FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 24019

FusionGeneSummary for NEK7_SMYD3

check button Fusion gene summary
Fusion gene informationFusion gene name: NEK7_SMYD3
Fusion gene ID: 24019
HgeneTgene
Gene symbol

NEK7

SMYD3

Gene ID

140609

64754

Gene nameNIMA related kinase 7SET and MYND domain containing 3
Synonyms-KMT3E|ZMYND1|ZNFN3A1|bA74P14.1
Cytomap

1q31.3

1q44

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase Nek7NIMA (never in mitosis gene a)-related kinase 7never in mitosis A-related kinase 7nimA-related protein kinase 7histone-lysine N-methyltransferase SMYD3SET and MYND domain-containing protein 3bA74P14.1 (novel protein)zinc finger MYND domain-containing protein 1zinc finger protein, subfamily 3A (MYND domain containing), 1zinc finger, MYND domain containing 1
Modification date2018052220180519
UniProtAcc

Q8TDX7

Q9H7B4

Ensembl transtripts involved in fusion geneENST00000367385, ENST00000538004, 
ENST00000367383, ENST00000417895, 
ENST00000541742, ENST00000490107, 
ENST00000388985, ENST00000366517, 
ENST00000403792, 
Fusion gene scores* DoF score8 X 4 X 6=19217 X 9 X 13=1989
# samples 831
** MAII scorelog2(8/192*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(31/1989*10)=-2.68170315555951
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NEK7 [Title/Abstract] AND SMYD3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNEK7

GO:0006468

protein phosphorylation

12840024


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-QQ-A5VC-01ANEK7chr1

198201767

+SMYD3chr1

246093239

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000367385ENST00000541742NEK7chr1

198201767

+SMYD3chr1

246093239

-
In-frameENST00000367385ENST00000490107NEK7chr1

198201767

+SMYD3chr1

246093239

-
In-frameENST00000367385ENST00000388985NEK7chr1

198201767

+SMYD3chr1

246093239

-
5CDS-5UTRENST00000367385ENST00000366517NEK7chr1

198201767

+SMYD3chr1

246093239

-
5CDS-intronENST00000367385ENST00000403792NEK7chr1

198201767

+SMYD3chr1

246093239

-
In-frameENST00000538004ENST00000541742NEK7chr1

198201767

+SMYD3chr1

246093239

-
In-frameENST00000538004ENST00000490107NEK7chr1

198201767

+SMYD3chr1

246093239

-
In-frameENST00000538004ENST00000388985NEK7chr1

198201767

+SMYD3chr1

246093239

-
5CDS-5UTRENST00000538004ENST00000366517NEK7chr1

198201767

+SMYD3chr1

246093239

-
5CDS-intronENST00000538004ENST00000403792NEK7chr1

198201767

+SMYD3chr1

246093239

-
In-frameENST00000367383ENST00000541742NEK7chr1

198201767

+SMYD3chr1

246093239

-
In-frameENST00000367383ENST00000490107NEK7chr1

198201767

+SMYD3chr1

246093239

-
In-frameENST00000367383ENST00000388985NEK7chr1

198201767

+SMYD3chr1

246093239

-
5CDS-5UTRENST00000367383ENST00000366517NEK7chr1

198201767

+SMYD3chr1

246093239

-
5CDS-intronENST00000367383ENST00000403792NEK7chr1

198201767

+SMYD3chr1

246093239

-
3UTR-3CDSENST00000417895ENST00000541742NEK7chr1

198201767

+SMYD3chr1

246093239

-
3UTR-3CDSENST00000417895ENST00000490107NEK7chr1

198201767

+SMYD3chr1

246093239

-
3UTR-3CDSENST00000417895ENST00000388985NEK7chr1

198201767

+SMYD3chr1

246093239

-
3UTR-5UTRENST00000417895ENST00000366517NEK7chr1

198201767

+SMYD3chr1

246093239

-
3UTR-intronENST00000417895ENST00000403792NEK7chr1

198201767

+SMYD3chr1

246093239

-

Top

FusionProtFeatures for NEK7_SMYD3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NEK7

