FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24458

FusionGeneSummary for NLK_BCAS3

check button Fusion gene summary
Fusion gene informationFusion gene name: NLK_BCAS3
Fusion gene ID: 24458
HgeneTgene
Gene symbol

NLK

BCAS3

Gene ID

51701

54828

Gene namenemo like kinaseBCAS3, microtubule associated cell migration factor
Synonyms-GAOB1|MAAB
Cytomap

17q11.2

17q23.2

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase NLKbreast carcinoma-amplified sequence 3BCAS4/BCAS3 fusionRudhirabreast carcinoma amplified sequence 4/3 fusion proteinmetastasis associated antigen of breast cancerprotein Maab1
Modification date2018052320180523
UniProtAcc

Q9UBE8

Q9H6U6

Ensembl transtripts involved in fusion geneENST00000407008, ENST00000583517, 
ENST00000582037, 
ENST00000589222, 
ENST00000407086, ENST00000390652, 
ENST00000408905, ENST00000588462, 
ENST00000585744, ENST00000588874, 
ENST00000585812, 
Fusion gene scores* DoF score13 X 7 X 8=72826 X 15 X 15=5850
# samples 1541
** MAII scorelog2(15/728*10)=-2.27897594970282
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(41/5850*10)=-3.83474080985268
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NLK [Title/Abstract] AND BCAS3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNLK

GO:0050821

protein stabilization

25512613

TgeneBCAS3

GO:0043085

positive regulation of catalytic activity

17505058

TgeneBCAS3

GO:0045944

positive regulation of transcription by RNA polymerase II

17505058

TgeneBCAS3

GO:0071391

cellular response to estrogen stimulus

17505058


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-C8-A26X-01ANLKchr17

26495683

+BCAS3chr17

59067332

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000407008ENST00000589222NLKchr17

26495683

+BCAS3chr17

59067332

+
In-frameENST00000407008ENST00000407086NLKchr17

26495683

+BCAS3chr17

59067332

+
In-frameENST00000407008ENST00000390652NLKchr17

26495683

+BCAS3chr17

59067332

+
In-frameENST00000407008ENST00000408905NLKchr17

26495683

+BCAS3chr17

59067332

+
In-frameENST00000407008ENST00000588462NLKchr17

26495683

+BCAS3chr17

59067332

+
In-frameENST00000407008ENST00000585744NLKchr17

26495683

+BCAS3chr17

59067332

+
In-frameENST00000407008ENST00000588874NLKchr17

26495683

+BCAS3chr17

59067332

+
5CDS-intronENST00000407008ENST00000585812NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-3CDSENST00000583517ENST00000589222NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-3CDSENST00000583517ENST00000407086NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-3CDSENST00000583517ENST00000390652NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-3CDSENST00000583517ENST00000408905NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-3CDSENST00000583517ENST00000588462NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-3CDSENST00000583517ENST00000585744NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-3CDSENST00000583517ENST00000588874NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-intronENST00000583517ENST00000585812NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-3CDSENST00000582037ENST00000589222NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-3CDSENST00000582037ENST00000407086NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-3CDSENST00000582037ENST00000390652NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-3CDSENST00000582037ENST00000408905NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-3CDSENST00000582037ENST00000588462NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-3CDSENST00000582037ENST00000585744NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-3CDSENST00000582037ENST00000588874NLKchr17

26495683

+BCAS3chr17

59067332

+
intron-intronENST00000582037ENST00000585812NLKchr17

26495683

+BCAS3chr17

59067332

+

Top

FusionProtFeatures for NLK_BCAS3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NLK

Q9UBE8

BCAS3

Q9H6U6

Serine/threonine-protein kinase that regulates a numberof transcription factors with key roles in cell fatedetermination. Positive effector of the non-canonical Wntsignaling pathway, acting downstream of WNT5A, MAP3K7/TAK1 andHIPK2. Activation of this pathway causes binding to andphosphorylation of the histone methyltransferase SETDB1. The NLK-SETDB1 complex subsequently interacts with PPARG, leading tomethylation of PPARG target promoters at histone H3K9 andtranscriptional silencing. The resulting loss of PPARG target genetranscription inhibits adipogenesis and promotesosteoblastogenesis in mesenchymal stem cells (MSCs). Negativeregulator of the canonical Wnt/beta-catenin signaling pathway.Binds to and phosphorylates TCF7L2/TCF4 and LEF1, promoting thedissociation of the TCF7L2/LEF1/beta-catenin complex from DNA, aswell as the ubiquitination and subsequent proteolysis of LEF1.Together these effects inhibit the transcriptional activation ofcanonical Wnt/beta-catenin target genes. Negative regulator of theNotch signaling pathway. Binds to and phosphorylates NOTCH1,thereby preventing the formation of a transcriptionally activeternary complex of NOTCH1, RBPJ/RBPSUH and MAML1. Negativeregulator of the MYB family of transcription factors.Phosphorylation of MYB leads to its subsequent proteolysis whilephosphorylation of MYBL1 and MYBL2 inhibits their interaction withthe coactivator CREBBP. Other transcription factors may also beinhibited by direct phosphorylation of CREBBP itself. Actsdownstream of IL6 and MAP3K7/TAK1 to phosphorylate STAT3, which isin turn required for activation of NLK by MAP3K7/TAK1. Upon IL1Bstimulus, cooperates with ATF5 to activate the transactivationactivity of C/EBP subfamily members. Phosphorylates ATF5 but alsostabilizes ATF5 protein levels in a kinase-independent manner(PubMed:25512613). {ECO:0000250|UniProtKB:O54949,ECO:0000269|PubMed:12482967, ECO:0000269|PubMed:14960582,ECO:0000269|PubMed:15004007, ECO:0000269|PubMed:15764709,ECO:0000269|PubMed:17952062, ECO:0000269|PubMed:20061393,ECO:0000269|PubMed:20118921, ECO:0000269|PubMed:20874444,ECO:0000269|PubMed:21454679, ECO:0000269|PubMed:25512613}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNLKchr17:26495683chr17:59067332ENST00000407008+611106_111349528Compositional biasNote=Poly-Ala
HgeneNLKchr17:26495683chr17:59067332ENST00000407008+611115_119349528Compositional biasNote=Poly-Ala
HgeneNLKchr17:26495683chr17:59067332ENST00000407008+61122_25349528Compositional biasNote=Poly-Ala
HgeneNLKchr17:26495683chr17:59067332ENST00000407008+61127_34349528Compositional biasNote=Poly-His
HgeneNLKchr17:26495683chr17:59067332ENST00000407008+61142_48349528Compositional biasNote=Poly-His
HgeneNLKchr17:26495683chr17:59067332ENST00000407008+61171_83349528Compositional biasNote=Poly-Ala
HgeneNLKchr17:26495683chr17:59067332ENST00000407008+611298_300349528MotifNote=TQE
HgeneNLKchr17:26495683chr17:59067332ENST00000407008+611144_152349528Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNLKchr17:26495683chr17:59067332ENST00000407008+611138_427349528DomainProtein kinase
HgeneNLKchr17:26495683chr17:59067332ENST00000407008+611428_527349528RegionRequired for homodimerization and kinase activation and localization to the nucleus


