGCTTCGTCAAGTCGGACGTGGAGATCAACTACTCTCTCATCGAGATAAAGCTGTACACC
AAGCATGGGACTTTGAAATACCAGACAGACTGTGCCCCTAATAATGGTTACTTTATGATCCCTTTGTATGATAAGGGGGATTTCATTCTG
AAGATTGAGCCTCCCCTAGGGTGGAGTTTTGAGCCGACGACCGTGGAGCTCCATGTGGATGGAGTCAGTGACATCTGCACAAAGGGTGGG
GACATCAACTTTGTCTTCACTGGGTTCTCTGTGAATGGCAAGGTCCTCAGCAAAGGGCAGCCCCTGGGTCCTGCGGGAGTTCAGGTGTCT
CTGAGAAACACTGGGACCGAAGCAAAGATCCAGTCCACAGTTACACAGCCTGGCGGAAAGTTTGCATTTTTTAAAGTTCTGCCTGGAGAT
TATGAAATCCTCGCAACTCATCCAACCTGGGCGTTGAAAGAGGCAAGCACCACAGTGCGTGTAACCAACTCCAATGCCAATGCGGCCAGT
CCCCTCATAGTTGCTGGCTACAATGTGTCTGGCTCTGTCCGAAGTGATGGGGAGCCCATGAAAGGCGTGAAGTTTCTTCTCTTTTCTTCT
TTAGTAACTAAAGAGGATGTCCTGGGCTGCAATGTCTCACCAGTGCCTGGGTTCCAGCCCCAAGACGAGAGTCTGGTGTATTTGTGCTAC
ACGGTCTCCAGAGAAGATGGCTCGTTCTCTTTCTATTCCTTGCCAAGTGGGGGCTACACTGTGATTCCGTTCTATCGAGGGGAGAGGATT
ACCTTTGATGTGGCGCCTTCCAGACTTGACTTCACAGTGGAGCATGACAGCTTGAAAATCGAGCCCGTGTTCCACGTCATGGGATTCTCC
GTCACCGGGAGGGTCTTGAACGGACCCGAAGGAGATGGTGTTCCAGAAGCAGTAGTCACCCTGAATAACCAAATCAAAGTTAAAACAAAA
GCTGATGGCTCATTCCGCCTTGAGAACATAACCACAGGGACATACACCATCCATGCTCAGAAAGAGCACCTCTACTTTGAAACGGTCACC
ATCAAAATTGCACCGAACACACCTCAGCTGGCTGACATTATTGCAACAGGGTTCAGTGTCTGTGGTCAGATATCAATCATTCGCTTCCCC
GACACCGTCAAGCAGATGAATAAATACAAAGTTGTCCTGTCATCTCAAGACAAGGACAAGTCTTTGGTCACCGTGGAGACAGATGCTCAT
GGATCATTTTGTTTTAAAGCAAAACCAGGGACTTACAAAGTGCAGGTGATGGTTCCTGAGGCAGAAACCAGAGCAGGGCTGACGTTGAAA
CCCCAGACATTTCCTCTTACTGTGACCAACAGGCCCATGATGGATGTGGCCTTTGTACAGTTCTTGGCATCAGTTTCTGGGAAAGTCTCT
TGTTTGGACACCTGTGGTGACTTGCTGGTGACTCTACAGTCCCTGAGCCGCCAGGGTGAGAAGCGGAGCCTCCAGCTCTCCGGCAAGGTC
AACGCCATGACTTTCACCTTTGACAACGTGCTCCCTGGAAAATACAAAATAAGCATCATGCATGAGGATTGGTGCTGGAAGAACAAGAGC
CTGGAGGTGGAAGTGCTGGAGGATGACATGTCTGCAGTTGAGTTCAGGCAGACGGGCTACATGCTGAGATGTTCCCTGTCTCACGCCATC
ACTCTGGAATTTTATCAGGATGGAAATGGGCGTGAGAATGTGGGGATTTATAACCTCTCCAAAGGAGTCAACCGATTCTGCCTGTCCAAG
CCTGGTGTGTACAAAGTGACCCCTCGCTCCTGCCACCGGTTTGAGCAAGCGTTCTACACCTATGACACGTCTTCACCTAGTATCTTGACA
TTGACAGCCATTCGCCACCATGTCCTTGGAACTATCACCACCGACAAAATGATGGATGTCACTGTGACTATCAAGTCTTCCATCGACAGT
GAACCCGCCTTGGTCTTAGGCCCTCTGAAGTCTGTGCAGGAGCTGCGGAGGGAGCAGCAGCTGGCTGAGATCGAGGCCCGCAGGCAGGAG
AGGGAGAAAAACGGCAATGAGGAAGGCGAAGAAAGAATGACCAAGCCTCCCGTGCAGGAGATGGTAGATGAGTTACAAGGCCCCTTCTCG
TATGATTTCTCTTACTGGGCGCGGTCTGGAGAGAAAATCACTGTTACACCGTCATCTAAAGAGCTGCTCTTTTATCCCCCTTCAATGGAA
GCCGTTGTCAGTGGAGAAAGCTGCCCAGGGAAGCTGATCGAGATCCATGGGAAGGCAGGCCTGTTTTTAGAAGGCCAGATCCACCCCGAG
TTGGAAGGAGTCGAGATTGTCATCAGTGAAAAGGGGGCAAGTTCACCGCTGATCACAGTCTTTACTGATGACAAAGGTGCCTACAGTGTT
GGCCCCCTGCACAGTGACCTGGAGTACACGGTGACCTCACAGAAGGAGGGCTATGTTCTGACTGCGGTGGAAGGAACCATCGGAGACTTC
AAGGCCTATGCCCTGGCAGGCGTAAGCTTTGAGATAAAAGCTGAGGATGACCAGCCCCTCCCGGGAGTCCTCTTATCCCTGAGCGGTGGC
CTGTTTCGTTCCAACCTCTTGACCCAGGACAACGGCATTCTGACATTCTCAAACCTGAGCCCTGGCCAGTATTACTTCAAACCCATGATG
AAGGAGTTCCGGTTTGAGCCATCCTCACAGATGATCGAGGTGCAGGAAGGCCAGAACCTGAAGATCACCATCACGGGGTACCGAACCGCT
TACAGTTGCTATGGCACAGTGTCTTCCTTAAACGGAGAGCCCGAACAAGGGGTTGCCATGGAAGCGGTGGGCCAGAACGACTGCAGCATT
TACGGAGAAGACACCGTGACAGACGAAGAGGGCAAGTTCAGATTACGTGGATTGCTGCCGGGATGTGTGTACCACGTTCAGCTCAAGGCA
GAAGGCAACGACCACATTGAGCGGGCGCTCCCCCACCATAGGGTGATTGAGGTTGGGAATAATGACATCGATGATGTAAACATCATAGTT
TTCCGGCAGATTAATCAATTTGATTTAAGTGGAAATGTGATCACTTCCTCTGAATACCTTCCTACATTATGGGTCAAGCTTTACAAAAGC
GAAAACCTCGACAATCCAATCCAGACAGTTTCCCTTGGCCAGTCCCTGTTCTTCCATTTCCCCCCACTGCTCAGAGACGGCGAGAACTAT
GTTGTGCTTCTGGACTCCACACTCCCCAGATCCCAGTATGACTACATCTTGCCTCAAGTTTCTTTCACCGCAGTGGGCTACCATAAACAC
ATCACCTTGATTTTTAATCCCACGACGTACTCTGGCCTCTTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAG
ATCGTCGACATGTACAAGGGCAAGAAGAGGCACGAGATGCCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAA
GATCGGGAGGACCAGTCCATTCTATGCACAGGCGAGTCTGGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTG
GTGGCCTCCTCCCACAAGGGCAAGAAAGACACAAGTATCACGGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCT
TTCGGCAACGCCAAAACAGTGAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTG
GGAGCCAACATTGAGACCTATCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATG
ATTGCTGGAGCCAAGGAGAAGATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATC
CCAGCAGCCCAGGATGATGAGATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTG
AAGGTGGTATCATCGGTCCTGCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCT
GCTCAGAAAGTTTGCCACCTCATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTG
GTACAGAAAGCTCAGACAAAAGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTC
ACCCGCGTGAACAAAGCCCTGGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAG
GTGAACTCCTTCGAGCAGCTGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAG
GAGTACCAGCGCGAGGGCATCGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAAC
CCTCCAGGTGTGCTGGCCCTGCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAG
GGCAGCCACCCCAAGTTCCAGAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAAT
GCGAGTGCCTGGCTGACCAAGAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGAC
CTGTGGAAGGACGTGGACCGCATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAG
GGCATGTTCCGCACAGTGGGGCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGC
TGCATCATCCCCAACCACGAGAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGC
ATTCGCATCTGCCGGCAGGGCTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCC
AAAGGCTTCATGGACGGGAAGCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAA
ATCTTCTTCCGAACTGGCGTCCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGT
CGTGGCTACTTGGCCAGAAAGGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTC
AAGCTGCGGAACTGGCAGTGGTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAG
GAGGATGAACTGCAGAAGACCAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAG
GAGAAGAACCTGCTACAGGAACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAG
CAGGAGCTGGAGGAGATACTGCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAG
ATGGCCCAGCAGATGCTGGACCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAG
GCCAAGATCAAGAAACTGGAGGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGG
ATTAGTGACTTAACGACAAATCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCA
GAACTGGAAGTGCGGCTAAAGAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTC
CACGAGCAGATCGCTGACCTCCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCC
AGGCTTGACGATGAAATCGCTCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTG
GACTCAGAGCGGGCCGCCAGGAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGAC
ACACTGGACAGCACAGCCACTCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACG
CGGTCCCATGAGGCTCAGGTCCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGG
GCCAAGGCGAACCTAGACAAGAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAG
CAGGAGGTGGAACATAAGAAGAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAG
CTCAATGACAAAGTCCACAAGCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCC
AAGGACGTGGCGTCCCTCAGTTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAG
CTGCGCCAGCTGGAGGAGGAGCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCC
ACTCTCAACATCCAGCTCTCCGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTC
CAGAAGGAGATCGAGAACCTCACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAG
GAGCTGGACGACCTGGTTGTTGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTA
GCCGAGGAGAAAAACATCTCTTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCC
CTGGCTCGGGCCCTTGAAGAGGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTC
AGCTCCAAGGATGACGTGGGCAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAG
CTGGAAGAGCTGGAGGACGAGCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAA
AGGGATCTCCAAGCCCGGGACGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGAC
GAGCGAAAGCAACGTGCCCTGGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATC
AAGGGGAGGGAGGAAGCCATCAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCC
AGAGATGAGATCTTTGCCACAGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCC
GCCGCTGAGAGGGCTCGCAAACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTC
CAGGACGAGAAGCGCCGCCTGGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGAC
CGGGTCCGCAAAGCCACACAGCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGG
CAGCAGCTCGAGCGGCAGAACAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCG
GCGCTGGAGGCCAAGATTGCACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAA
GACAAGAAGCTGAAGGAAATCTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGGCAGAGAAAGGCAATGCC
AGGGTCAAGCAGCTCAAGAGGCAGCTGGAGGAGGCAGAGGAGGAGTCCCAGCGCATCAACGCCAACCGCAGGAAGCTGCAGCGGGAGCTG
GATGAGGCCACGGAGAGCAACGAGGCCATGGGCCGCGAGGTGAACGCACTCAAGAGCAAGCTCAGAGGGCCCCCCCCACAGGAAACTTCG

>In-frame_NOMO1_ENST00000287667_chr16_14983072_+_MYH11_ENST00000300036_chr16_15917268_-_9018nt
ATGCTGGTGGGCCAGGGCGCGGGGCCGCTGGGGCCCGCGGTGGTCACCGCCGCGGTGGTGCTGCTGCTGAGCGGCGTGGGGCCGGCGCAC
GGCTCGGAGGACATCGTGGTGGGCTGCGGTGGCTTCGTCAAGTCGGACGTGGAGATCAACTACTCTCTCATCGAGATAAAGCTGTACACC
AAGCATGGGACTTTGAAATACCAGACAGACTGTGCCCCTAATAATGGTTACTTTATGATCCCTTTGTATGATAAGGGGGATTTCATTCTG
AAGATTGAGCCTCCCCTAGGGTGGAGTTTTGAGCCGACGACCGTGGAGCTCCATGTGGATGGAGTCAGTGACATCTGCACAAAGGGTGGG
GACATCAACTTTGTCTTCACTGGGTTCTCTGTGAATGGCAAGGTCCTCAGCAAAGGGCAGCCCCTGGGTCCTGCGGGAGTTCAGGTGTCT
CTGAGAAACACTGGGACCGAAGCAAAGATCCAGTCCACAGTTACACAGCCTGGCGGAAAGTTTGCATTTTTTAAAGTTCTGCCTGGAGAT
TATGAAATCCTCGCAACTCATCCAACCTGGGCGTTGAAAGAGGCAAGCACCACAGTGCGTGTAACCAACTCCAATGCCAATGCGGCCAGT
CCCCTCATAGTTGCTGGCTACAATGTGTCTGGCTCTGTCCGAAGTGATGGGGAGCCCATGAAAGGCGTGAAGTTTCTTCTCTTTTCTTCT
TTAGTAACTAAAGAGGATGTCCTGGGCTGCAATGTCTCACCAGTGCCTGGGTTCCAGCCCCAAGACGAGAGTCTGGTGTATTTGTGCTAC
ACGGTCTCCAGAGAAGATGGCTCGTTCTCTTTCTATTCCTTGCCAAGTGGGGGCTACACTGTGATTCCGTTCTATCGAGGGGAGAGGATT
ACCTTTGATGTGGCGCCTTCCAGACTTGACTTCACAGTGGAGCATGACAGCTTGAAAATCGAGCCCGTGTTCCACGTCATGGGATTCTCC
GTCACCGGGAGGGTCTTGAACGGACCCGAAGGAGATGGTGTTCCAGAAGCAGTAGTCACCCTGAATAACCAAATCAAAGTTAAAACAAAA
GCTGATGGCTCATTCCGCCTTGAGAACATAACCACAGGGACATACACCATCCATGCTCAGAAAGAGCACCTCTACTTTGAAACGGTCACC
ATCAAAATTGCACCGAACACACCTCAGCTGGCTGACATTATTGCAACAGGGTTCAGTGTCTGTGGTCAGATATCAATCATTCGCTTCCCC
GACACCGTCAAGCAGATGAATAAATACAAAGTTGTCCTGTCATCTCAAGACAAGGACAAGTCTTTGGTCACCGTGGAGACAGATGCTCAT
GGATCATTTTGTTTTAAAGCAAAACCAGGGACTTACAAAGTGCAGGTGATGGTTCCTGAGGCAGAAACCAGAGCAGGGCTGACGTTGAAA
CCCCAGACATTTCCTCTTACTGTGACCAACAGGCCCATGATGGATGTGGCCTTTGTACAGTTCTTGGCATCAGTTTCTGGGAAAGTCTCT
TGTTTGGACACCTGTGGTGACTTGCTGGTGACTCTACAGTCCCTGAGCCGCCAGGGTGAGAAGCGGAGCCTCCAGCTCTCCGGCAAGGTC
AACGCCATGACTTTCACCTTTGACAACGTGCTCCCTGGAAAATACAAAATAAGCATCATGCATGAGGATTGGTGCTGGAAGAACAAGAGC
CTGGAGGTGGAAGTGCTGGAGGATGACATGTCTGCAGTTGAGTTCAGGCAGACGGGCTACATGCTGAGATGTTCCCTGTCTCACGCCATC
ACTCTGGAATTTTATCAGGATGGAAATGGGCGTGAGAATGTGGGGATTTATAACCTCTCCAAAGGAGTCAACCGATTCTGCCTGTCCAAG
CCTGGTGTGTACAAAGTGACCCCTCGCTCCTGCCACCGGTTTGAGCAAGCGTTCTACACCTATGACACGTCTTCACCTAGTATCTTGACA
TTGACAGCCATTCGCCACCATGTCCTTGGAACTATCACCACCGACAAAATGATGGATGTCACTGTGACTATCAAGTCTTCCATCGACAGT
GAACCCGCCTTGGTCTTAGGCCCTCTGAAGTCTGTGCAGGAGCTGCGGAGGGAGCAGCAGCTGGCTGAGATCGAGGCCCGCAGGCAGGAG
AGGGAGAAAAACGGCAATGAGGAAGGCGAAGAAAGAATGACCAAGCCTCCCGTGCAGGAGATGGTAGATGAGTTACAAGGCCCCTTCTCG
TATGATTTCTCTTACTGGGCGCGGTCTGGAGAGAAAATCACTGTTACACCGTCATCTAAAGAGCTGCTCTTTTATCCCCCTTCAATGGAA
GCCGTTGTCAGTGGAGAAAGCTGCCCAGGGAAGCTGATCGAGATCCATGGGAAGGCAGGCCTGTTTTTAGAAGGCCAGATCCACCCCGAG
TTGGAAGGAGTCGAGATTGTCATCAGTGAAAAGGGGGCAAGTTCACCGCTGATCACAGTCTTTACTGATGACAAAGGTGCCTACAGTGTT
GGCCCCCTGCACAGTGACCTGGAGTACACGGTGACCTCACAGAAGGAGGGCTATGTTCTGACTGCGGTGGAAGGAACCATCGGAGACTTC
AAGGCCTATGCCCTGGCAGGCGTAAGCTTTGAGATAAAAGCTGAGGATGACCAGCCCCTCCCGGGAGTCCTCTTATCCCTGAGCGGTGGC
CTGTTTCGTTCCAACCTCTTGACCCAGGACAACGGCATTCTGACATTCTCAAACCTGAGCCCTGGCCAGTATTACTTCAAACCCATGATG
AAGGAGTTCCGGTTTGAGCCATCCTCACAGATGATCGAGGTGCAGGAAGGCCAGAACCTGAAGATCACCATCACGGGGTACCGAACCGCT
TACAGTTGCTATGGCACAGTGTCTTCCTTAAACGGAGAGCCCGAACAAGGGGTTGCCATGGAAGCGGTGGGCCAGAACGACTGCAGCATT
TACGGAGAAGACACCGTGACAGACGAAGAGGGCAAGTTCAGATTACGTGGATTGCTGCCGGGATGTGTGTACCACGTTCAGCTCAAGGCA
GAAGGCAACGACCACATTGAGCGGGCGCTCCCCCACCATAGGGTGATTGAGGTTGGGAATAATGACATCGATGATGTAAACATCATAGTT
TTCCGGCAGATTAATCAATTTGATTTAAGTGGAAATGTGATCACTTCCTCTGAATACCTTCCTACATTATGGGTCAAGCTTTACAAAAGC
GAAAACCTCGACAATCCAATCCAGACAGTTTCCCTTGGCCAGTCCCTGTTCTTCCATTTCCCCCCACTGCTCAGAGACGGCGAGAACTAT
GTTGTGCTTCTGGACTCCACACTCCCCAGATCCCAGTATGACTACATCTTGCCTCAAGTTTCTTTCACCGCAGTGGGCTACCATAAACAC
ATCACCTTGATTTTTAATCCCACGACGTACTCTGGCCTCTTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAG
ATCGTCGACATGTACAAGGGCAAGAAGAGGCACGAGATGCCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAA
GATCGGGAGGACCAGTCCATTCTATGCACAGGCGAGTCTGGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTG
GTGGCCTCCTCCCACAAGGGCAAGAAAGACACAAGTATCACGGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCT
TTCGGCAACGCCAAAACAGTGAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTG
GGAGCCAACATTGAGACCTATCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATG
ATTGCTGGAGCCAAGGAGAAGATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATC
CCAGCAGCCCAGGATGATGAGATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTG
AAGGTGGTATCATCGGTCCTGCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCT
GCTCAGAAAGTTTGCCACCTCATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTG
GTACAGAAAGCTCAGACAAAAGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTC
ACCCGCGTGAACAAAGCCCTGGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAG
GTGAACTCCTTCGAGCAGCTGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAG
GAGTACCAGCGCGAGGGCATCGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAAC
CCTCCAGGTGTGCTGGCCCTGCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAG
GGCAGCCACCCCAAGTTCCAGAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAAT
GCGAGTGCCTGGCTGACCAAGAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGAC
CTGTGGAAGGACGTGGACCGCATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAG
GGCATGTTCCGCACAGTGGGGCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGC
TGCATCATCCCCAACCACGAGAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGC
ATTCGCATCTGCCGGCAGGGCTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCC
AAAGGCTTCATGGACGGGAAGCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAA
ATCTTCTTCCGAACTGGCGTCCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGT
CGTGGCTACTTGGCCAGAAAGGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTC
AAGCTGCGGAACTGGCAGTGGTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAG
GAGGATGAACTGCAGAAGACCAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAG
GAGAAGAACCTGCTACAGGAACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAG
CAGGAGCTGGAGGAGATACTGCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAG
ATGGCCCAGCAGATGCTGGACCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAG
GCCAAGATCAAGAAACTGGAGGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGG
ATTAGTGACTTAACGACAAATCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCA
GAACTGGAAGTGCGGCTAAAGAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTC
CACGAGCAGATCGCTGACCTCCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCC
AGGCTTGACGATGAAATCGCTCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTG
GACTCAGAGCGGGCCGCCAGGAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGAC
ACACTGGACAGCACAGCCACTCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACG
CGGTCCCATGAGGCTCAGGTCCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGG
GCCAAGGCGAACCTAGACAAGAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAG
CAGGAGGTGGAACATAAGAAGAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAG
CTCAATGACAAAGTCCACAAGCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCC
AAGGACGTGGCGTCCCTCAGTTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAG
CTGCGCCAGCTGGAGGAGGAGCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCC
ACTCTCAACATCCAGCTCTCCGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTC
CAGAAGGAGATCGAGAACCTCACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAG
GAGCTGGACGACCTGGTTGTTGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTA
GCCGAGGAGAAAAACATCTCTTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCC
CTGGCTCGGGCCCTTGAAGAGGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTC
AGCTCCAAGGATGACGTGGGCAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAG
CTGGAAGAGCTGGAGGACGAGCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAA
AGGGATCTCCAAGCCCGGGACGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGAC
GAGCGAAAGCAACGTGCCCTGGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATC
AAGGGGAGGGAGGAAGCCATCAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCC
AGAGATGAGATCTTTGCCACAGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCC
GCCGCTGAGAGGGCTCGCAAACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTC
CAGGACGAGAAGCGCCGCCTGGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGAC
CGGGTCCGCAAAGCCACACAGCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGG
CAGCAGCTCGAGCGGCAGAACAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCG
GCGCTGGAGGCCAAGATTGCACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAA
GACAAGAAGCTGAAGGAAATCTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGGCAGAGAAAGGCAATGCC
AGGGTCAAGCAGCTCAAGAGGCAGCTGGAGGAGGCAGAGGAGGAGTCCCAGCGCATCAACGCCAACCGCAGGAAGCTGCAGCGGGAGCTG
GATGAGGCCACGGAGAGCAACGAGGCCATGGGCCGCGAGGTGAACGCACTCAAGAGCAAGCTCAGGCGAGGAAACGAGACCTCTTTCGTT
CCTTCTAGAAGGTCTGGAGGACGTAGAGTTATTGAAAATGCAGATGGTTCTGAGGAGGAAACGGACACTCGAGACGCAGACTTCAATGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_NOMO1_ENST00000287667_chr16_14983072_+_MYH11_ENST00000396324_chr16_15917268_-_10029nt
CTGGGGCTGTGAACGTGGGGTCGAAGCGCGCGTGCGCGGCGGCTCTGGCGGCGGCGGTGGGGCGGGGCCTGGGCTGTCAGCCGGCCTAGG
AGGAGGAAGGAGCCTGCGGCGTGCAGTGTGAGGGGCGGGACCCGGCTGCCGGCGGTGGGTCTAGCTGGGGGAGGTCGGGCCATGCTGGTG
GGCCAGGGCGCGGGGCCGCTGGGGCCCGCGGTGGTCACCGCCGCGGTGGTGCTGCTGCTGAGCGGCGTGGGGCCGGCGCACGGCTCGGAG
GACATCGTGGTGGGCTGCGGTGGCTTCGTCAAGTCGGACGTGGAGATCAACTACTCTCTCATCGAGATAAAGCTGTACACCAAGCATGGG
ACTTTGAAATACCAGACAGACTGTGCCCCTAATAATGGTTACTTTATGATCCCTTTGTATGATAAGGGGGATTTCATTCTGAAGATTGAG
CCTCCCCTAGGGTGGAGTTTTGAGCCGACGACCGTGGAGCTCCATGTGGATGGAGTCAGTGACATCTGCACAAAGGGTGGGGACATCAAC
TTTGTCTTCACTGGGTTCTCTGTGAATGGCAAGGTCCTCAGCAAAGGGCAGCCCCTGGGTCCTGCGGGAGTTCAGGTGTCTCTGAGAAAC
ACTGGGACCGAAGCAAAGATCCAGTCCACAGTTACACAGCCTGGCGGAAAGTTTGCATTTTTTAAAGTTCTGCCTGGAGATTATGAAATC
CTCGCAACTCATCCAACCTGGGCGTTGAAAGAGGCAAGCACCACAGTGCGTGTAACCAACTCCAATGCCAATGCGGCCAGTCCCCTCATA
GTTGCTGGCTACAATGTGTCTGGCTCTGTCCGAAGTGATGGGGAGCCCATGAAAGGCGTGAAGTTTCTTCTCTTTTCTTCTTTAGTAACT
AAAGAGGATGTCCTGGGCTGCAATGTCTCACCAGTGCCTGGGTTCCAGCCCCAAGACGAGAGTCTGGTGTATTTGTGCTACACGGTCTCC
AGAGAAGATGGCTCGTTCTCTTTCTATTCCTTGCCAAGTGGGGGCTACACTGTGATTCCGTTCTATCGAGGGGAGAGGATTACCTTTGAT
GTGGCGCCTTCCAGACTTGACTTCACAGTGGAGCATGACAGCTTGAAAATCGAGCCCGTGTTCCACGTCATGGGATTCTCCGTCACCGGG
AGGGTCTTGAACGGACCCGAAGGAGATGGTGTTCCAGAAGCAGTAGTCACCCTGAATAACCAAATCAAAGTTAAAACAAAAGCTGATGGC
TCATTCCGCCTTGAGAACATAACCACAGGGACATACACCATCCATGCTCAGAAAGAGCACCTCTACTTTGAAACGGTCACCATCAAAATT
GCACCGAACACACCTCAGCTGGCTGACATTATTGCAACAGGGTTCAGTGTCTGTGGTCAGATATCAATCATTCGCTTCCCCGACACCGTC
AAGCAGATGAATAAATACAAAGTTGTCCTGTCATCTCAAGACAAGGACAAGTCTTTGGTCACCGTGGAGACAGATGCTCATGGATCATTT
TGTTTTAAAGCAAAACCAGGGACTTACAAAGTGCAGGTGATGGTTCCTGAGGCAGAAACCAGAGCAGGGCTGACGTTGAAACCCCAGACA
TTTCCTCTTACTGTGACCAACAGGCCCATGATGGATGTGGCCTTTGTACAGTTCTTGGCATCAGTTTCTGGGAAAGTCTCTTGTTTGGAC
ACCTGTGGTGACTTGCTGGTGACTCTACAGTCCCTGAGCCGCCAGGGTGAGAAGCGGAGCCTCCAGCTCTCCGGCAAGGTCAACGCCATG
ACTTTCACCTTTGACAACGTGCTCCCTGGAAAATACAAAATAAGCATCATGCATGAGGATTGGTGCTGGAAGAACAAGAGCCTGGAGGTG
GAAGTGCTGGAGGATGACATGTCTGCAGTTGAGTTCAGGCAGACGGGCTACATGCTGAGATGTTCCCTGTCTCACGCCATCACTCTGGAA
TTTTATCAGGATGGAAATGGGCGTGAGAATGTGGGGATTTATAACCTCTCCAAAGGAGTCAACCGATTCTGCCTGTCCAAGCCTGGTGTG
TACAAAGTGACCCCTCGCTCCTGCCACCGGTTTGAGCAAGCGTTCTACACCTATGACACGTCTTCACCTAGTATCTTGACATTGACAGCC
ATTCGCCACCATGTCCTTGGAACTATCACCACCGACAAAATGATGGATGTCACTGTGACTATCAAGTCTTCCATCGACAGTGAACCCGCC
TTGGTCTTAGGCCCTCTGAAGTCTGTGCAGGAGCTGCGGAGGGAGCAGCAGCTGGCTGAGATCGAGGCCCGCAGGCAGGAGAGGGAGAAA
AACGGCAATGAGGAAGGCGAAGAAAGAATGACCAAGCCTCCCGTGCAGGAGATGGTAGATGAGTTACAAGGCCCCTTCTCGTATGATTTC
TCTTACTGGGCGCGGTCTGGAGAGAAAATCACTGTTACACCGTCATCTAAAGAGCTGCTCTTTTATCCCCCTTCAATGGAAGCCGTTGTC
AGTGGAGAAAGCTGCCCAGGGAAGCTGATCGAGATCCATGGGAAGGCAGGCCTGTTTTTAGAAGGCCAGATCCACCCCGAGTTGGAAGGA
GTCGAGATTGTCATCAGTGAAAAGGGGGCAAGTTCACCGCTGATCACAGTCTTTACTGATGACAAAGGTGCCTACAGTGTTGGCCCCCTG
CACAGTGACCTGGAGTACACGGTGACCTCACAGAAGGAGGGCTATGTTCTGACTGCGGTGGAAGGAACCATCGGAGACTTCAAGGCCTAT
GCCCTGGCAGGCGTAAGCTTTGAGATAAAAGCTGAGGATGACCAGCCCCTCCCGGGAGTCCTCTTATCCCTGAGCGGTGGCCTGTTTCGT
TCCAACCTCTTGACCCAGGACAACGGCATTCTGACATTCTCAAACCTGAGCCCTGGCCAGTATTACTTCAAACCCATGATGAAGGAGTTC
CGGTTTGAGCCATCCTCACAGATGATCGAGGTGCAGGAAGGCCAGAACCTGAAGATCACCATCACGGGGTACCGAACCGCTTACAGTTGC
TATGGCACAGTGTCTTCCTTAAACGGAGAGCCCGAACAAGGGGTTGCCATGGAAGCGGTGGGCCAGAACGACTGCAGCATTTACGGAGAA
GACACCGTGACAGACGAAGAGGGCAAGTTCAGATTACGTGGATTGCTGCCGGGATGTGTGTACCACGTTCAGCTCAAGGCAGAAGGCAAC
GACCACATTGAGCGGGCGCTCCCCCACCATAGGGTGATTGAGGTTGGGAATAATGACATCGATGATGTAAACATCATAGTTTTCCGGCAG
ATTAATCAATTTGATTTAAGTGGAAATGTGATCACTTCCTCTGAATACCTTCCTACATTATGGGTCAAGCTTTACAAAAGCGAAAACCTC
GACAATCCAATCCAGACAGTTTCCCTTGGCCAGTCCCTGTTCTTCCATTTCCCCCCACTGCTCAGAGACGGCGAGAACTATGTTGTGCTT
CTGGACTCCACACTCCCCAGATCCCAGTATGACTACATCTTGCCTCAAGTTTCTTTCACCGCAGTGGGCTACCATAAACACATCACCTTG
ATTTTTAATCCCACGACGTACTCTGGCCTCTTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGAC
ATGTACAAGGGCAAGAAGAGGCACGAGATGCCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAG
GACCAGTCCATTCTATGCACAGGCGAGTCTGGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCC
TCCCACAAGGGCAAGAAAGACACAAGTATCACGCAAGGCCCATCTTTTGCCTACGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCG
ATTCTGGAGGCTTTCGGCAACGCCAAAACAGTGAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACG
GGTTACATCGTGGGAGCCAACATTGAGACCTATCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATC
TTTTACTACATGATTGCTGGAGCCAAGGAGAAGATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGC
TTTGTGCCCATCCCAGCAGCCCAGGATGATGAGATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAG
CTATCCATATTGAAGGTGGTATCATCGGTCCTGCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCA
GATAACACAGCTGCTCAGAAAGTTTGCCACCTCATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTT
GGGCGAGATGTGGTACAGAAAGCTCAGACAAAAGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTC
CGCTGGATACTCACCCGCGTGAACAAAGCCCTGGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTT
GAGATCTTTGAGGTGAACTCCTTCGAGCAGCTGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATC
CTGGAGCAGGAGGAGTACCAGCGCGAGGGCATCGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAG
CGACCGAACAACCCTCCAGGTGTGCTGGCCCTGCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTG
TGCACGGAGCAGGGCAGCCACCCCAAGTTCCAGAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAG
GTGGACTATAATGCGAGTGCCTGGCTGACCAAGAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAG
TTTGTGGCCGACCTGTGGAAGGACGTGGACCGCATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCC
AAGACCAAGAAGGGCATGTTCCGCACAGTGGGGCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCC
AACTTCGTGCGCTGCATCATCCCCAACCACGAGAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGG
GTGCTGGAAGGCATTCGCATCTGCCGGCAGGGCTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCG
AATGCCATCCCCAAAGGCTTCATGGACGGGAAGCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATA
GGGCAGAGCAAAATCTTCTTCCGAACTGGCGTCCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTC
CAGGCGATGTGTCGTGGCTACTTGGCCAGAAAGGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGC
GCCGCCTACCTCAAGCTGCGGAACTGGCAGTGGTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAG
ATGCAGGCCAAGGAGGATGAACTGCAGAAGACCAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCG
CAGCTGACCGAGGAGAAGAACCTGCTACAGGAACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTG
GCGGCCAAGAAGCAGGAGCTGGAGGAGATACTGCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCT
GAAAGGAAGAAGATGGCCCAGCAGATGCTGGACCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAG
GTCACGGCTGAGGCCAAGATCAAGAAACTGGAGGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTC
CTTGAGGAGAGGATTAGTGACTTAACGACAAATCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAA
TCTATGATTTCAGAACTGGAAGTGCGGCTAAAGAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGAT
GCCAGCGACTTCCACGAGCAGATCGCTGACCTCCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAG
GCGGCCCTGGCCAGGCTTGACGATGAAATCGCTCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTC
CAGGAGGACCTGGACTCAGAGCGGGCCGCCAGGAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACA
GAGCTGGAAGACACACTGGACAGCACAGCCACTCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTG
GATGAAGAGACGCGGTCCCATGAGGCTCAGGTCCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAG
CAGTTCAAGAGGGCCAAGGCGAACCTAGACAAGAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTG
GGCCAGGCCAAGCAGGAGGTGGAACATAAGAAGAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGG
GCCCGGGCGGAGCTCAATGACAAAGTCCACAAGCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCC
ATTAAGCTGGCCAAGGACGTGGCGTCCCTCAGTTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAAC
GTGTCTACGAAGCTGCGCCAGCTGGAGGAGGAGCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAG
CGCCACATCTCCACTCTCAACATCCAGCTCTCCGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGG
AAGAAGAGGTTCCAGAAGGAGATCGAGAACCTCACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAAC
AGGCTTCAGCAGGAGCTGGACGACCTGGTTGTTGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTT
GATCAGTTGTTAGCCGAGGAGAAAAACATCTCTTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACC
AAGGCCCTGTCCCTGGCTCGGGCCCTTGAAGAGGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATG
GAAGACCTGGTCAGCTCCAAGGATGACGTGGGCAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAG
ATGAAGACGCAGCTGGAAGAGCTGGAGGACGAGCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAG
GGCCAGTTCGAAAGGGATCTCCAAGCCCGGGACGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACG
GAACTGGAAGACGAGCGAAAGCAACGTGCCCTGGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCC
GACTCTGCCATCAAGGGGAGGGAGGAAGCCATCAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGAT
GCCCGTGCCTCCAGAGATGAGATCTTTGCCACAGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAA
GAGGACCTCGCCGCCGCTGAGAGGGCTCGCAAACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGA
AGGAACGCACTCCAGGACGAGAAGCGCCGCCTGGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAG
GCCATGAGCGACCGGGTCCGCAAAGCCACACAGCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAAT
GAGAGTGCCCGGCAGCAGCTCGAGCGGCAGAACAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAG
TCCACCATCGCGGCGCTGGAGGCCAAGATTGCACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCG
CTGAAGCAGAAAGACAAGAAGCTGAAGGAAATCTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGGCAGAG
AAAGGCAATGCCAGGGTCAAGCAGCTCAAGAGGCAGCTGGAGGAGGCAGAGGAGGAGTCCCAGCGCATCAACGCCAACCGCAGGAAGCTG
CAGCGGGAGCTGGATGAGGCCACGGAGAGCAACGAGGCCATGGGCCGCGAGGTGAACGCACTCAAGAGCAAGCTCAGGCGAGGAAACGAG
ACCTCTTTCGTTCCTTCTAGAAGGTCTGGAGGACGTAGAGTTATTGAAAATGCAGATGGTTCTGAGGAGGAAACGGACACTCGAGACGCA
GACTTCAATGGAACCAAGGCCAGTGAATAAGCAACTTTCTACAGTTTTGCACCACGGCAAGAAAACCAAAAACCAAAACAAACAAACAAA
AAAAACCCAACAACAACCCAGAACAAAGCAAAACCCAGCAGACTGTACTTAGCATTGTCTAAATCCATTCTCAAATTCCAAATATCACAG
ACACCCCTCACACAAGGAATATAAAAACCACCACCCTCCAGCCTGGGCAACGTAGTAAAACCTCATCTATACAAGAATTTAAAAATAAGC
TGGGCGTGGTGGTACACACCTGTGGTCCCAGCTACTAGGGAGGCTGAGCCAGGAAGAACGCTCCAGCCCAGGACTTCGAGGCTGCAATGA
GCTATAATTGCATCATTGCACTCCAGCCTGGGCAACAGAGACCCTGTCTCAACCACCACCACCACCACCACCCCTACTACCCCTGTATTC
AAGGTAAAAATTGAAGTTTGTATGATGTAAGAGATGAGAAAAACCCAACAGGAAACACAGACACATCCTCCAGTTCTATCAATGGATTGT
GCAGACACTGAGTTTTTAGAAAAACATATCCACGGTAACCGGTCCCTGGCAATTCTGTTTACATGAAATGGGGAGAAAGTCACCGAAATG
GGTGCCGCCGGCCCCCACTCCCAATTCATTCCCTAACCTGCAAACCTTTCCAACTTCTCACGTCAGGCCTTTGAGAATTCTTTCCCCCTC
TCCTGGTTTCCACACCTCAGACACGCACAGTTCACCAAGTGCCTTCTGTAGTCACATGAATTGAAAAGGAGACGCTGCTCCCACGGAGGG

>In-frame_NOMO1_ENST00000287667_chr16_14983072_+_MYH11_ENST00000452625_chr16_15917268_-_10068nt
CTGGGGCTGTGAACGTGGGGTCGAAGCGCGCGTGCGCGGCGGCTCTGGCGGCGGCGGTGGGGCGGGGCCTGGGCTGTCAGCCGGCCTAGG
AGGAGGAAGGAGCCTGCGGCGTGCAGTGTGAGGGGCGGGACCCGGCTGCCGGCGGTGGGTCTAGCTGGGGGAGGTCGGGCCATGCTGGTG
GGCCAGGGCGCGGGGCCGCTGGGGCCCGCGGTGGTCACCGCCGCGGTGGTGCTGCTGCTGAGCGGCGTGGGGCCGGCGCACGGCTCGGAG
GACATCGTGGTGGGCTGCGGTGGCTTCGTCAAGTCGGACGTGGAGATCAACTACTCTCTCATCGAGATAAAGCTGTACACCAAGCATGGG
ACTTTGAAATACCAGACAGACTGTGCCCCTAATAATGGTTACTTTATGATCCCTTTGTATGATAAGGGGGATTTCATTCTGAAGATTGAG
CCTCCCCTAGGGTGGAGTTTTGAGCCGACGACCGTGGAGCTCCATGTGGATGGAGTCAGTGACATCTGCACAAAGGGTGGGGACATCAAC
TTTGTCTTCACTGGGTTCTCTGTGAATGGCAAGGTCCTCAGCAAAGGGCAGCCCCTGGGTCCTGCGGGAGTTCAGGTGTCTCTGAGAAAC
ACTGGGACCGAAGCAAAGATCCAGTCCACAGTTACACAGCCTGGCGGAAAGTTTGCATTTTTTAAAGTTCTGCCTGGAGATTATGAAATC
CTCGCAACTCATCCAACCTGGGCGTTGAAAGAGGCAAGCACCACAGTGCGTGTAACCAACTCCAATGCCAATGCGGCCAGTCCCCTCATA