Q8TDX7

SMYD3

Q9H7B4

Protein kinase which plays an important role in mitoticcell cycle progression. Required for microtubule nucleationactivity of the centrosome, robust mitotic spindle formation andcytokinesis. Phosphorylates RPS6KB1. {ECO:0000269|PubMed:17101132,ECO:0000269|PubMed:17586473, ECO:0000269|PubMed:19414596}. Histone methyltransferase. Specifically methylates 'Lys-4' of histone H3, inducing di- and tri-methylation, but notmonomethylation (PubMed:15235609, PubMed:22419068). Alsomethylates 'Lys-5' of histone H4 (PubMed:22419068). Plays animportant role in transcriptional activation as a member of an RNApolymerase complex (PubMed:15235609). Binds DNA containing 5'-CCCTCC-3' or 5'-GAGGGG-3' sequences (PubMed:15235609).{ECO:0000269|PubMed:15235609, ECO:0000269|PubMed:22419068}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSMYD3chr1:198201767chr1:246093239ENST00000388985-412205_206177429RegionS-adenosyl-L-methionine binding
TgeneSMYD3chr1:198201767chr1:246093239ENST00000490107-412205_206118370RegionS-adenosyl-L-methionine binding
TgeneSMYD3chr1:198201767chr1:246093239ENST00000541742-412205_206118370RegionS-adenosyl-L-methionine binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNEK7chr1:198201767chr1:246093239ENST00000367383+2434_29919120DomainProtein kinase
HgeneNEK7chr1:198201767chr1:246093239ENST00000367385+21034_29919303DomainProtein kinase
HgeneNEK7chr1:198201767chr1:246093239ENST00000538004+21034_29919303DomainProtein kinase
HgeneNEK7chr1:198201767chr1:246093239ENST00000367383+2440_4819120Nucleotide bindingNote=ATP
HgeneNEK7chr1:198201767chr1:246093239ENST00000367385+21040_4819303Nucleotide bindingNote=ATP
HgeneNEK7chr1:198201767chr1:246093239ENST00000538004+21040_4819303Nucleotide bindingNote=ATP
HgeneNEK7chr1:198201767chr1:246093239ENST00000367383+2420_3319120RegionNote=NTE motif
HgeneNEK7chr1:198201767chr1:246093239ENST00000367385+21020_3319303RegionNote=NTE motif
HgeneNEK7chr1:198201767chr1:246093239ENST00000538004+21020_3319303RegionNote=NTE motif
TgeneSMYD3chr1:198201767chr1:246093239ENST00000388985-4124_240177429DomainSET
TgeneSMYD3chr1:198201767chr1:246093239ENST00000490107-4124_240118370DomainSET
TgeneSMYD3chr1:198201767chr1:246093239ENST00000541742-4124_240118370DomainSET
TgeneSMYD3chr1:198201767chr1:246093239ENST00000388985-41214_16177429RegionS-adenosyl-L-methionine binding
TgeneSMYD3chr1:198201767chr1:246093239ENST00000490107-41214_16118370RegionS-adenosyl-L-methionine binding
TgeneSMYD3chr1:198201767chr1:246093239ENST00000541742-41214_16118370RegionS-adenosyl-L-methionine binding
TgeneSMYD3chr1:198201767chr1:246093239ENST00000388985-41249_87177429Zinc fingerMYND-type
TgeneSMYD3chr1:198201767chr1:246093239ENST00000490107-41249_87118370Zinc fingerMYND-type
TgeneSMYD3chr1:198201767chr1:246093239ENST00000541742-41249_87118370Zinc fingerMYND-type


Top

FusionGeneSequence for NEK7_SMYD3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NEK7_ENST00000367385_chr1_198201767_+_SMYD3_ENST00000541742_chr1_246093239_-_271aa
MDEQSQGMQGPPVPQFQPQVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEE
RRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDAC
INLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS

>In-frame_NEK7_ENST00000367385_chr1_198201767_+_SMYD3_ENST00000490107_chr1_246093239_-_271aa
MDEQSQGMQGPPVPQFQPQVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEE
RRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDAC
INLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS

>In-frame_NEK7_ENST00000367385_chr1_198201767_+_SMYD3_ENST00000388985_chr1_246093239_-_271aa
MDEQSQGMQGPPVPQFQPQVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEE
RRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDAC
INLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS

>In-frame_NEK7_ENST00000538004_chr1_198201767_+_SMYD3_ENST00000541742_chr1_246093239_-_271aa
MDEQSQGMQGPPVPQFQPQVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEE
RRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDAC
INLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS

>In-frame_NEK7_ENST00000538004_chr1_198201767_+_SMYD3_ENST00000490107_chr1_246093239_-_271aa
MDEQSQGMQGPPVPQFQPQVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEE
RRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDAC
INLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS

>In-frame_NEK7_ENST00000538004_chr1_198201767_+_SMYD3_ENST00000388985_chr1_246093239_-_271aa
MDEQSQGMQGPPVPQFQPQVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEE
RRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDAC
INLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS

>In-frame_NEK7_ENST00000367383_chr1_198201767_+_SMYD3_ENST00000541742_chr1_246093239_-_271aa
MDEQSQGMQGPPVPQFQPQVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEE
RRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDAC
INLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS

>In-frame_NEK7_ENST00000367383_chr1_198201767_+_SMYD3_ENST00000490107_chr1_246093239_-_271aa
MDEQSQGMQGPPVPQFQPQVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEE
RRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDAC
INLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS

>In-frame_NEK7_ENST00000367383_chr1_198201767_+_SMYD3_ENST00000388985_chr1_246093239_-_271aa
MDEQSQGMQGPPVPQFQPQVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELTICYLDMLMTSEE
RRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEELKAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDAC
INLGLLEEALFYGTRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NEK7_ENST00000367385_chr1_198201767_+_SMYD3_ENST00000541742_chr1_246093239_-_813nt
ATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCG
GAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGG
CCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAG
CGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGT
GATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATG
TGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGC
ATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTC
AGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGAT
ATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCGACGCCAACATCAGAGCATCC

>In-frame_NEK7_ENST00000367385_chr1_198201767_+_SMYD3_ENST00000490107_chr1_246093239_-_813nt
ATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCG
GAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGG
CCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAG
CGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGT
GATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATG
TGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGC
ATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTC
AGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGAT
ATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCGACGCCAACATCAGAGCATCC

>In-frame_NEK7_ENST00000367385_chr1_198201767_+_SMYD3_ENST00000388985_chr1_246093239_-_813nt
ATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCG
GAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGG
CCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAG
CGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGT
GATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATG
TGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGC
ATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTC
AGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGAT
ATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCGACGCCAACATCAGAGCATCC

>In-frame_NEK7_ENST00000538004_chr1_198201767_+_SMYD3_ENST00000541742_chr1_246093239_-_813nt
ATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCG
GAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGG
CCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAG
CGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGT
GATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATG
TGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGC
ATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTC
AGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGAT
ATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCGACGCCAACATCAGAGCATCC

>In-frame_NEK7_ENST00000538004_chr1_198201767_+_SMYD3_ENST00000490107_chr1_246093239_-_813nt
ATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCG
GAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGG
CCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAG
CGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGT
GATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATG
TGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGC
ATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTC
AGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGAT
ATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCGACGCCAACATCAGAGCATCC

>In-frame_NEK7_ENST00000538004_chr1_198201767_+_SMYD3_ENST00000388985_chr1_246093239_-_813nt
ATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCG
GAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGG
CCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAG
CGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGT
GATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATG
TGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGC
ATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTC
AGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGAT
ATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCGACGCCAACATCAGAGCATCC

>In-frame_NEK7_ENST00000367383_chr1_198201767_+_SMYD3_ENST00000541742_chr1_246093239_-_813nt
ATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCG
GAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGG
CCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAG
CGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGT
GATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATG
TGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGC
ATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTC
AGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGAT
ATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCGACGCCAACATCAGAGCATCC

>In-frame_NEK7_ENST00000367383_chr1_198201767_+_SMYD3_ENST00000490107_chr1_246093239_-_813nt
ATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCG
GAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGG
CCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAG
CGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGT
GATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATG
TGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGC
ATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTC
AGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGAT
ATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCGACGCCAACATCAGAGCATCC

>In-frame_NEK7_ENST00000367383_chr1_198201767_+_SMYD3_ENST00000388985_chr1_246093239_-_813nt
ATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCG
GAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGG
CCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAG
CGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGT
GATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATG
TGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGC
ATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTC
AGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGAT
ATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCGACGCCAACATCAGAGCATCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_NEK7_ENST00000367385_chr1_198201767_+_SMYD3_ENST00000541742_chr1_246093239_-_1378nt
GCCCCGCCCCTCTCCTCGGGGATGCCGGGATGTTTACACTCCTGACAGCGGCGGCAGCAGGAGGAGGATCGGGAGTCGCGGGAGGATGGG
CCGCCGCTAGGCTCGCACTCCGGACGCGCCTCGCAGTGCGCAGGGTGGGTGCCCCGCGCCTGCAGCGTCCGCCGGGGCGGCGCGGCGGGA
GGTGGCCGACAGGCTCCGGGCCTCGCAGCCTCAGCCCCCGGCCCAGCGCGCTTTCCGACGGCGGCGCCGCGCCGAGCCACCCGCCCGCCC
AAGGTCTCTCGCGGGCGGGAGAACGGAAAACTCCCAACTTCCTGAGTTCTAAAGTTCCTGTTGCTTCAGACAATGGATGAGCAATCACAA
GGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGT
GTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGA
GCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGG
GACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAG
GAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGC
AGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTG
GAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATG
AAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACACAT
GGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCGACGCCAACATCAGAGCATCCTAAGGGAACGCAGTCAGA
GGGAAATACGGCGTGTGTCTTTGTTGAATGCCTTATTGAGGTCACACACTCTATGCTTTGTTAGCTGTGTGAACCTCTCCTATTGGAAAT
TCTGTTCCGTGTTTGTGTAGGTAAATAAAGGCAGACATGGTTTGCAAACCACAAGAATCATTAGTTGTAGAGAAGCACGATTATAATAAA

>In-frame_NEK7_ENST00000367385_chr1_198201767_+_SMYD3_ENST00000490107_chr1_246093239_-_1376nt
GCCCCGCCCCTCTCCTCGGGGATGCCGGGATGTTTACACTCCTGACAGCGGCGGCAGCAGGAGGAGGATCGGGAGTCGCGGGAGGATGGG
CCGCCGCTAGGCTCGCACTCCGGACGCGCCTCGCAGTGCGCAGGGTGGGTGCCCCGCGCCTGCAGCGTCCGCCGGGGCGGCGCGGCGGGA
GGTGGCCGACAGGCTCCGGGCCTCGCAGCCTCAGCCCCCGGCCCAGCGCGCTTTCCGACGGCGGCGCCGCGCCGAGCCACCCGCCCGCCC
AAGGTCTCTCGCGGGCGGGAGAACGGAAAACTCCCAACTTCCTGAGTTCTAAAGTTCCTGTTGCTTCAGACAATGGATGAGCAATCACAA
GGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGT
GTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGA
GCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGG
GACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAG
GAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGC
AGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTG
GAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATG
AAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACACAT
GGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCGACGCCAACATCAGAGCATCCTAAGGGAACGCAGTCAGA
GGGAAATACGGCGTGTGTCTTTGTTGAATGCCTTATTGAGGTCACACACTCTATGCTTTGTTAGCTGTGTGAACCTCTCCTATTGGAAAT
TCTGTTCCGTGTTTGTGTAGGTAAATAAAGGCAGACATGGTTTGCAAACCACAAGAATCATTAGTTGTAGAGAAGCACGATTATAATAAA

>In-frame_NEK7_ENST00000367385_chr1_198201767_+_SMYD3_ENST00000388985_chr1_246093239_-_1155nt
GCCCCGCCCCTCTCCTCGGGGATGCCGGGATGTTTACACTCCTGACAGCGGCGGCAGCAGGAGGAGGATCGGGAGTCGCGGGAGGATGGG
CCGCCGCTAGGCTCGCACTCCGGACGCGCCTCGCAGTGCGCAGGGTGGGTGCCCCGCGCCTGCAGCGTCCGCCGGGGCGGCGCGGCGGGA
GGTGGCCGACAGGCTCCGGGCCTCGCAGCCTCAGCCCCCGGCCCAGCGCGCTTTCCGACGGCGGCGCCGCGCCGAGCCACCCGCCCGCCC
AAGGTCTCTCGCGGGCGGGAGAACGGAAAACTCCCAACTTCCTGAGTTCTAAAGTTCCTGTTGCTTCAGACAATGGATGAGCAATCACAA
GGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGT
GTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGA
GCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGG
GACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAG
GAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGC
AGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTG
GAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATG
AAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACACAT

>In-frame_NEK7_ENST00000538004_chr1_198201767_+_SMYD3_ENST00000541742_chr1_246093239_-_1163nt
ACACTCCTGACAGCGGCGGCAGCAGGAGGAGGATCGGGAGTCGCGGGAGGATGGGCCGCCGCTAGGCTCGCACTCCGGACGCGCCTCGCA
GTGCGCAGGAGTTCTAAAGTTCCTGTTGCTTCAGACAATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACC
ACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCA
CAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCAC
CATCTGCTACCTGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTG
CCAAACCCAGGACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACT
GAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTA
CCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGA
GCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTT
TCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCT
ACTTTTAGAAGAATGCGACGCCAACATCAGAGCATCCTAAGGGAACGCAGTCAGAGGGAAATACGGCGTGTGTCTTTGTTGAATGCCTTA
TTGAGGTCACACACTCTATGCTTTGTTAGCTGTGTGAACCTCTCCTATTGGAAATTCTGTTCCGTGTTTGTGTAGGTAAATAAAGGCAGA

>In-frame_NEK7_ENST00000538004_chr1_198201767_+_SMYD3_ENST00000490107_chr1_246093239_-_1161nt
ACACTCCTGACAGCGGCGGCAGCAGGAGGAGGATCGGGAGTCGCGGGAGGATGGGCCGCCGCTAGGCTCGCACTCCGGACGCGCCTCGCA
GTGCGCAGGAGTTCTAAAGTTCCTGTTGCTTCAGACAATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACC
ACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCA
CAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCAC
CATCTGCTACCTGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTG
CCAAACCCAGGACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACT
GAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTA
CCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGA
GCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTT
TCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCT
ACTTTTAGAAGAATGCGACGCCAACATCAGAGCATCCTAAGGGAACGCAGTCAGAGGGAAATACGGCGTGTGTCTTTGTTGAATGCCTTA
TTGAGGTCACACACTCTATGCTTTGTTAGCTGTGTGAACCTCTCCTATTGGAAATTCTGTTCCGTGTTTGTGTAGGTAAATAAAGGCAGA

>In-frame_NEK7_ENST00000538004_chr1_198201767_+_SMYD3_ENST00000388985_chr1_246093239_-_940nt
ACACTCCTGACAGCGGCGGCAGCAGGAGGAGGATCGGGAGTCGCGGGAGGATGGGCCGCCGCTAGGCTCGCACTCCGGACGCGCCTCGCA
GTGCGCAGGAGTTCTAAAGTTCCTGTTGCTTCAGACAATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACC
ACAGGTGATCTGCAACTCTTTCACCATCTGTAATGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCA
CAGCTGTGACCCCAACTGTTCGATTGTGTTCAATGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCAC
CATCTGCTACCTGGATATGCTGATGACCAGTGAGGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTG
CCAAACCCAGGACAAGGATGCTGATATGCTAACTGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACT
GAAGGCACACTGGAAGTGGGAGCAGGTTCTGGCCATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTA
CCAGCTGAAGGTGCTCGACTGCGCCATGGATGCCTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGA
GCCATACAGGATTTTTTTCCCAGGAAGCCATCCCGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTT
TCCCCAAGCAATGAAGAATCTGAGACTGGCTTTTGATATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCT

>In-frame_NEK7_ENST00000367383_chr1_198201767_+_SMYD3_ENST00000541742_chr1_246093239_-_1220nt
CCGCCGGGGCGGCGCGGCGGGAGGTGGCCGACAGGCTCCGGGCCTCGCAGCCTCAGCCCCCGGCCCAGCGCGCTTTCCGACGGCGGCGCC
GCGCCGAGCCACCCGCCCGCCCAAGGTCTCTCGCGGGCGGGAGAACGGAAAACTCCCAACTTCCTGAGTTCTAAAGTTCCTGTTGCTTCA
GACAATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAA
TGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAA
TGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGA
GGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAAC
TGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGC
CATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGC
CTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCC
CGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTT
TGATATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCGACGCCAACATCAGAGC
ATCCTAAGGGAACGCAGTCAGAGGGAAATACGGCGTGTGTCTTTGTTGAATGCCTTATTGAGGTCACACACTCTATGCTTTGTTAGCTGT
GTGAACCTCTCCTATTGGAAATTCTGTTCCGTGTTTGTGTAGGTAAATAAAGGCAGACATGGTTTGCAAACCACAAGAATCATTAGTTGT

>In-frame_NEK7_ENST00000367383_chr1_198201767_+_SMYD3_ENST00000490107_chr1_246093239_-_1218nt
CCGCCGGGGCGGCGCGGCGGGAGGTGGCCGACAGGCTCCGGGCCTCGCAGCCTCAGCCCCCGGCCCAGCGCGCTTTCCGACGGCGGCGCC
GCGCCGAGCCACCCGCCCGCCCAAGGTCTCTCGCGGGCGGGAGAACGGAAAACTCCCAACTTCCTGAGTTCTAAAGTTCCTGTTGCTTCA
GACAATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAA
TGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAA
TGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGA
GGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAAC
TGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGC
CATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGC
CTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCC
CGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTT
TGATATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCGACGCCAACATCAGAGC
ATCCTAAGGGAACGCAGTCAGAGGGAAATACGGCGTGTGTCTTTGTTGAATGCCTTATTGAGGTCACACACTCTATGCTTTGTTAGCTGT
GTGAACCTCTCCTATTGGAAATTCTGTTCCGTGTTTGTGTAGGTAAATAAAGGCAGACATGGTTTGCAAACCACAAGAATCATTAGTTGT

>In-frame_NEK7_ENST00000367383_chr1_198201767_+_SMYD3_ENST00000388985_chr1_246093239_-_997nt
CCGCCGGGGCGGCGCGGCGGGAGGTGGCCGACAGGCTCCGGGCCTCGCAGCCTCAGCCCCCGGCCCAGCGCGCTTTCCGACGGCGGCGCC
GCGCCGAGCCACCCGCCCGCCCAAGGTCTCTCGCGGGCGGGAGAACGGAAAACTCCCAACTTCCTGAGTTCTAAAGTTCCTGTTGCTTCA
GACAATGGATGAGCAATCACAAGGAATGCAAGGGCCACCTGTTCCTCAGTTCCAACCACAGGTGATCTGCAACTCTTTCACCATCTGTAA
TGCGGAGATGCAGGAAGTTGGTGTTGGCCTATATCCCAGTATCTCTTTGCTCAATCACAGCTGTGACCCCAACTGTTCGATTGTGTTCAA
TGGGCCCCACCTCTTACTGCGAGCAGTCCGAGACATCGAGGTGGGAGAGGAGCTCACCATCTGCTACCTGGATATGCTGATGACCAGTGA
GGAGCGCCGGAAGCAGCTGAGGGACCAGTACTGCTTTGAATGTGACTGTTTCCGTTGCCAAACCCAGGACAAGGATGCTGATATGCTAAC
TGGTGATGAGCAAGTATGGAAGGAAGTTCAAGAATCCCTGAAAAAAATTGAAGAACTGAAGGCACACTGGAAGTGGGAGCAGGTTCTGGC
CATGTGCCAGGCAATCATAAGCAGCAATTCTGAACGGCTTCCCGATATCAACATCTACCAGCTGAAGGTGCTCGACTGCGCCATGGATGC
CTGCATCAACCTCGGCCTGTTGGAGGAAGCCTTGTTCTATGGTACTCGGACCATGGAGCCATACAGGATTTTTTTCCCAGGAAGCCATCC
CGTCAGAGGGGTTCAAGTGATGAAAGTTGGCAAACTGCAGCTACATCAAGGCATGTTTCCCCAAGCAATGAAGAATCTGAGACTGGCTTT
TGATATTATGAGAGTGACACATGGCAGAGAACACAGCCTGATTGAAGATTTGATTCTACTTTTAGAAGAATGCGACGCCAACATCAGAGC


Top

FusionGenePPI for NEK7_SMYD3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NEK7NEK6, NEK9, TNF, NFATC1, LAMP3, ZNF669, ZNF214, PCDHGB1, IL13RA2, P4HA2, SLC39A9, ZNF331, DPH3, LLGL2, GPR107, ZNF556, PTPN21, ANKS3, ANKS6, SCYL1, P4HB, RREB1, EML4, CBS, NEK8, DYNLL1, PLK1, WDR19, IFT122, WDR35, TRIM25, TERF1, NEK7SMYD3MEST, HELZ, POLR2A, HSP90AA1, HIST3H3, ESR1, EZH2, EED, APP, CAMK2B, NDUFAB1, NFYB, CYP39A1, VANGL1, H3F3C, TRIT1, ZNF557, CDC37, HSP90AB1, HSP90AB4P, HSP90AB3P, HSP90AA5P, MAGED4B, KDM3B, RCAN3, PLCB3, TRMT2A, KMT2E


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NEK7_SMYD3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NEK7_SMYD3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNEK7C0043094Weight Gain1CTD_human
TgeneSMYD3C0236733Amphetamine-Related Disorders1CTD_human