Top

FusionGeneSequence for NLK_BCAS3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000589222_chr17_59067332_+_871aa
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAAVHPVQQHTSSAAAAAAAAAAAAAMLNPGQQ
QPTFPSPAPGQAPGPAAAAPAQVQAAAAATVKAHHHQHSHHPQQQLDIEPDRPIGTGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDTFEEITVVTELMQSDLHKIIVSPQPLSSDHVKVFLTQILRGLKTLHSAGILHRDIKPGNL
LVNSNCVLKICDFGLARVEELDESRHMTQEVVTQTTRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQVQDICFSHDCR
WVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFT
NNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESL
YIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITR
HGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQ
PVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTDTAL

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000407086_chr17_59067332_+_856aa
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAAVHPVQQHTSSAAAAAAAAAAAAAMLNPGQQ
QPTFPSPAPGQAPGPAAAAPAQVQAAAAATVKAHHHQHSHHPQQQLDIEPDRPIGTGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDTFEEITVVTELMQSDLHKIIVSPQPLSSDHVKVFLTQILRGLKTLHSAGILHRDIKPGNL
LVNSNCVLKICDFGLARVEELDESRHMTQEVVTQTTRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQVQDICFSHDCR
WVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFT
NNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESL
YIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITR
HGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQ
PVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQR

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000390652_chr17_59067332_+_871aa
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAAVHPVQQHTSSAAAAAAAAAAAAAMLNPGQQ
QPTFPSPAPGQAPGPAAAAPAQVQAAAAATVKAHHHQHSHHPQQQLDIEPDRPIGTGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDTFEEITVVTELMQSDLHKIIVSPQPLSSDHVKVFLTQILRGLKTLHSAGILHRDIKPGNL
LVNSNCVLKICDFGLARVEELDESRHMTQEVVTQTTRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQVQDICFSHDCR
WVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFT
NNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGL
KREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFL
LAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLL
DFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAE

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000408905_chr17_59067332_+_878aa
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAAVHPVQQHTSSAAAAAAAAAAAAAMLNPGQQ
QPTFPSPAPGQAPGPAAAAPAQVQAAAAATVKAHHHQHSHHPQQQLDIEPDRPIGTGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDTFEEITVVTELMQSDLHKIIVSPQPLSSDHVKVFLTQILRGLKTLHSAGILHRDIKPGNL
LVNSNCVLKICDFGLARVEELDESRHMTQEVVTQTTRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQVQDICFSHDCR
WVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFT
NNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESL
YIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITR
HGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQ
PVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTDTAL

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000588462_chr17_59067332_+_893aa
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAAVHPVQQHTSSAAAAAAAAAAAAAMLNPGQQ
QPTFPSPAPGQAPGPAAAAPAQVQAAAAATVKAHHHQHSHHPQQQLDIEPDRPIGTGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDTFEEITVVTELMQSDLHKIIVSPQPLSSDHVKVFLTQILRGLKTLHSAGILHRDIKPGNL
LVNSNCVLKICDFGLARVEELDESRHMTQEVVTQTTRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQVQDICFSHDCR
WVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFT
NNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGL
KREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFL
LAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLL
DFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAE

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000585744_chr17_59067332_+_871aa
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAAVHPVQQHTSSAAAAAAAAAAAAAMLNPGQQ
QPTFPSPAPGQAPGPAAAAPAQVQAAAAATVKAHHHQHSHHPQQQLDIEPDRPIGTGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDTFEEITVVTELMQSDLHKIIVSPQPLSSDHVKVFLTQILRGLKTLHSAGILHRDIKPGNL
LVNSNCVLKICDFGLARVEELDESRHMTQEVVTQTTRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQVQDICFSHDCR
WVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFT
NNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGPTLFGAGCFSIKAPCKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGL
KREKDQSKQVVVESLYIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFL
LAGLVPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLL
DFDTDDLDLNSLRIQPVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAE

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000588874_chr17_59067332_+_856aa
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAAVHPVQQHTSSAAAAAAAAAAAAAMLNPGQQ
QPTFPSPAPGQAPGPAAAAPAQVQAAAAATVKAHHHQHSHHPQQQLDIEPDRPIGTGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDTFEEITVVTELMQSDLHKIIVSPQPLSSDHVKVFLTQILRGLKTLHSAGILHRDIKPGNL
LVNSNCVLKICDFGLARVEELDESRHMTQEVVTQTTRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQVQDICFSHDCR
WVVVSTLRGTSHVFPINPTGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGSPLHGKLNSQDSTNNFT
NNNPGNPRLSPLPSLMVVMPLAQIKQPMTLGTITKRTGKVKPPPQISPSKSMGGEFCVAAIFGTSRSWFANNAGLKREKDQSKQVVVESL
YIISCTGTLVEHMMEPRPLSTAPKISDDTPLEMMTSPRASWTLVRTPQWNELQPPFNANHPLLLAADAVQTTQFLLAGLVPPGSPGPITR
HGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQFQFKTIHPSGQTTVISSSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQ
PVRSDPVSMPGSSRPVSDRRGVSTVIDAASGTFDRSVTLLEVCGSWPEGFGLRHMSSMEHTEEGLRERLADAMAESPSRDVVGSGTELQR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000589222_chr17_59067332_+_2613nt
ATGTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCAC
CATCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCT
GTACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAA
CAGCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACA
GTTAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGT
GTTGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAA
AGGGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATGTACTCTCTGCCCTTGACATACTCCAACCTCCACACATTGAC
TATTTTGAAGAAATATATGTTGTCACAGAATTGATGCAGAGTGACCTACATAAAATTATCGTCTCTCCTCAACCACTCAGCTCAGATCAT
GTCAAAGTTTTTCTTTATCAGATTTTGCGAGGTTTGAAATATCTCCATTCAGCTGGCATTTTACATCGAGACATTAAGCCAGGGAATCTC
CTTGTGAACAGCAACTGTGTTCTAAAGATTTGTGATTTTGGATTGGCCAGAGTGGAAGAATTAGATGAATCCCGTCATATGACTCAGGAA
GTTGTTACTCAGTATTATCGGGCTCCAGAAATCCTGATGGGCAGCCGTCATTACAGCAATGCTATTGACATCTGGTCTGTGGGATGTATC
TTTGCAGAACTACTAGGACGAAGAATATTGTTTCAGGCACAGAGTCCCATTCAGCAGGTACAGGACATCTGCTTCAGCCATGACTGTCGC
TGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCA
CCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGC
TGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACC
AACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTG
GGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCT
ATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTG
TACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCA
CTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCAC
CCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGA
CATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGA
CCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCT
GTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAG
CCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCA
GGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCAC
ACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTT
GACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGGGAAAAAAAAAGGAAAAAAAAAACAATGCCAACAG
CCCAGCGTCCGTGAGCAACCCAACAGTAACAAAGCATGCGTTCGGGATGGAGGAAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAG

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000407086_chr17_59067332_+_2568nt
ATGTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCAC
CATCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCT
GTACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAA
CAGCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACA
GTTAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGT
GTTGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAA
AGGGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATGTACTCTCTGCCCTTGACATACTCCAACCTCCACACATTGAC
TATTTTGAAGAAATATATGTTGTCACAGAATTGATGCAGAGTGACCTACATAAAATTATCGTCTCTCCTCAACCACTCAGCTCAGATCAT
GTCAAAGTTTTTCTTTATCAGATTTTGCGAGGTTTGAAATATCTCCATTCAGCTGGCATTTTACATCGAGACATTAAGCCAGGGAATCTC
CTTGTGAACAGCAACTGTGTTCTAAAGATTTGTGATTTTGGATTGGCCAGAGTGGAAGAATTAGATGAATCCCGTCATATGACTCAGGAA
GTTGTTACTCAGTATTATCGGGCTCCAGAAATCCTGATGGGCAGCCGTCATTACAGCAATGCTATTGACATCTGGTCTGTGGGATGTATC
TTTGCAGAACTACTAGGACGAAGAATATTGTTTCAGGCACAGAGTCCCATTCAGCAGGTACAGGACATCTGCTTCAGCCATGACTGTCGC
TGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCA
CCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGC
TGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACC
AACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTG
GGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCT
ATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTG
TACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCA
CTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCAC
CCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGA
CATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGA
CCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCT
GTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAG
CCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCA
GGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCAC
ACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGA
GAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCC

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000390652_chr17_59067332_+_2613nt
ATGTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCAC
CATCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCT
GTACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAA
CAGCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACA
GTTAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGT
GTTGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAA
AGGGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATGTACTCTCTGCCCTTGACATACTCCAACCTCCACACATTGAC
TATTTTGAAGAAATATATGTTGTCACAGAATTGATGCAGAGTGACCTACATAAAATTATCGTCTCTCCTCAACCACTCAGCTCAGATCAT
GTCAAAGTTTTTCTTTATCAGATTTTGCGAGGTTTGAAATATCTCCATTCAGCTGGCATTTTACATCGAGACATTAAGCCAGGGAATCTC
CTTGTGAACAGCAACTGTGTTCTAAAGATTTGTGATTTTGGATTGGCCAGAGTGGAAGAATTAGATGAATCCCGTCATATGACTCAGGAA
GTTGTTACTCAGTATTATCGGGCTCCAGAAATCCTGATGGGCAGCCGTCATTACAGCAATGCTATTGACATCTGGTCTGTGGGATGTATC
TTTGCAGAACTACTAGGACGAAGAATATTGTTTCAGGCACAGAGTCCCATTCAGCAGGTACAGGACATCTGCTTCAGCCATGACTGTCGC
TGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCA
CCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGC
TGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACC
AACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTG
GGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAA
ATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTG
AAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAG
CCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGA
ACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTG
CTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAA
GATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACC
ATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTG
GATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCA
GTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGC
TGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAG
TCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGC
GGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCG

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000408905_chr17_59067332_+_2634nt
ATGTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCAC
CATCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCT
GTACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAA
CAGCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACA
GTTAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGT
GTTGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAA
AGGGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATGTACTCTCTGCCCTTGACATACTCCAACCTCCACACATTGAC
TATTTTGAAGAAATATATGTTGTCACAGAATTGATGCAGAGTGACCTACATAAAATTATCGTCTCTCCTCAACCACTCAGCTCAGATCAT
GTCAAAGTTTTTCTTTATCAGATTTTGCGAGGTTTGAAATATCTCCATTCAGCTGGCATTTTACATCGAGACATTAAGCCAGGGAATCTC
CTTGTGAACAGCAACTGTGTTCTAAAGATTTGTGATTTTGGATTGGCCAGAGTGGAAGAATTAGATGAATCCCGTCATATGACTCAGGAA
GTTGTTACTCAGTATTATCGGGCTCCAGAAATCCTGATGGGCAGCCGTCATTACAGCAATGCTATTGACATCTGGTCTGTGGGATGTATC
TTTGCAGAACTACTAGGACGAAGAATATTGTTTCAGGCACAGAGTCCCATTCAGCAGGTACAGGACATCTGCTTCAGCCATGACTGTCGC
TGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCA
CCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGC
TGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACC
AACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTG
GGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCT
ATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTG
TACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCA
CTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCAC
CCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGA
CATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGA
CCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCT
GTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAG
CCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCA
GGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCAC
ACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTT
GACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGT
AACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGC

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000588462_chr17_59067332_+_2679nt
ATGTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCAC
CATCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCT
GTACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAA
CAGCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACA
GTTAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGT
GTTGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAA
AGGGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATGTACTCTCTGCCCTTGACATACTCCAACCTCCACACATTGAC
TATTTTGAAGAAATATATGTTGTCACAGAATTGATGCAGAGTGACCTACATAAAATTATCGTCTCTCCTCAACCACTCAGCTCAGATCAT
GTCAAAGTTTTTCTTTATCAGATTTTGCGAGGTTTGAAATATCTCCATTCAGCTGGCATTTTACATCGAGACATTAAGCCAGGGAATCTC
CTTGTGAACAGCAACTGTGTTCTAAAGATTTGTGATTTTGGATTGGCCAGAGTGGAAGAATTAGATGAATCCCGTCATATGACTCAGGAA
GTTGTTACTCAGTATTATCGGGCTCCAGAAATCCTGATGGGCAGCCGTCATTACAGCAATGCTATTGACATCTGGTCTGTGGGATGTATC
TTTGCAGAACTACTAGGACGAAGAATATTGTTTCAGGCACAGAGTCCCATTCAGCAGGTACAGGACATCTGCTTCAGCCATGACTGTCGC
TGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCA
CCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGC
TGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACC
AACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTG
GGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAA
ATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTG
AAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAG
CCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGA
ACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTG
CTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAA
GATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACC
ATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTG
GATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCA
GTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGC
TGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAG
TCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTG
AAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGAT

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000585744_chr17_59067332_+_2613nt
ATGTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCAC
CATCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCT
GTACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAA
CAGCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACA
GTTAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGT
GTTGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAA
AGGGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATGTACTCTCTGCCCTTGACATACTCCAACCTCCACACATTGAC
TATTTTGAAGAAATATATGTTGTCACAGAATTGATGCAGAGTGACCTACATAAAATTATCGTCTCTCCTCAACCACTCAGCTCAGATCAT
GTCAAAGTTTTTCTTTATCAGATTTTGCGAGGTTTGAAATATCTCCATTCAGCTGGCATTTTACATCGAGACATTAAGCCAGGGAATCTC
CTTGTGAACAGCAACTGTGTTCTAAAGATTTGTGATTTTGGATTGGCCAGAGTGGAAGAATTAGATGAATCCCGTCATATGACTCAGGAA
GTTGTTACTCAGTATTATCGGGCTCCAGAAATCCTGATGGGCAGCCGTCATTACAGCAATGCTATTGACATCTGGTCTGTGGGATGTATC
TTTGCAGAACTACTAGGACGAAGAATATTGTTTCAGGCACAGAGTCCCATTCAGCAGGTACAGGACATCTGCTTCAGCCATGACTGTCGC
TGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCA
CCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGC
TGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACC
AACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTG
GGGACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAA
ATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTG
AAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAG
CCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGA
ACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTG
CTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAA
GATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACC
ATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTG
GATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCA
GTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGC
TGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAG
TCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGC
GGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCG

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000588874_chr17_59067332_+_2568nt
ATGTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCAC
CATCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCT
GTACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAA
CAGCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACA
GTTAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGT
GTTGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAA
AGGGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATGTACTCTCTGCCCTTGACATACTCCAACCTCCACACATTGAC
TATTTTGAAGAAATATATGTTGTCACAGAATTGATGCAGAGTGACCTACATAAAATTATCGTCTCTCCTCAACCACTCAGCTCAGATCAT
GTCAAAGTTTTTCTTTATCAGATTTTGCGAGGTTTGAAATATCTCCATTCAGCTGGCATTTTACATCGAGACATTAAGCCAGGGAATCTC
CTTGTGAACAGCAACTGTGTTCTAAAGATTTGTGATTTTGGATTGGCCAGAGTGGAAGAATTAGATGAATCCCGTCATATGACTCAGGAA
GTTGTTACTCAGTATTATCGGGCTCCAGAAATCCTGATGGGCAGCCGTCATTACAGCAATGCTATTGACATCTGGTCTGTGGGATGTATC
TTTGCAGAACTACTAGGACGAAGAATATTGTTTCAGGCACAGAGTCCCATTCAGCAGGTACAGGACATCTGCTTCAGCCATGACTGTCGC
TGGGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCA
CCACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGC
TGTAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACC
AACAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTG
GGGACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCT
ATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTG
TACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCA
CTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCAC
CCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGA
CATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGA
CCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCT
GTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAG
CCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCA
GGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCAC
ACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGA
GAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000589222_chr17_59067332_+_4149nt
CCCCGGCTCTCTTTCTCCTCTCTGTCCTGCTGTCGCCTCCTCTCCTCACTCCAGCCTCCTTCCCTGGCTTATTCTGCCCAGGAAAGTTTG
GAACCCCCGCCCCCCCTCCCCAATCAGGTCAACCTGACTAGGAGTAGGGGGAGATGTAGGAAGGCCTGAGAGTTCGGGGGGGGGGAAGCT
GGAAGCTGGTTTCCCAGAAAATTTCCCCCCATCTTCTCCATTTAGGGTGGTGGGAATTTTTTTTAATCCTGTTTTTGAGGAGGTGGTAGG
TGTTTAGAAAAGGATGTGGGAATGGAAGGGGTAGATGAGTCAACCCTCTTTCAAGATTCCAAGGGTGGTGTGTTACCTGATCCTTTTCGT
GTGTGGAGTTCAGGGGGTCGGGAGGTTTGGCCTTTATTCCCACATTCAAAGTTGGAACCTCCCCCAAATTAAGAATGGAGTTTTAGTACC
CACTTGTGGCAGGAATCCTGGGGGGAAGGGGTCCTTTTTTCCTTTTTCTTTTCTTTTTTCCCTTTTTTTTCCTTTTGGCAACCCACACCC
TTCCACACACGCTCACCCCAAAATTAAACACCAAGATCCTCTAACTTGTTTGGATTGACTGATGAAGACATAAAGCTCTATGTTTTTTGA
GGTGGAGTGAGTGGTTTTTCTTCATTTTTAAATGGCCAAATGACAGCTTGACCCAGTTTGCTTTCCAATCAAAGGGCATTTATTTTGAAT
GTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCACCA
TCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCTGT
ACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAACA
GCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACAGT
TAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGTGT
TGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAAAG
GGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATGTACTCTCTGCCCTTGACATACTCCAACCTCCACACATTGACTA
TTTTGAAGAAATATATGTTGTCACAGAATTGATGCAGAGTGACCTACATAAAATTATCGTCTCTCCTCAACCACTCAGCTCAGATCATGT
CAAAGTTTTTCTTTATCAGATTTTGCGAGGTTTGAAATATCTCCATTCAGCTGGCATTTTACATCGAGACATTAAGCCAGGGAATCTCCT
TGTGAACAGCAACTGTGTTCTAAAGATTTGTGATTTTGGATTGGCCAGAGTGGAAGAATTAGATGAATCCCGTCATATGACTCAGGAAGT
TGTTACTCAGTATTATCGGGCTCCAGAAATCCTGATGGGCAGCCGTCATTACAGCAATGCTATTGACATCTGGTCTGTGGGATGTATCTT
TGCAGAACTACTAGGACGAAGAATATTGTTTCAGGCACAGAGTCCCATTCAGCAGGTACAGGACATCTGCTTCAGCCATGACTGTCGCTG
GGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACC
ACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTG
TAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAA
CAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGG
GACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTAT
CTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTA
CATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACT
GGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCC
TCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACA
TGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACC
CCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGT
GTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCC
AGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGG
TACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACAC
GGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGA
CGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGGGAAAAAAAAAGGAAAAAAAAAACAATGCCAACAGCC
CAGCGTCCGTGAGCAACCCAACAGTAACAAAGCATGCGTTCGGGATGGAGGAAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTA
ACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCC
TCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCT
GGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAG
AGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCC
CTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGA
ACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCT
CATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAA
GGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTA
CCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTTGTCCAATAAATCACGCTGCAGT