GTTGCTGGCTACAATGTGTCTGGCTCTGTCCGAAGTGATGGGGAGCCCATGAAAGGCGTGAAGTTTCTTCTCTTTTCTTCTTTAGTAACT
AAAGAGGATGTCCTGGGCTGCAATGTCTCACCAGTGCCTGGGTTCCAGCCCCAAGACGAGAGTCTGGTGTATTTGTGCTACACGGTCTCC
AGAGAAGATGGCTCGTTCTCTTTCTATTCCTTGCCAAGTGGGGGCTACACTGTGATTCCGTTCTATCGAGGGGAGAGGATTACCTTTGAT
GTGGCGCCTTCCAGACTTGACTTCACAGTGGAGCATGACAGCTTGAAAATCGAGCCCGTGTTCCACGTCATGGGATTCTCCGTCACCGGG
AGGGTCTTGAACGGACCCGAAGGAGATGGTGTTCCAGAAGCAGTAGTCACCCTGAATAACCAAATCAAAGTTAAAACAAAAGCTGATGGC
TCATTCCGCCTTGAGAACATAACCACAGGGACATACACCATCCATGCTCAGAAAGAGCACCTCTACTTTGAAACGGTCACCATCAAAATT
GCACCGAACACACCTCAGCTGGCTGACATTATTGCAACAGGGTTCAGTGTCTGTGGTCAGATATCAATCATTCGCTTCCCCGACACCGTC
AAGCAGATGAATAAATACAAAGTTGTCCTGTCATCTCAAGACAAGGACAAGTCTTTGGTCACCGTGGAGACAGATGCTCATGGATCATTT
TGTTTTAAAGCAAAACCAGGGACTTACAAAGTGCAGGTGATGGTTCCTGAGGCAGAAACCAGAGCAGGGCTGACGTTGAAACCCCAGACA
TTTCCTCTTACTGTGACCAACAGGCCCATGATGGATGTGGCCTTTGTACAGTTCTTGGCATCAGTTTCTGGGAAAGTCTCTTGTTTGGAC
ACCTGTGGTGACTTGCTGGTGACTCTACAGTCCCTGAGCCGCCAGGGTGAGAAGCGGAGCCTCCAGCTCTCCGGCAAGGTCAACGCCATG
ACTTTCACCTTTGACAACGTGCTCCCTGGAAAATACAAAATAAGCATCATGCATGAGGATTGGTGCTGGAAGAACAAGAGCCTGGAGGTG
GAAGTGCTGGAGGATGACATGTCTGCAGTTGAGTTCAGGCAGACGGGCTACATGCTGAGATGTTCCCTGTCTCACGCCATCACTCTGGAA
TTTTATCAGGATGGAAATGGGCGTGAGAATGTGGGGATTTATAACCTCTCCAAAGGAGTCAACCGATTCTGCCTGTCCAAGCCTGGTGTG
TACAAAGTGACCCCTCGCTCCTGCCACCGGTTTGAGCAAGCGTTCTACACCTATGACACGTCTTCACCTAGTATCTTGACATTGACAGCC
ATTCGCCACCATGTCCTTGGAACTATCACCACCGACAAAATGATGGATGTCACTGTGACTATCAAGTCTTCCATCGACAGTGAACCCGCC
TTGGTCTTAGGCCCTCTGAAGTCTGTGCAGGAGCTGCGGAGGGAGCAGCAGCTGGCTGAGATCGAGGCCCGCAGGCAGGAGAGGGAGAAA
AACGGCAATGAGGAAGGCGAAGAAAGAATGACCAAGCCTCCCGTGCAGGAGATGGTAGATGAGTTACAAGGCCCCTTCTCGTATGATTTC
TCTTACTGGGCGCGGTCTGGAGAGAAAATCACTGTTACACCGTCATCTAAAGAGCTGCTCTTTTATCCCCCTTCAATGGAAGCCGTTGTC
AGTGGAGAAAGCTGCCCAGGGAAGCTGATCGAGATCCATGGGAAGGCAGGCCTGTTTTTAGAAGGCCAGATCCACCCCGAGTTGGAAGGA
GTCGAGATTGTCATCAGTGAAAAGGGGGCAAGTTCACCGCTGATCACAGTCTTTACTGATGACAAAGGTGCCTACAGTGTTGGCCCCCTG
CACAGTGACCTGGAGTACACGGTGACCTCACAGAAGGAGGGCTATGTTCTGACTGCGGTGGAAGGAACCATCGGAGACTTCAAGGCCTAT
GCCCTGGCAGGCGTAAGCTTTGAGATAAAAGCTGAGGATGACCAGCCCCTCCCGGGAGTCCTCTTATCCCTGAGCGGTGGCCTGTTTCGT
TCCAACCTCTTGACCCAGGACAACGGCATTCTGACATTCTCAAACCTGAGCCCTGGCCAGTATTACTTCAAACCCATGATGAAGGAGTTC
CGGTTTGAGCCATCCTCACAGATGATCGAGGTGCAGGAAGGCCAGAACCTGAAGATCACCATCACGGGGTACCGAACCGCTTACAGTTGC
TATGGCACAGTGTCTTCCTTAAACGGAGAGCCCGAACAAGGGGTTGCCATGGAAGCGGTGGGCCAGAACGACTGCAGCATTTACGGAGAA
GACACCGTGACAGACGAAGAGGGCAAGTTCAGATTACGTGGATTGCTGCCGGGATGTGTGTACCACGTTCAGCTCAAGGCAGAAGGCAAC
GACCACATTGAGCGGGCGCTCCCCCACCATAGGGTGATTGAGGTTGGGAATAATGACATCGATGATGTAAACATCATAGTTTTCCGGCAG
ATTAATCAATTTGATTTAAGTGGAAATGTGATCACTTCCTCTGAATACCTTCCTACATTATGGGTCAAGCTTTACAAAAGCGAAAACCTC
GACAATCCAATCCAGACAGTTTCCCTTGGCCAGTCCCTGTTCTTCCATTTCCCCCCACTGCTCAGAGACGGCGAGAACTATGTTGTGCTT
CTGGACTCCACACTCCCCAGATCCCAGTATGACTACATCTTGCCTCAAGTTTCTTTCACCGCAGTGGGCTACCATAAACACATCACCTTG
ATTTTTAATCCCACGACGTACTCTGGCCTCTTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGAC
ATGTACAAGGGCAAGAAGAGGCACGAGATGCCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAG
GACCAGTCCATTCTATGCACAGGCGAGTCTGGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCC
TCCCACAAGGGCAAGAAAGACACAAGTATCACGCAAGGCCCATCTTTTGCCTACGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCG
ATTCTGGAGGCTTTCGGCAACGCCAAAACAGTGAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACG
GGTTACATCGTGGGAGCCAACATTGAGACCTATCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATC
TTTTACTACATGATTGCTGGAGCCAAGGAGAAGATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGC
TTTGTGCCCATCCCAGCAGCCCAGGATGATGAGATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAG
CTATCCATATTGAAGGTGGTATCATCGGTCCTGCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCA
GATAACACAGCTGCTCAGAAAGTTTGCCACCTCATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTT
GGGCGAGATGTGGTACAGAAAGCTCAGACAAAAGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTC
CGCTGGATACTCACCCGCGTGAACAAAGCCCTGGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTT
GAGATCTTTGAGGTGAACTCCTTCGAGCAGCTGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATC
CTGGAGCAGGAGGAGTACCAGCGCGAGGGCATCGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAG
CGACCGAACAACCCTCCAGGTGTGCTGGCCCTGCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTG
TGCACGGAGCAGGGCAGCCACCCCAAGTTCCAGAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAG
GTGGACTATAATGCGAGTGCCTGGCTGACCAAGAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAG
TTTGTGGCCGACCTGTGGAAGGACGTGGACCGCATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCC
AAGACCAAGAAGGGCATGTTCCGCACAGTGGGGCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCC
AACTTCGTGCGCTGCATCATCCCCAACCACGAGAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGG
GTGCTGGAAGGCATTCGCATCTGCCGGCAGGGCTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCG
AATGCCATCCCCAAAGGCTTCATGGACGGGAAGCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATA
GGGCAGAGCAAAATCTTCTTCCGAACTGGCGTCCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTC
CAGGCGATGTGTCGTGGCTACTTGGCCAGAAAGGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGC
GCCGCCTACCTCAAGCTGCGGAACTGGCAGTGGTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAG
ATGCAGGCCAAGGAGGATGAACTGCAGAAGACCAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCG
CAGCTGACCGAGGAGAAGAACCTGCTACAGGAACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTG
GCGGCCAAGAAGCAGGAGCTGGAGGAGATACTGCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCT
GAAAGGAAGAAGATGGCCCAGCAGATGCTGGACCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAG
GTCACGGCTGAGGCCAAGATCAAGAAACTGGAGGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTC
CTTGAGGAGAGGATTAGTGACTTAACGACAAATCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAA
TCTATGATTTCAGAACTGGAAGTGCGGCTAAAGAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGAT
GCCAGCGACTTCCACGAGCAGATCGCTGACCTCCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAG
GCGGCCCTGGCCAGGCTTGACGATGAAATCGCTCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTC
CAGGAGGACCTGGACTCAGAGCGGGCCGCCAGGAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACA
GAGCTGGAAGACACACTGGACAGCACAGCCACTCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTG
GATGAAGAGACGCGGTCCCATGAGGCTCAGGTCCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAG
CAGTTCAAGAGGGCCAAGGCGAACCTAGACAAGAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTG
GGCCAGGCCAAGCAGGAGGTGGAACATAAGAAGAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGG
GCCCGGGCGGAGCTCAATGACAAAGTCCACAAGCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCC
ATTAAGCTGGCCAAGGACGTGGCGTCCCTCAGTTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAAC
GTGTCTACGAAGCTGCGCCAGCTGGAGGAGGAGCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAG
CGCCACATCTCCACTCTCAACATCCAGCTCTCCGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGG
AAGAAGAGGTTCCAGAAGGAGATCGAGAACCTCACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAAC
AGGCTTCAGCAGGAGCTGGACGACCTGGTTGTTGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTT
GATCAGTTGTTAGCCGAGGAGAAAAACATCTCTTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACC
AAGGCCCTGTCCCTGGCTCGGGCCCTTGAAGAGGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATG
GAAGACCTGGTCAGCTCCAAGGATGACGTGGGCAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAG
ATGAAGACGCAGCTGGAAGAGCTGGAGGACGAGCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAG
GGCCAGTTCGAAAGGGATCTCCAAGCCCGGGACGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACG
GAACTGGAAGACGAGCGAAAGCAACGTGCCCTGGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCC
GACTCTGCCATCAAGGGGAGGGAGGAAGCCATCAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGAT
GCCCGTGCCTCCAGAGATGAGATCTTTGCCACAGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAA
GAGGACCTCGCCGCCGCTGAGAGGGCTCGCAAACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGA
AGGAACGCACTCCAGGACGAGAAGCGCCGCCTGGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAG
GCCATGAGCGACCGGGTCCGCAAAGCCACACAGCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAAT
GAGAGTGCCCGGCAGCAGCTCGAGCGGCAGAACAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAG
TCCACCATCGCGGCGCTGGAGGCCAAGATTGCACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCG
CTGAAGCAGAAAGACAAGAAGCTGAAGGAAATCTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGGCAGAG
AAAGGCAATGCCAGGGTCAAGCAGCTCAAGAGGCAGCTGGAGGAGGCAGAGGAGGAGTCCCAGCGCATCAACGCCAACCGCAGGAAGCTG
CAGCGGGAGCTGGATGAGGCCACGGAGAGCAACGAGGCCATGGGCCGCGAGGTGAACGCACTCAAGAGCAAGCTCAGAGGGCCCCCCCCA
CAGGAAACTTCGCAGTGATGCACCAGGCGAGGAAACGAGACCTCTTTCGTTCCTTCTAGAAGGTCTGGAGGACGTAGAGTTATTGAAAAT
GCAGATGGTTCTGAGGAGGAAACGGACACTCGAGACGCAGACTTCAATGGAACCAAGGCCAGTGAATAAGCAACTTTCTACAGTTTTGCA
CCACGGCAAGAAAACCAAAAACCAAAACAAACAAACAAAAAAAACCCAACAACAACCCAGAACAAAGCAAAACCCAGCAGACTGTACTTA
GCATTGTCTAAATCCATTCTCAAATTCCAAATATCACAGACACCCCTCACACAAGGAATATAAAAACCACCACCCTCCAGCCTGGGCAAC
GTAGTAAAACCTCATCTATACAAGAATTTAAAAATAAGCTGGGCGTGGTGGTACACACCTGTGGTCCCAGCTACTAGGGAGGCTGAGCCA
GGAAGAACGCTCCAGCCCAGGACTTCGAGGCTGCAATGAGCTATAATTGCATCATTGCACTCCAGCCTGGGCAACAGAGACCCTGTCTCA
ACCACCACCACCACCACCACCCCTACTACCCCTGTATTCAAGGTAAAAATTGAAGTTTGTATGATGTAAGAGATGAGAAAAACCCAACAG
GAAACACAGACACATCCTCCAGTTCTATCAATGGATTGTGCAGACACTGAGTTTTTAGAAAAACATATCCACGGTAACCGGTCCCTGGCA
ATTCTGTTTACATGAAATGGGGAGAAAGTCACCGAAATGGGTGCCGCCGGCCCCCACTCCCAATTCATTCCCTAACCTGCAAACCTTTCC
AACTTCTCACGTCAGGCCTTTGAGAATTCTTTCCCCCTCTCCTGGTTTCCACACCTCAGACACGCACAGTTCACCAAGTGCCTTCTGTAG

>In-frame_NOMO1_ENST00000287667_chr16_14983072_+_MYH11_ENST00000576790_chr16_15917268_-_9432nt
CTGGGGCTGTGAACGTGGGGTCGAAGCGCGCGTGCGCGGCGGCTCTGGCGGCGGCGGTGGGGCGGGGCCTGGGCTGTCAGCCGGCCTAGG
AGGAGGAAGGAGCCTGCGGCGTGCAGTGTGAGGGGCGGGACCCGGCTGCCGGCGGTGGGTCTAGCTGGGGGAGGTCGGGCCATGCTGGTG
GGCCAGGGCGCGGGGCCGCTGGGGCCCGCGGTGGTCACCGCCGCGGTGGTGCTGCTGCTGAGCGGCGTGGGGCCGGCGCACGGCTCGGAG
GACATCGTGGTGGGCTGCGGTGGCTTCGTCAAGTCGGACGTGGAGATCAACTACTCTCTCATCGAGATAAAGCTGTACACCAAGCATGGG
ACTTTGAAATACCAGACAGACTGTGCCCCTAATAATGGTTACTTTATGATCCCTTTGTATGATAAGGGGGATTTCATTCTGAAGATTGAG
CCTCCCCTAGGGTGGAGTTTTGAGCCGACGACCGTGGAGCTCCATGTGGATGGAGTCAGTGACATCTGCACAAAGGGTGGGGACATCAAC
TTTGTCTTCACTGGGTTCTCTGTGAATGGCAAGGTCCTCAGCAAAGGGCAGCCCCTGGGTCCTGCGGGAGTTCAGGTGTCTCTGAGAAAC
ACTGGGACCGAAGCAAAGATCCAGTCCACAGTTACACAGCCTGGCGGAAAGTTTGCATTTTTTAAAGTTCTGCCTGGAGATTATGAAATC
CTCGCAACTCATCCAACCTGGGCGTTGAAAGAGGCAAGCACCACAGTGCGTGTAACCAACTCCAATGCCAATGCGGCCAGTCCCCTCATA
GTTGCTGGCTACAATGTGTCTGGCTCTGTCCGAAGTGATGGGGAGCCCATGAAAGGCGTGAAGTTTCTTCTCTTTTCTTCTTTAGTAACT
AAAGAGGATGTCCTGGGCTGCAATGTCTCACCAGTGCCTGGGTTCCAGCCCCAAGACGAGAGTCTGGTGTATTTGTGCTACACGGTCTCC
AGAGAAGATGGCTCGTTCTCTTTCTATTCCTTGCCAAGTGGGGGCTACACTGTGATTCCGTTCTATCGAGGGGAGAGGATTACCTTTGAT
GTGGCGCCTTCCAGACTTGACTTCACAGTGGAGCATGACAGCTTGAAAATCGAGCCCGTGTTCCACGTCATGGGATTCTCCGTCACCGGG
AGGGTCTTGAACGGACCCGAAGGAGATGGTGTTCCAGAAGCAGTAGTCACCCTGAATAACCAAATCAAAGTTAAAACAAAAGCTGATGGC
TCATTCCGCCTTGAGAACATAACCACAGGGACATACACCATCCATGCTCAGAAAGAGCACCTCTACTTTGAAACGGTCACCATCAAAATT
GCACCGAACACACCTCAGCTGGCTGACATTATTGCAACAGGGTTCAGTGTCTGTGGTCAGATATCAATCATTCGCTTCCCCGACACCGTC
AAGCAGATGAATAAATACAAAGTTGTCCTGTCATCTCAAGACAAGGACAAGTCTTTGGTCACCGTGGAGACAGATGCTCATGGATCATTT
TGTTTTAAAGCAAAACCAGGGACTTACAAAGTGCAGGTGATGGTTCCTGAGGCAGAAACCAGAGCAGGGCTGACGTTGAAACCCCAGACA
TTTCCTCTTACTGTGACCAACAGGCCCATGATGGATGTGGCCTTTGTACAGTTCTTGGCATCAGTTTCTGGGAAAGTCTCTTGTTTGGAC
ACCTGTGGTGACTTGCTGGTGACTCTACAGTCCCTGAGCCGCCAGGGTGAGAAGCGGAGCCTCCAGCTCTCCGGCAAGGTCAACGCCATG
ACTTTCACCTTTGACAACGTGCTCCCTGGAAAATACAAAATAAGCATCATGCATGAGGATTGGTGCTGGAAGAACAAGAGCCTGGAGGTG
GAAGTGCTGGAGGATGACATGTCTGCAGTTGAGTTCAGGCAGACGGGCTACATGCTGAGATGTTCCCTGTCTCACGCCATCACTCTGGAA
TTTTATCAGGATGGAAATGGGCGTGAGAATGTGGGGATTTATAACCTCTCCAAAGGAGTCAACCGATTCTGCCTGTCCAAGCCTGGTGTG
TACAAAGTGACCCCTCGCTCCTGCCACCGGTTTGAGCAAGCGTTCTACACCTATGACACGTCTTCACCTAGTATCTTGACATTGACAGCC
ATTCGCCACCATGTCCTTGGAACTATCACCACCGACAAAATGATGGATGTCACTGTGACTATCAAGTCTTCCATCGACAGTGAACCCGCC
TTGGTCTTAGGCCCTCTGAAGTCTGTGCAGGAGCTGCGGAGGGAGCAGCAGCTGGCTGAGATCGAGGCCCGCAGGCAGGAGAGGGAGAAA
AACGGCAATGAGGAAGGCGAAGAAAGAATGACCAAGCCTCCCGTGCAGGAGATGGTAGATGAGTTACAAGGCCCCTTCTCGTATGATTTC
TCTTACTGGGCGCGGTCTGGAGAGAAAATCACTGTTACACCGTCATCTAAAGAGCTGCTCTTTTATCCCCCTTCAATGGAAGCCGTTGTC
AGTGGAGAAAGCTGCCCAGGGAAGCTGATCGAGATCCATGGGAAGGCAGGCCTGTTTTTAGAAGGCCAGATCCACCCCGAGTTGGAAGGA
GTCGAGATTGTCATCAGTGAAAAGGGGGCAAGTTCACCGCTGATCACAGTCTTTACTGATGACAAAGGTGCCTACAGTGTTGGCCCCCTG
CACAGTGACCTGGAGTACACGGTGACCTCACAGAAGGAGGGCTATGTTCTGACTGCGGTGGAAGGAACCATCGGAGACTTCAAGGCCTAT
GCCCTGGCAGGCGTAAGCTTTGAGATAAAAGCTGAGGATGACCAGCCCCTCCCGGGAGTCCTCTTATCCCTGAGCGGTGGCCTGTTTCGT
TCCAACCTCTTGACCCAGGACAACGGCATTCTGACATTCTCAAACCTGAGCCCTGGCCAGTATTACTTCAAACCCATGATGAAGGAGTTC
CGGTTTGAGCCATCCTCACAGATGATCGAGGTGCAGGAAGGCCAGAACCTGAAGATCACCATCACGGGGTACCGAACCGCTTACAGTTGC
TATGGCACAGTGTCTTCCTTAAACGGAGAGCCCGAACAAGGGGTTGCCATGGAAGCGGTGGGCCAGAACGACTGCAGCATTTACGGAGAA
GACACCGTGACAGACGAAGAGGGCAAGTTCAGATTACGTGGATTGCTGCCGGGATGTGTGTACCACGTTCAGCTCAAGGCAGAAGGCAAC
GACCACATTGAGCGGGCGCTCCCCCACCATAGGGTGATTGAGGTTGGGAATAATGACATCGATGATGTAAACATCATAGTTTTCCGGCAG
ATTAATCAATTTGATTTAAGTGGAAATGTGATCACTTCCTCTGAATACCTTCCTACATTATGGGTCAAGCTTTACAAAAGCGAAAACCTC
GACAATCCAATCCAGACAGTTTCCCTTGGCCAGTCCCTGTTCTTCCATTTCCCCCCACTGCTCAGAGACGGCGAGAACTATGTTGTGCTT
CTGGACTCCACACTCCCCAGATCCCAGTATGACTACATCTTGCCTCAAGTTTCTTTCACCGCAGTGGGCTACCATAAACACATCACCTTG
ATTTTTAATCCCACGACGTACTCTGGCCTCTTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGAC
ATGTACAAGGGCAAGAAGAGGCACGAGATGCCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAG
GACCAGTCCATTCTATGCACAGGCGAGTCTGGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCC
TCCCACAAGGGCAAGAAAGACACAAGTATCACGGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCTTTCGGCAAC
GCCAAAACAGTGAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTGGGAGCCAAC
ATTGAGACCTATCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATGATTGCTGGA
GCCAAGGAGAAGATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATCCCAGCAGCC
CAGGATGATGAGATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTGAAGGTGGTA
TCATCGGTCCTGCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCTGCTCAGAAA
GTTTGCCACCTCATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTGGTACAGAAA
GCTCAGACAAAAGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTCACCCGCGTG
AACAAAGCCCTGGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAGGTGAACTCC
TTCGAGCAGCTGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAG
CGCGAGGGCATCGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAACCCTCCAGGT
GTGCTGGCCCTGCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAGGGCAGCCAC
CCCAAGTTCCAGAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAATGCGAGTGCC
TGGCTGACCAAGAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGACCTGTGGAAG
GACGTGGACCGCATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAGGGCATGTTC
CGCACAGTGGGGCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGCTGCATCATC
CCCAACCACGAGAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGCATTCGCATC
TGCCGGCAGGGCTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCCAAAGGCTTC
ATGGACGGGAAGCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAAATCTTCTTC
CGAACTGGCGTCCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGTCGTGGCTAC
TTGGCCAGAAAGGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTCAAGCTGCGG
AACTGGCAGTGGTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGATGAA
CTGCAGAAGACCAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAGGAGAAGAAC
CTGCTACAGGAACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAGCAGGAGCTG
GAGGAGATACTGCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAGATGGCCCAG
CAGATGCTGGACCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAGGCCAAGATC
AAGAAACTGGAGGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGGATTAGTGAC
TTAACGACAAATCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCAGAACTGGAA
GTGCGGCTAAAGAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTCCACGAGCAG
ATCGCTGACCTCCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCCAGGCTTGAC
GATGAAATCGCTCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTGGACTCAGAG
CGGGCCGCCAGGAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGACACACTGGAC
AGCACAGCCACTCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACGCGGTCCCAT
GAGGCTCAGGTCCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGGGCCAAGGCG
AACCTAGACAAGAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAGCAGGAGGTG
GAACATAAGAAGAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAGCTCAATGAC
AAAGTCCACAAGCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCCAAGGACGTG
GCGTCCCTCAGTTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAGCTGCGCCAG
CTGGAGGAGGAGCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCCACTCTCAAC
ATCCAGCTCTCCGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTCCAGAAGGAG
ATCGAGAACCTCACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAGGAGCTGGAC
GACCTGGTTGTTGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTAGCCGAGGAG
AAAAACATCTCTTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCCCTGGCTCGG
GCCCTTGAAGAGGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTCAGCTCCAAG
GATGACGTGGGCAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAGCTGGAAGAG
CTGGAGGACGAGCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAAAGGGATCTC
CAAGCCCGGGACGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGACGAGCGAAAG
CAACGTGCCCTGGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATCAAGGGGAGG
GAGGAAGCCATCAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCCAGAGATGAG
ATCTTTGCCACAGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCCGCCGCTGAG
AGGGCTCGCAAACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTCCAGGACGAG
AAGCGCCGCCTGGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGACCGGGTCCGC
AAAGCCACACAGCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGGCAGCAGCTC
GAGCGGCAGAACAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCGGCGCTGGAG
GCCAAGATTGCACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAAGACAAGAAG
CTGAAGGAAATCTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGGCAGAGAAAGGCAATGCCAGGGTCAAG
CAGCTCAAGAGGCAGCTGGAGGAGGCAGAGGAGGAGTCCCAGCGCATCAACGCCAACCGCAGGAAGCTGCAGCGGGAGCTGGATGAGGCC
ACGGAGAGCAACGAGGCCATGGGCCGCGAGGTGAACGCACTCAAGAGCAAGCTCAGAGGGCCCCCCCCACAGGAAACTTCGCAGTGATGC
ACCAGGCGAGGAAACGAGACCTCTTTCGTTCCTTCTAGAAGGTCTGGAGGACGTAGAGTTATTGAAAATGCAGATGGTTCTGAGGAGGAA
ACGGACACTCGAGACGCAGACTTCAATGGAACCAAGGCCAGTGAATAAGCAACTTTCTACAGTTTTGCACCACGGCAAGAAAACCAAAAA
CCAAAACAAACAAACAAAAAAAACCCAACAACAACCCAGAACAAAGCAAAACCCAGCAGACTGTACTTAGCATTGTCTAAATCCATTCTC

>In-frame_NOMO1_ENST00000287667_chr16_14983072_+_MYH11_ENST00000300036_chr16_15917268_-_9189nt
CTGGGGCTGTGAACGTGGGGTCGAAGCGCGCGTGCGCGGCGGCTCTGGCGGCGGCGGTGGGGCGGGGCCTGGGCTGTCAGCCGGCCTAGG
AGGAGGAAGGAGCCTGCGGCGTGCAGTGTGAGGGGCGGGACCCGGCTGCCGGCGGTGGGTCTAGCTGGGGGAGGTCGGGCCATGCTGGTG
GGCCAGGGCGCGGGGCCGCTGGGGCCCGCGGTGGTCACCGCCGCGGTGGTGCTGCTGCTGAGCGGCGTGGGGCCGGCGCACGGCTCGGAG
GACATCGTGGTGGGCTGCGGTGGCTTCGTCAAGTCGGACGTGGAGATCAACTACTCTCTCATCGAGATAAAGCTGTACACCAAGCATGGG
ACTTTGAAATACCAGACAGACTGTGCCCCTAATAATGGTTACTTTATGATCCCTTTGTATGATAAGGGGGATTTCATTCTGAAGATTGAG
CCTCCCCTAGGGTGGAGTTTTGAGCCGACGACCGTGGAGCTCCATGTGGATGGAGTCAGTGACATCTGCACAAAGGGTGGGGACATCAAC
TTTGTCTTCACTGGGTTCTCTGTGAATGGCAAGGTCCTCAGCAAAGGGCAGCCCCTGGGTCCTGCGGGAGTTCAGGTGTCTCTGAGAAAC
ACTGGGACCGAAGCAAAGATCCAGTCCACAGTTACACAGCCTGGCGGAAAGTTTGCATTTTTTAAAGTTCTGCCTGGAGATTATGAAATC
CTCGCAACTCATCCAACCTGGGCGTTGAAAGAGGCAAGCACCACAGTGCGTGTAACCAACTCCAATGCCAATGCGGCCAGTCCCCTCATA
GTTGCTGGCTACAATGTGTCTGGCTCTGTCCGAAGTGATGGGGAGCCCATGAAAGGCGTGAAGTTTCTTCTCTTTTCTTCTTTAGTAACT
AAAGAGGATGTCCTGGGCTGCAATGTCTCACCAGTGCCTGGGTTCCAGCCCCAAGACGAGAGTCTGGTGTATTTGTGCTACACGGTCTCC
AGAGAAGATGGCTCGTTCTCTTTCTATTCCTTGCCAAGTGGGGGCTACACTGTGATTCCGTTCTATCGAGGGGAGAGGATTACCTTTGAT
GTGGCGCCTTCCAGACTTGACTTCACAGTGGAGCATGACAGCTTGAAAATCGAGCCCGTGTTCCACGTCATGGGATTCTCCGTCACCGGG
AGGGTCTTGAACGGACCCGAAGGAGATGGTGTTCCAGAAGCAGTAGTCACCCTGAATAACCAAATCAAAGTTAAAACAAAAGCTGATGGC
TCATTCCGCCTTGAGAACATAACCACAGGGACATACACCATCCATGCTCAGAAAGAGCACCTCTACTTTGAAACGGTCACCATCAAAATT
GCACCGAACACACCTCAGCTGGCTGACATTATTGCAACAGGGTTCAGTGTCTGTGGTCAGATATCAATCATTCGCTTCCCCGACACCGTC
AAGCAGATGAATAAATACAAAGTTGTCCTGTCATCTCAAGACAAGGACAAGTCTTTGGTCACCGTGGAGACAGATGCTCATGGATCATTT
TGTTTTAAAGCAAAACCAGGGACTTACAAAGTGCAGGTGATGGTTCCTGAGGCAGAAACCAGAGCAGGGCTGACGTTGAAACCCCAGACA
TTTCCTCTTACTGTGACCAACAGGCCCATGATGGATGTGGCCTTTGTACAGTTCTTGGCATCAGTTTCTGGGAAAGTCTCTTGTTTGGAC
ACCTGTGGTGACTTGCTGGTGACTCTACAGTCCCTGAGCCGCCAGGGTGAGAAGCGGAGCCTCCAGCTCTCCGGCAAGGTCAACGCCATG
ACTTTCACCTTTGACAACGTGCTCCCTGGAAAATACAAAATAAGCATCATGCATGAGGATTGGTGCTGGAAGAACAAGAGCCTGGAGGTG
GAAGTGCTGGAGGATGACATGTCTGCAGTTGAGTTCAGGCAGACGGGCTACATGCTGAGATGTTCCCTGTCTCACGCCATCACTCTGGAA
TTTTATCAGGATGGAAATGGGCGTGAGAATGTGGGGATTTATAACCTCTCCAAAGGAGTCAACCGATTCTGCCTGTCCAAGCCTGGTGTG
TACAAAGTGACCCCTCGCTCCTGCCACCGGTTTGAGCAAGCGTTCTACACCTATGACACGTCTTCACCTAGTATCTTGACATTGACAGCC
ATTCGCCACCATGTCCTTGGAACTATCACCACCGACAAAATGATGGATGTCACTGTGACTATCAAGTCTTCCATCGACAGTGAACCCGCC
TTGGTCTTAGGCCCTCTGAAGTCTGTGCAGGAGCTGCGGAGGGAGCAGCAGCTGGCTGAGATCGAGGCCCGCAGGCAGGAGAGGGAGAAA
AACGGCAATGAGGAAGGCGAAGAAAGAATGACCAAGCCTCCCGTGCAGGAGATGGTAGATGAGTTACAAGGCCCCTTCTCGTATGATTTC
TCTTACTGGGCGCGGTCTGGAGAGAAAATCACTGTTACACCGTCATCTAAAGAGCTGCTCTTTTATCCCCCTTCAATGGAAGCCGTTGTC
AGTGGAGAAAGCTGCCCAGGGAAGCTGATCGAGATCCATGGGAAGGCAGGCCTGTTTTTAGAAGGCCAGATCCACCCCGAGTTGGAAGGA
GTCGAGATTGTCATCAGTGAAAAGGGGGCAAGTTCACCGCTGATCACAGTCTTTACTGATGACAAAGGTGCCTACAGTGTTGGCCCCCTG
CACAGTGACCTGGAGTACACGGTGACCTCACAGAAGGAGGGCTATGTTCTGACTGCGGTGGAAGGAACCATCGGAGACTTCAAGGCCTAT
GCCCTGGCAGGCGTAAGCTTTGAGATAAAAGCTGAGGATGACCAGCCCCTCCCGGGAGTCCTCTTATCCCTGAGCGGTGGCCTGTTTCGT
TCCAACCTCTTGACCCAGGACAACGGCATTCTGACATTCTCAAACCTGAGCCCTGGCCAGTATTACTTCAAACCCATGATGAAGGAGTTC
CGGTTTGAGCCATCCTCACAGATGATCGAGGTGCAGGAAGGCCAGAACCTGAAGATCACCATCACGGGGTACCGAACCGCTTACAGTTGC
TATGGCACAGTGTCTTCCTTAAACGGAGAGCCCGAACAAGGGGTTGCCATGGAAGCGGTGGGCCAGAACGACTGCAGCATTTACGGAGAA
GACACCGTGACAGACGAAGAGGGCAAGTTCAGATTACGTGGATTGCTGCCGGGATGTGTGTACCACGTTCAGCTCAAGGCAGAAGGCAAC
GACCACATTGAGCGGGCGCTCCCCCACCATAGGGTGATTGAGGTTGGGAATAATGACATCGATGATGTAAACATCATAGTTTTCCGGCAG
ATTAATCAATTTGATTTAAGTGGAAATGTGATCACTTCCTCTGAATACCTTCCTACATTATGGGTCAAGCTTTACAAAAGCGAAAACCTC
GACAATCCAATCCAGACAGTTTCCCTTGGCCAGTCCCTGTTCTTCCATTTCCCCCCACTGCTCAGAGACGGCGAGAACTATGTTGTGCTT
CTGGACTCCACACTCCCCAGATCCCAGTATGACTACATCTTGCCTCAAGTTTCTTTCACCGCAGTGGGCTACCATAAACACATCACCTTG
ATTTTTAATCCCACGACGTACTCTGGCCTCTTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGAC
ATGTACAAGGGCAAGAAGAGGCACGAGATGCCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAG
GACCAGTCCATTCTATGCACAGGCGAGTCTGGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCC
TCCCACAAGGGCAAGAAAGACACAAGTATCACGGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCTTTCGGCAAC
GCCAAAACAGTGAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTGGGAGCCAAC
ATTGAGACCTATCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATGATTGCTGGA
GCCAAGGAGAAGATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATCCCAGCAGCC
CAGGATGATGAGATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTGAAGGTGGTA
TCATCGGTCCTGCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCTGCTCAGAAA
GTTTGCCACCTCATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTGGTACAGAAA
GCTCAGACAAAAGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTCACCCGCGTG
AACAAAGCCCTGGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAGGTGAACTCC
TTCGAGCAGCTGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAG
CGCGAGGGCATCGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAACCCTCCAGGT
GTGCTGGCCCTGCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAGGGCAGCCAC
CCCAAGTTCCAGAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAATGCGAGTGCC
TGGCTGACCAAGAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGACCTGTGGAAG
GACGTGGACCGCATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAGGGCATGTTC
CGCACAGTGGGGCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGCTGCATCATC
CCCAACCACGAGAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGCATTCGCATC
TGCCGGCAGGGCTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCCAAAGGCTTC
ATGGACGGGAAGCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAAATCTTCTTC
CGAACTGGCGTCCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGTCGTGGCTAC
TTGGCCAGAAAGGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTCAAGCTGCGG
AACTGGCAGTGGTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGATGAA
CTGCAGAAGACCAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAGGAGAAGAAC
CTGCTACAGGAACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAGCAGGAGCTG
GAGGAGATACTGCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAGATGGCCCAG
CAGATGCTGGACCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAGGCCAAGATC
AAGAAACTGGAGGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGGATTAGTGAC
TTAACGACAAATCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCAGAACTGGAA
GTGCGGCTAAAGAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTCCACGAGCAG
ATCGCTGACCTCCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCCAGGCTTGAC
GATGAAATCGCTCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTGGACTCAGAG
CGGGCCGCCAGGAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGACACACTGGAC
AGCACAGCCACTCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACGCGGTCCCAT
GAGGCTCAGGTCCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGGGCCAAGGCG
AACCTAGACAAGAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAGCAGGAGGTG
GAACATAAGAAGAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAGCTCAATGAC
AAAGTCCACAAGCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCCAAGGACGTG
GCGTCCCTCAGTTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAGCTGCGCCAG
CTGGAGGAGGAGCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCCACTCTCAAC
ATCCAGCTCTCCGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTCCAGAAGGAG
ATCGAGAACCTCACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAGGAGCTGGAC
GACCTGGTTGTTGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTAGCCGAGGAG
AAAAACATCTCTTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCCCTGGCTCGG
GCCCTTGAAGAGGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTCAGCTCCAAG
GATGACGTGGGCAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAGCTGGAAGAG
CTGGAGGACGAGCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAAAGGGATCTC
CAAGCCCGGGACGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGACGAGCGAAAG
CAACGTGCCCTGGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATCAAGGGGAGG
GAGGAAGCCATCAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCCAGAGATGAG
ATCTTTGCCACAGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCCGCCGCTGAG
AGGGCTCGCAAACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTCCAGGACGAG
AAGCGCCGCCTGGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGACCGGGTCCGC
AAAGCCACACAGCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGGCAGCAGCTC
GAGCGGCAGAACAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCGGCGCTGGAG
GCCAAGATTGCACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAAGACAAGAAG
CTGAAGGAAATCTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGGCAGAGAAAGGCAATGCCAGGGTCAAG
CAGCTCAAGAGGCAGCTGGAGGAGGCAGAGGAGGAGTCCCAGCGCATCAACGCCAACCGCAGGAAGCTGCAGCGGGAGCTGGATGAGGCC
ACGGAGAGCAACGAGGCCATGGGCCGCGAGGTGAACGCACTCAAGAGCAAGCTCAGGCGAGGAAACGAGACCTCTTTCGTTCCTTCTAGA
AGGTCTGGAGGACGTAGAGTTATTGAAAATGCAGATGGTTCTGAGGAGGAAACGGACACTCGAGACGCAGACTTCAATGGAACCAAGGCC


Top

FusionGenePPI for NOMO1_MYH11


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NOMO1NCLN, BAG6, TOM1L1, CDK2, SHBG, UBQLN4, ILF3, PLEC, TIMM10, ECT2, STAT1, EXOSC10, UPF2, FBXO6, TRIM63, TRIM55, RPN1, NTRK1, EWSR1, FPR2, CD96, TPCN2, PTPRO, ARL15, AGPAT3, METTL9, SERINC1, TMEM120B, TMEM120AMYH11SLX1B, GRB2, DAXX, APC, YWHAQ, SP1, FBXO25, MYOC, SHC1, ACTA2, ACTB, DSTN, MYO1E, EIF3A, RPA1, RPA2, RPA3, LGR4, FAM96A, OVCA2, RWDD2B, MYO5A, SFN, C4BPA, CAPZB, FLNA, MYL6, RAD51, SVIL, YWHAE, ARPC5, ACTR3, RALBP1, POC1A, ASTE1, MED4, LRRC59, CGN, INF2, ARPC5L, TBC1D31, UBXN2A, PLBD2, TMEM189, ZNF746, MPP1, GDF9, COQ2, COX15, DLST, DNM1L, PARK7, PDHA1, SOAT1, SOD1, VDAC1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NOMO1_MYH11


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneNOMO1Q15155DB00277TheophyllineNodal modulator 1small moleculeapproved

Top

RelatedDiseases for NOMO1_MYH11


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneMYH11C0023467Leukemia, Myelocytic, Acute2CTD_human
TgeneMYH11C0023479Acute myelomonocytic leukemia1CTD_human;ORPHANET
TgeneMYH11C1851504Aortic aneurysm, familial thoracic 41CTD_human;UNIPROT