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000407086_chr17_59067332_+_3992nt
CCCCGGCTCTCTTTCTCCTCTCTGTCCTGCTGTCGCCTCCTCTCCTCACTCCAGCCTCCTTCCCTGGCTTATTCTGCCCAGGAAAGTTTG
GAACCCCCGCCCCCCCTCCCCAATCAGGTCAACCTGACTAGGAGTAGGGGGAGATGTAGGAAGGCCTGAGAGTTCGGGGGGGGGGAAGCT
GGAAGCTGGTTTCCCAGAAAATTTCCCCCCATCTTCTCCATTTAGGGTGGTGGGAATTTTTTTTAATCCTGTTTTTGAGGAGGTGGTAGG
TGTTTAGAAAAGGATGTGGGAATGGAAGGGGTAGATGAGTCAACCCTCTTTCAAGATTCCAAGGGTGGTGTGTTACCTGATCCTTTTCGT
GTGTGGAGTTCAGGGGGTCGGGAGGTTTGGCCTTTATTCCCACATTCAAAGTTGGAACCTCCCCCAAATTAAGAATGGAGTTTTAGTACC
CACTTGTGGCAGGAATCCTGGGGGGAAGGGGTCCTTTTTTCCTTTTTCTTTTCTTTTTTCCCTTTTTTTTCCTTTTGGCAACCCACACCC
TTCCACACACGCTCACCCCAAAATTAAACACCAAGATCCTCTAACTTGTTTGGATTGACTGATGAAGACATAAAGCTCTATGTTTTTTGA
GGTGGAGTGAGTGGTTTTTCTTCATTTTTAAATGGCCAAATGACAGCTTGACCCAGTTTGCTTTCCAATCAAAGGGCATTTATTTTGAAT
GTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCACCA
TCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCTGT
ACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAACA
GCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACAGT
TAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGTGT
TGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAAAG
GGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATGTACTCTCTGCCCTTGACATACTCCAACCTCCACACATTGACTA
TTTTGAAGAAATATATGTTGTCACAGAATTGATGCAGAGTGACCTACATAAAATTATCGTCTCTCCTCAACCACTCAGCTCAGATCATGT
CAAAGTTTTTCTTTATCAGATTTTGCGAGGTTTGAAATATCTCCATTCAGCTGGCATTTTACATCGAGACATTAAGCCAGGGAATCTCCT
TGTGAACAGCAACTGTGTTCTAAAGATTTGTGATTTTGGATTGGCCAGAGTGGAAGAATTAGATGAATCCCGTCATATGACTCAGGAAGT
TGTTACTCAGTATTATCGGGCTCCAGAAATCCTGATGGGCAGCCGTCATTACAGCAATGCTATTGACATCTGGTCTGTGGGATGTATCTT
TGCAGAACTACTAGGACGAAGAATATTGTTTCAGGCACAGAGTCCCATTCAGCAGGTACAGGACATCTGCTTCAGCCATGACTGTCGCTG
GGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACC
ACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTG
TAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAA
CAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGG
GACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTAT
CTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTA
CATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACT
GGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCC
TCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACA
TGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACC
CCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGT
GTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCC
AGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGG
TACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACAC
GGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGA
GGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCAC
CAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTG
GAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCG
CCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAG
GAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGT
GGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTG
AGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAA
CGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTC
TTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCT

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000390652_chr17_59067332_+_4044nt
CCCCGGCTCTCTTTCTCCTCTCTGTCCTGCTGTCGCCTCCTCTCCTCACTCCAGCCTCCTTCCCTGGCTTATTCTGCCCAGGAAAGTTTG
GAACCCCCGCCCCCCCTCCCCAATCAGGTCAACCTGACTAGGAGTAGGGGGAGATGTAGGAAGGCCTGAGAGTTCGGGGGGGGGGAAGCT
GGAAGCTGGTTTCCCAGAAAATTTCCCCCCATCTTCTCCATTTAGGGTGGTGGGAATTTTTTTTAATCCTGTTTTTGAGGAGGTGGTAGG
TGTTTAGAAAAGGATGTGGGAATGGAAGGGGTAGATGAGTCAACCCTCTTTCAAGATTCCAAGGGTGGTGTGTTACCTGATCCTTTTCGT
GTGTGGAGTTCAGGGGGTCGGGAGGTTTGGCCTTTATTCCCACATTCAAAGTTGGAACCTCCCCCAAATTAAGAATGGAGTTTTAGTACC
CACTTGTGGCAGGAATCCTGGGGGGAAGGGGTCCTTTTTTCCTTTTTCTTTTCTTTTTTCCCTTTTTTTTCCTTTTGGCAACCCACACCC
TTCCACACACGCTCACCCCAAAATTAAACACCAAGATCCTCTAACTTGTTTGGATTGACTGATGAAGACATAAAGCTCTATGTTTTTTGA
GGTGGAGTGAGTGGTTTTTCTTCATTTTTAAATGGCCAAATGACAGCTTGACCCAGTTTGCTTTCCAATCAAAGGGCATTTATTTTGAAT
GTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCACCA
TCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCTGT
ACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAACA
GCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACAGT
TAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGTGT
TGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAAAG
GGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATGTACTCTCTGCCCTTGACATACTCCAACCTCCACACATTGACTA
TTTTGAAGAAATATATGTTGTCACAGAATTGATGCAGAGTGACCTACATAAAATTATCGTCTCTCCTCAACCACTCAGCTCAGATCATGT
CAAAGTTTTTCTTTATCAGATTTTGCGAGGTTTGAAATATCTCCATTCAGCTGGCATTTTACATCGAGACATTAAGCCAGGGAATCTCCT
TGTGAACAGCAACTGTGTTCTAAAGATTTGTGATTTTGGATTGGCCAGAGTGGAAGAATTAGATGAATCCCGTCATATGACTCAGGAAGT
TGTTACTCAGTATTATCGGGCTCCAGAAATCCTGATGGGCAGCCGTCATTACAGCAATGCTATTGACATCTGGTCTGTGGGATGTATCTT
TGCAGAACTACTAGGACGAAGAATATTGTTTCAGGCACAGAGTCCCATTCAGCAGGTACAGGACATCTGCTTCAGCCATGACTGTCGCTG
GGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACC
ACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTG
TAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAA
CAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGG
GACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAAT
TTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAA
AAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCC
GCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAAC
CCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCT
TGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGA
TGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCAT
CCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGA
TTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGT
CTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTG
GCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTC
ACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGG
CAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTA
GGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGC
TCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCA
GCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACA
TCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCC
TGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACAC
TGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTC
TTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGT

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000408905_chr17_59067332_+_4058nt
CCCCGGCTCTCTTTCTCCTCTCTGTCCTGCTGTCGCCTCCTCTCCTCACTCCAGCCTCCTTCCCTGGCTTATTCTGCCCAGGAAAGTTTG
GAACCCCCGCCCCCCCTCCCCAATCAGGTCAACCTGACTAGGAGTAGGGGGAGATGTAGGAAGGCCTGAGAGTTCGGGGGGGGGGAAGCT
GGAAGCTGGTTTCCCAGAAAATTTCCCCCCATCTTCTCCATTTAGGGTGGTGGGAATTTTTTTTAATCCTGTTTTTGAGGAGGTGGTAGG
TGTTTAGAAAAGGATGTGGGAATGGAAGGGGTAGATGAGTCAACCCTCTTTCAAGATTCCAAGGGTGGTGTGTTACCTGATCCTTTTCGT
GTGTGGAGTTCAGGGGGTCGGGAGGTTTGGCCTTTATTCCCACATTCAAAGTTGGAACCTCCCCCAAATTAAGAATGGAGTTTTAGTACC
CACTTGTGGCAGGAATCCTGGGGGGAAGGGGTCCTTTTTTCCTTTTTCTTTTCTTTTTTCCCTTTTTTTTCCTTTTGGCAACCCACACCC
TTCCACACACGCTCACCCCAAAATTAAACACCAAGATCCTCTAACTTGTTTGGATTGACTGATGAAGACATAAAGCTCTATGTTTTTTGA
GGTGGAGTGAGTGGTTTTTCTTCATTTTTAAATGGCCAAATGACAGCTTGACCCAGTTTGCTTTCCAATCAAAGGGCATTTATTTTGAAT
GTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCACCA
TCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCTGT
ACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAACA
GCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACAGT
TAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGTGT
TGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAAAG
GGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATGTACTCTCTGCCCTTGACATACTCCAACCTCCACACATTGACTA
TTTTGAAGAAATATATGTTGTCACAGAATTGATGCAGAGTGACCTACATAAAATTATCGTCTCTCCTCAACCACTCAGCTCAGATCATGT
CAAAGTTTTTCTTTATCAGATTTTGCGAGGTTTGAAATATCTCCATTCAGCTGGCATTTTACATCGAGACATTAAGCCAGGGAATCTCCT
TGTGAACAGCAACTGTGTTCTAAAGATTTGTGATTTTGGATTGGCCAGAGTGGAAGAATTAGATGAATCCCGTCATATGACTCAGGAAGT
TGTTACTCAGTATTATCGGGCTCCAGAAATCCTGATGGGCAGCCGTCATTACAGCAATGCTATTGACATCTGGTCTGTGGGATGTATCTT
TGCAGAACTACTAGGACGAAGAATATTGTTTCAGGCACAGAGTCCCATTCAGCAGGTACAGGACATCTGCTTCAGCCATGACTGTCGCTG
GGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACC
ACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTG
TAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAA
CAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGG
GACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTAT
CTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTA
CATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACT
GGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCC
TCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACA
TGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACC
CCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGT
GTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCC
AGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGG
TACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACAC
GGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGA
CGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAAGTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAA
CAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCT
CTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTG
GTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGA
GACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCC
TGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAA
CAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTC
ATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAG
GAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTAC
CCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCTTGTCCAATAAATCACGCTGCAGTT

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000588462_chr17_59067332_+_4103nt
CCCCGGCTCTCTTTCTCCTCTCTGTCCTGCTGTCGCCTCCTCTCCTCACTCCAGCCTCCTTCCCTGGCTTATTCTGCCCAGGAAAGTTTG
GAACCCCCGCCCCCCCTCCCCAATCAGGTCAACCTGACTAGGAGTAGGGGGAGATGTAGGAAGGCCTGAGAGTTCGGGGGGGGGGAAGCT
GGAAGCTGGTTTCCCAGAAAATTTCCCCCCATCTTCTCCATTTAGGGTGGTGGGAATTTTTTTTAATCCTGTTTTTGAGGAGGTGGTAGG
TGTTTAGAAAAGGATGTGGGAATGGAAGGGGTAGATGAGTCAACCCTCTTTCAAGATTCCAAGGGTGGTGTGTTACCTGATCCTTTTCGT
GTGTGGAGTTCAGGGGGTCGGGAGGTTTGGCCTTTATTCCCACATTCAAAGTTGGAACCTCCCCCAAATTAAGAATGGAGTTTTAGTACC
CACTTGTGGCAGGAATCCTGGGGGGAAGGGGTCCTTTTTTCCTTTTTCTTTTCTTTTTTCCCTTTTTTTTCCTTTTGGCAACCCACACCC
TTCCACACACGCTCACCCCAAAATTAAACACCAAGATCCTCTAACTTGTTTGGATTGACTGATGAAGACATAAAGCTCTATGTTTTTTGA
GGTGGAGTGAGTGGTTTTTCTTCATTTTTAAATGGCCAAATGACAGCTTGACCCAGTTTGCTTTCCAATCAAAGGGCATTTATTTTGAAT
GTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCACCA
TCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCTGT
ACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAACA
GCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACAGT
TAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGTGT
TGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAAAG
GGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATGTACTCTCTGCCCTTGACATACTCCAACCTCCACACATTGACTA
TTTTGAAGAAATATATGTTGTCACAGAATTGATGCAGAGTGACCTACATAAAATTATCGTCTCTCCTCAACCACTCAGCTCAGATCATGT
CAAAGTTTTTCTTTATCAGATTTTGCGAGGTTTGAAATATCTCCATTCAGCTGGCATTTTACATCGAGACATTAAGCCAGGGAATCTCCT
TGTGAACAGCAACTGTGTTCTAAAGATTTGTGATTTTGGATTGGCCAGAGTGGAAGAATTAGATGAATCCCGTCATATGACTCAGGAAGT
TGTTACTCAGTATTATCGGGCTCCAGAAATCCTGATGGGCAGCCGTCATTACAGCAATGCTATTGACATCTGGTCTGTGGGATGTATCTT
TGCAGAACTACTAGGACGAAGAATATTGTTTCAGGCACAGAGTCCCATTCAGCAGGTACAGGACATCTGCTTCAGCCATGACTGTCGCTG
GGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACC
ACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTG
TAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAA
CAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGG
GACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAAT
TTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAA
AAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCC
GCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAAC
CCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCT
TGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGA
TGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCAT
CCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGA
TTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGT
CTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTG
GCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTC
ACCTAGCCGGGACGTCGTGGGATCCGGAACAGACACAGCCCTTGACGTAGCAGTAAAAACCTTCCCCCCTGAGAGACACGTGGCAGTGAA
GTGTTTTGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGG
CTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACT
GGCCAGCCCCCTCCCCTGCTGGAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCC
CAAGCTTAGTGACAGCAGCCGCCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCT
GTCGGTGGAGGCTGTGGCCAGGAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTA
TTTTTTAACCATACCCACGGTGGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTC
CACCTGGCCATTTTGACCCTGAGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGC
CCCACTCCAGCACGGGGTGAACGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATC
TGTTCATGGGAAGAGTTTGTCTTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGC

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000585744_chr17_59067332_+_3331nt
CCCCGGCTCTCTTTCTCCTCTCTGTCCTGCTGTCGCCTCCTCTCCTCACTCCAGCCTCCTTCCCTGGCTTATTCTGCCCAGGAAAGTTTG
GAACCCCCGCCCCCCCTCCCCAATCAGGTCAACCTGACTAGGAGTAGGGGGAGATGTAGGAAGGCCTGAGAGTTCGGGGGGGGGGAAGCT
GGAAGCTGGTTTCCCAGAAAATTTCCCCCCATCTTCTCCATTTAGGGTGGTGGGAATTTTTTTTAATCCTGTTTTTGAGGAGGTGGTAGG
TGTTTAGAAAAGGATGTGGGAATGGAAGGGGTAGATGAGTCAACCCTCTTTCAAGATTCCAAGGGTGGTGTGTTACCTGATCCTTTTCGT
GTGTGGAGTTCAGGGGGTCGGGAGGTTTGGCCTTTATTCCCACATTCAAAGTTGGAACCTCCCCCAAATTAAGAATGGAGTTTTAGTACC
CACTTGTGGCAGGAATCCTGGGGGGAAGGGGTCCTTTTTTCCTTTTTCTTTTCTTTTTTCCCTTTTTTTTCCTTTTGGCAACCCACACCC
TTCCACACACGCTCACCCCAAAATTAAACACCAAGATCCTCTAACTTGTTTGGATTGACTGATGAAGACATAAAGCTCTATGTTTTTTGA
GGTGGAGTGAGTGGTTTTTCTTCATTTTTAAATGGCCAAATGACAGCTTGACCCAGTTTGCTTTCCAATCAAAGGGCATTTATTTTGAAT
GTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCACCA
TCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCTGT
ACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAACA
GCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACAGT
TAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGTGT
TGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAAAG
GGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATGTACTCTCTGCCCTTGACATACTCCAACCTCCACACATTGACTA
TTTTGAAGAAATATATGTTGTCACAGAATTGATGCAGAGTGACCTACATAAAATTATCGTCTCTCCTCAACCACTCAGCTCAGATCATGT
CAAAGTTTTTCTTTATCAGATTTTGCGAGGTTTGAAATATCTCCATTCAGCTGGCATTTTACATCGAGACATTAAGCCAGGGAATCTCCT
TGTGAACAGCAACTGTGTTCTAAAGATTTGTGATTTTGGATTGGCCAGAGTGGAAGAATTAGATGAATCCCGTCATATGACTCAGGAAGT
TGTTACTCAGTATTATCGGGCTCCAGAAATCCTGATGGGCAGCCGTCATTACAGCAATGCTATTGACATCTGGTCTGTGGGATGTATCTT
TGCAGAACTACTAGGACGAAGAATATTGTTTCAGGCACAGAGTCCCATTCAGCAGGTACAGGACATCTGCTTCAGCCATGACTGTCGCTG
GGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACC
ACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTG
TAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAA
CAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGG
GACCATCACCAAACGAACCGGGCCTTATCTCTTTGGAGCGGGGTGTTTTTCCATAAAAGCCCCATGCAAAGTTAAACCTCCTCCACAAAT
TTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTATCTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAA
AAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTACATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCC
GCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACTGGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAAC
CCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCCTCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCT
TGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACATGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGA
TGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACCCCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCAT
CCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGTGTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGA
TTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCCAGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGT
CTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGGTACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTG
GCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACACGGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTC
ACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGAGGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGG
CAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCACCAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTA

>In-frame_NLK_ENST00000407008_chr17_26495683_+_BCAS3_ENST00000588874_chr17_59067332_+_3991nt
CCCCGGCTCTCTTTCTCCTCTCTGTCCTGCTGTCGCCTCCTCTCCTCACTCCAGCCTCCTTCCCTGGCTTATTCTGCCCAGGAAAGTTTG
GAACCCCCGCCCCCCCTCCCCAATCAGGTCAACCTGACTAGGAGTAGGGGGAGATGTAGGAAGGCCTGAGAGTTCGGGGGGGGGGAAGCT
GGAAGCTGGTTTCCCAGAAAATTTCCCCCCATCTTCTCCATTTAGGGTGGTGGGAATTTTTTTTAATCCTGTTTTTGAGGAGGTGGTAGG
TGTTTAGAAAAGGATGTGGGAATGGAAGGGGTAGATGAGTCAACCCTCTTTCAAGATTCCAAGGGTGGTGTGTTACCTGATCCTTTTCGT
GTGTGGAGTTCAGGGGGTCGGGAGGTTTGGCCTTTATTCCCACATTCAAAGTTGGAACCTCCCCCAAATTAAGAATGGAGTTTTAGTACC
CACTTGTGGCAGGAATCCTGGGGGGAAGGGGTCCTTTTTTCCTTTTTCTTTTCTTTTTTCCCTTTTTTTTCCTTTTGGCAACCCACACCC
TTCCACACACGCTCACCCCAAAATTAAACACCAAGATCCTCTAACTTGTTTGGATTGACTGATGAAGACATAAAGCTCTATGTTTTTTGA
GGTGGAGTGAGTGGTTTTTCTTCATTTTTAAATGGCCAAATGACAGCTTGACCCAGTTTGCTTTCCAATCAAAGGGCATTTATTTTGAAT
GTCTCTTTGTGGCGCAAGAGCCAACGCAAAAATGATGGCGGCTTACAATGGCGGTACATCTGCAGCAGCAGCAGGTCACCACCACCACCA
TCACCACCACCTTCCACACCTCCCTCCTCCTCACCTGCACCACCACCACCACCCTCAACACCATCTTCATCCGGGGTCGGCTGCCGCTGT
ACACCCTGTACAGCAGCACACCTCTTCGGCAGCTGCGGCAGCCGCAGCAGCGGCTGCAGCTGCAGCCATGTTAAACCCTGGGCAACAACA
GCCATATTTCCCATCACCGGCACCGGGGCAGGCTCCTGGACCAGCTGCAGCAGCCCCAGCTCAGGTACAGGCTGCCGCAGCTGCTACAGT
TAAGGCGCACCATCATCAGCACTCGCATCATCCACAGCAGCAGCTGGATATTGAGCCGGATAGACCTATTGGATATGGAGCCTTTGGTGT
TGTCTGGTCAGTAACAGATCCAAGAGATGGAAAGAGAGTAGCGCTCAAAAAGATGCCCAACGTCTTCCAGAATCTGGTCTCTTGCAAAAG
GGTCTTCCGGGAATTGAAGATGTTGTGTTTTTTTAAGCATGATAATGTACTCTCTGCCCTTGACATACTCCAACCTCCACACATTGACTA
TTTTGAAGAAATATATGTTGTCACAGAATTGATGCAGAGTGACCTACATAAAATTATCGTCTCTCCTCAACCACTCAGCTCAGATCATGT
CAAAGTTTTTCTTTATCAGATTTTGCGAGGTTTGAAATATCTCCATTCAGCTGGCATTTTACATCGAGACATTAAGCCAGGGAATCTCCT
TGTGAACAGCAACTGTGTTCTAAAGATTTGTGATTTTGGATTGGCCAGAGTGGAAGAATTAGATGAATCCCGTCATATGACTCAGGAAGT
TGTTACTCAGTATTATCGGGCTCCAGAAATCCTGATGGGCAGCCGTCATTACAGCAATGCTATTGACATCTGGTCTGTGGGATGTATCTT
TGCAGAACTACTAGGACGAAGAATATTGTTTCAGGCACAGAGTCCCATTCAGCAGGTACAGGACATCTGCTTCAGCCATGACTGTCGCTG
GGTTGTGGTCAGTACTCTCCGGGGTACTTCCCACGTTTTCCCCATCAACCCTTATGGTGGCCAGCCTTGTGTTCGTACACATATGTCACC
ACGAGTAGTGAATCGCATGAGCCGTTTCCAGAAAAGTGCTGGACTGGAAGAGATTGAACAAGAACTGACGTCTAAGCAAGGAGGTCGCTG
TAGCCCTGTTCCAGGTCTATCAAGCAGCCCTTCTGGGTCACCCTTGCATGGGAAACTGAACAGCCAAGACTCCTATAACAATTTTACCAA
CAACAACCCTGGCAACCCTCGGCTCTCTCCTCTTCCCAGCTTGATGGTAGTGATGCCTCTTGCACAAATCAAGCAGCCAATGACATTGGG
GACCATCACCAAACGAACCGGCAAAGTTAAACCTCCTCCACAAATTTCACCCAGCAAATCGATGGGCGGAGAATTTTGTGTGGCTGCTAT
CTTCGGAACATCCAGGTCATGGTTTGCAAATAATGCAGGTCTGAAAAGAGAAAAAGATCAGTCCAAACAAGTTGTAGTTGAGTCCCTGTA
CATTATCAGTTGCTATGGCACCTTAGTGGAACACATGATGGAGCCGCGACCCCTCAGCACTGCACCCAAGATTAGTGACGACACACCACT
GGAAATGATGACATCGCCTCGAGCCAGCTGGACTCTGGTTAGAACCCCTCAATGGAATGAATTGCAGCCACCGTTTAATGCAAACCACCC
TCTGCTCCTCGCTGCAGATGCAGTACAGTATTATCAGTTCCTGCTTGCTGGCCTGGTTCCCCCTGGAAGTCCTGGGCCCATTACTCGACA
TGGGTCTTACGACAGTTTAGCTTCTGACCATAGTGGACAGGAAGATGAAGAATGGCTTTCCCAGGTTGAAATTGTAACACACACTGGACC
CCATAGACGTCTGTGGATGGGTCCACAGTTCCAGTTCAAAACCATCCATCCCTCAGGCCAAACCACAGTTATCTCATCCAGTTCATCTGT
GTTGCAGTCTCATGGTCCGAGTGACACGCCACAGCCTCTTTTGGATTTTGATACAGATGATCTTGATCTCAACAGTCTCAGGATCCAGCC
AGTCCGCTCTGACCCCGTCAGCATGCCAGGGTCATCCCGTCCAGTCTCTGATCGAAGGGGAGTTTCCACAGTGATTGATGCTGCCTCAGG
TACCTTTGACAGGAGCGTGACCCTGCTGGAGGTGTGCGGGAGCTGGCCTGAGGGCTTCGGGCTGCGGCACATGTCCTCCATGGAGCACAC
GGAGGAGGGCCTCCGGGAGCGACTTGCCGACGCCATGGCCGAGTCACCTAGCCGGGACGTCGTGGGATCCGGAACAGAACTTCAGCGAGA
GGGAAGCATCGAGACTCTGAGTAACAGCTCAGGCTCCACCAGCGGCAGCATACCAAGAAACTTTGATGGCTACCGATCTCCGCTGCCCAC
CAATGAGAGCCAGCCCCTCAGCCTCTTCCCGACTGGCTTCCCGTAGGTACCAGCAACCTGCTTCTGACTGGCCAGCCCCCTCCCCTGCTG
GAGGAGGGGAGAAGCCCCGCTCTGGTCCTACCCTTCAGTCTCTGCTCTTCCTTCATCAACCACCTTCCCCAAGCTTAGTGACAGCAGCCG
CCCATCCTACCTGGATGGAGAAGAGACCCTTCTCCAAGCACCTCAGCGCACTTGCCCTCTGCCACACCTGTCGGTGGAGGCTGTGGCCAG
GAGAGACTGTAGAAGCTCGGTCCCTGTGTATGTTTGCATATGACATCCTGCATTGGATCCGCTTTTGTATTTTTTAACCATACCCACGGT
GGGGCGGGTGGGGGGAGCCTGGAACAGTGACCAGATCTGGGGGCCTGAGTGGGGACAGAGTTGATCGTCCACCTGGCCATTTTGACCCTG
AGTGGACAGTCACAGCCTCAGCTCATGTCTGGCTGTGACACACACTGCCCCCAGCTTCCCTTGGTCAGCCCCACTCCAGCACGGGGTGAA
CGGAGGCCCAGAGTACTAGGGAAGGAGGAAGGGAGGACATGCCTCTTCTTCCTCCTTTCTTTCCCCATCTGTTCATGGGAAGAGTTTGTC
TTTCTTATCTTTAAGCCCCTTTACCCTGGTCCTGTACTGATCAGTGAAGGAAACCGTGGTTACTGAGGCCCTGTTGAAAAGTGCACGTCT


Top

FusionGenePPI for NLK_BCAS3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NLKLEF1, CTNNB1, TCF7L2, FBXW4, FBXW5, SKP2, CUL1, MYB, HIPK2, MYBL1, MYBL2, CREBBP, FOXO4, FOXO1, FOXO3, ASGR1, ELAVL1, USP4, ATXN1, TAB2, MAP3K7, NLK, SMAD4, RCHY1, SDR16C5, KPNB1, RANBP2, C2orf44, FAM222B, FAM222A, RNF219, TNKS1BP1, SKI, RANGAP1, TLE3, CEP97, PASK, CNOT2, CCP110, UBAP2L, TRPS1, CNOT11, BACH1, CNOT3, SHANK2, PKM, TP53, MDM2, GRN, KRTAP5-9, ZHX3, QRICH1, KRTAP4-2, KRTAP10-3, KRTAP5-6, STAT5ABCAS3CTBP1, CTBP2, CDC23, C16orf70, ZDHHC17, ESR1, PELP1, HIST1H3A, KAT2B, WIPI2, ATM, BAG4, CCND1, FBXW7, KRAS, PALB2, PHB, PTPN1, SMAD4, STK11, TGFB1, TSG101, XRCC3, OFD1, CEP128, FBF1, NPHP1, SCLT1, XPO1, CD14, HDAC1, IRF3, MAGEE1, IL17RA, DOCK5, VWA5A, RAB2B


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NLK_BCAS3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NLK_BCAS3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource