FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23504

FusionGeneSummary for NBEA_NDFIP2

check button Fusion gene summary
Fusion gene informationFusion gene name: NBEA_NDFIP2
Fusion gene ID: 23504
HgeneTgene
Gene symbol

NBEA

NDFIP2

Gene ID

26960

54602

Gene nameneurobeachinNedd4 family interacting protein 2
SynonymsBCL8B|LYST2N4WBP5A
Cytomap

13q13.3

13q31.1

Type of geneprotein-codingprotein-coding
Descriptionneurobeachinlysosomal-trafficking regulator 2NEDD4 family-interacting protein 2MAPK-activating protein PM04 PM05 PM06 PM07NEDD4 WW domain-binding protein 5ANF-kappa-B-activating protein 413putative MAPK-activating protein PM04/PM05/PM06/PM07putative NF-kappa-B-activating protein 413
Modification date2018051920180522
UniProtAcc

Q8NFP9

Q9NV92

Ensembl transtripts involved in fusion geneENST00000540320, ENST00000400445, 
ENST00000310336, ENST00000379939, 
ENST00000537702, ENST00000379922, 
ENST00000461581, 
ENST00000218652, 
ENST00000494647, 
Fusion gene scores* DoF score7 X 7 X 6=2941 X 1 X 1=1
# samples 71
** MAII scorelog2(7/294*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: NBEA [Title/Abstract] AND NDFIP2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-50-6591-01ANBEAchr13

35517251

+NDFIP2chr13

80094945

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000540320ENST00000218652NBEAchr13

35517251

+NDFIP2chr13

80094945

+
5CDS-3UTRENST00000540320ENST00000494647NBEAchr13

35517251

+NDFIP2chr13

80094945

+
In-frameENST00000400445ENST00000218652NBEAchr13

35517251

+NDFIP2chr13

80094945

+
5CDS-3UTRENST00000400445ENST00000494647NBEAchr13

35517251

+NDFIP2chr13

80094945

+
In-frameENST00000310336ENST00000218652NBEAchr13

35517251

+NDFIP2chr13

80094945

+
5CDS-3UTRENST00000310336ENST00000494647NBEAchr13

35517251

+NDFIP2chr13

80094945

+
In-frameENST00000379939ENST00000218652NBEAchr13

35517251

+NDFIP2chr13

80094945

+
5CDS-3UTRENST00000379939ENST00000494647NBEAchr13

35517251

+NDFIP2chr13

80094945

+
intron-3CDSENST00000537702ENST00000218652NBEAchr13

35517251

+NDFIP2chr13

80094945

+
intron-3UTRENST00000537702ENST00000494647NBEAchr13

35517251

+NDFIP2chr13

80094945

+
intron-3CDSENST00000379922ENST00000218652NBEAchr13

35517251

+NDFIP2chr13

80094945

+
intron-3UTRENST00000379922ENST00000494647NBEAchr13

35517251

+NDFIP2chr13

80094945

+
intron-3CDSENST00000461581ENST00000218652NBEAchr13

35517251

+NDFIP2chr13

80094945

+
intron-3UTRENST00000461581ENST00000494647NBEAchr13

35517251

+NDFIP2chr13

80094945

+

Top

FusionProtFeatures for NBEA_NDFIP2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NBEA

Q8NFP9

NDFIP2

Q9NV92

Binds to type II regulatory subunits of protein kinase Aand anchors/targets them to the membrane. May anchor the kinase tocytoskeletal and/or organelle-associated proteins (By similarity).{ECO:0000250}. Activates HECT domain-containing E3 ubiquitin-proteinligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, andconsequently modulates the stability of their targets. As aresult, may control many cellular processes. Recruits ITCH, NEDD4and SMURF2 to endosomal membranes. Negatively regulates KCNH2potassium channel activity by decreasing its cell-surfaceexpression and interfering with channel maturation throughrecruitment of NEDD4L to the Golgi apparatus and multivesicularbody where it mediates KCNH2 degradation (PubMed:26363003). Maymodulate EGFR signaling. Together with NDFIP1, limits the cytokinesignaling and expansion of effector Th2 T-cells by promotingdegradation of JAK1, probably by ITCH- and NEDD4L-mediatedubiquitination (By similarity). {ECO:0000250|UniProtKB:Q91ZP6,ECO:0000269|PubMed:12761501, ECO:0000269|PubMed:19343052,ECO:0000269|PubMed:20534535, ECO:0000269|PubMed:26363003}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneNDFIP2chr13:35517251chr13:80094945ENST00000218652+08148_1511071399MotifNote=PPxY motif 1
TgeneNDFIP2chr13:35517251chr13:80094945ENST00000218652+08174_1771071399MotifNote=PPxY motif 2
TgeneNDFIP2chr13:35517251chr13:80094945ENST00000218652+08184_1861071399MotifNote=PPxY motif 3
TgeneNDFIP2chr13:35517251chr13:80094945ENST00000218652+08253_2571071399Topological domainExtracellular
TgeneNDFIP2chr13:35517251chr13:80094945ENST00000218652+08279_2871071399Topological domainCytoplasmic
TgeneNDFIP2chr13:35517251chr13:80094945ENST00000218652+08309_3361071399Topological domainExtracellular
TgeneNDFIP2chr13:35517251chr13:80094945ENST00000218652+08232_2521071399TransmembraneHelical
TgeneNDFIP2chr13:35517251chr13:80094945ENST00000218652+08258_2781071399TransmembraneHelical
TgeneNDFIP2chr13:35517251chr13:80094945ENST00000218652+08288_3081071399TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneNBEAchr13:35517251chr13:80094945ENST00000379922+1132147_2255-159525DomainBEACH-type PH
HgeneNBEAchr13:35517251chr13:80094945ENST00000379922+1132274_2563-159525DomainBEACH
HgeneNBEAchr13:35517251chr13:80094945ENST00000400445+1582147_2255982947DomainBEACH-type PH
HgeneNBEAchr13:35517251chr13:80094945ENST00000400445+1582274_2563982947DomainBEACH
HgeneNBEAchr13:35517251chr13:80094945ENST00000537702+1182147_2255-42740DomainBEACH-type PH
HgeneNBEAchr13:35517251chr13:80094945ENST00000537702+1182274_2563-42740DomainBEACH
HgeneNBEAchr13:35517251chr13:80094945ENST00000379922+1131326_1368-159525RepeatWD 1
HgeneNBEAchr13:35517251chr13:80094945ENST00000379922+1132718_2761-159525RepeatWD 2
HgeneNBEAchr13:35517251chr13:80094945ENST00000379922+1132778_2818-159525RepeatWD 3
HgeneNBEAchr13:35517251chr13:80094945ENST00000379922+1132860_2899-159525RepeatWD 4
HgeneNBEAchr13:35517251chr13:80094945ENST00000379922+1132902_2941-159525RepeatWD 5
HgeneNBEAchr13:35517251chr13:80094945ENST00000400445+1581326_1368982947RepeatWD 1
HgeneNBEAchr13:35517251chr13:80094945ENST00000400445+1582718_2761982947RepeatWD 2
HgeneNBEAchr13:35517251chr13:80094945ENST00000400445+1582778_2818982947RepeatWD 3
HgeneNBEAchr13:35517251chr13:80094945ENST00000400445+1582860_2899982947RepeatWD 4
HgeneNBEAchr13:35517251chr13:80094945ENST00000400445+1582902_2941982947RepeatWD 5
HgeneNBEAchr13:35517251chr13:80094945ENST00000537702+1181326_1368-42740RepeatWD 1
HgeneNBEAchr13:35517251chr13:80094945ENST00000537702+1182718_2761-42740RepeatWD 2
HgeneNBEAchr13:35517251chr13:80094945ENST00000537702+1182778_2818-42740RepeatWD 3
HgeneNBEAchr13:35517251chr13:80094945ENST00000537702+1182860_2899-42740RepeatWD 4
HgeneNBEAchr13:35517251chr13:80094945ENST00000537702+1182902_2941-42740RepeatWD 5
TgeneNDFIP2chr13:35517251chr13:80094945ENST00000218652+081_2311071399Topological domainCytoplasmic


Top

FusionGeneSequence for NBEA_NDFIP2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NBEA_ENST00000540320_chr13_35517251_+_NDFIP2_ENST00000218652_chr13_80094945_+_328aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEA
EKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIV

>In-frame_NBEA_ENST00000400445_chr13_35517251_+_NDFIP2_ENST00000218652_chr13_80094945_+_328aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEA
EKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIV

>In-frame_NBEA_ENST00000310336_chr13_35517251_+_NDFIP2_ENST00000218652_chr13_80094945_+_328aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEA
EKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIV

>In-frame_NBEA_ENST00000379939_chr13_35517251_+_NDFIP2_ENST00000218652_chr13_80094945_+_328aa
MASEKPGPGPGLEPQPVGLIAVGAAGGGGGGSGGGGTGGSGMGELRGASGSGSVMLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRD
IVETVLNLLLNEEDNSESSAIEQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVATSLPTYDEA
EKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NBEA_ENST00000540320_chr13_35517251_+_NDFIP2_ENST00000218652_chr13_80094945_+_984nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTTCTTAATGAAGAGGATAACTCAGAATCATCGGCTATAGAGCAGCCACCTACTTCAAACCCAGCA
CCGCAGATTGTGCAGGCTGCGTCTTCAGCACCAGCACTTGAAACTGACTCTTCCCCTCCACCATATAGTAGTATTACTGTGGAAGTACCT
ACAACTTCAGATACAGAAGTTTACGGTGAGTTTTATCCCGTGCCACCTCCCTATAGCGTTGCTACCTCTCTTCCTACATACGATGAAGCT
GAGAAGGCTAAAGCTGCTGCAATGGCAGCTGCAGCAGCAGAAACATCTCAAAGAATTCAGGAGGAAGAGTGTCCACCAAGAGATGACTTC
AGTGATGCAGACCAGCTCAGAGTGGGGAATGATGGCATTTTCATGCTGGCATTTTTCATGGCATTTATTTTCAACTGGCTTGGATTTTGT
TTATCCTTCTGTATCACCAATACCATAGCTGGAAGGTATGGTGCTATCTGCGGATTTGGCCTTTCCTTGATCAAATGGATCCTTATTGTC
AGGTTTTCTGATTATTTTACTGGATATTTCAATGGACAGTATTGGCTTTGGTGGATATTTCTTGTACTTGGCCTGCTCCTTTTCTTCAGA

>In-frame_NBEA_ENST00000400445_chr13_35517251_+_NDFIP2_ENST00000218652_chr13_80094945_+_984nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTTCTTAATGAAGAGGATAACTCAGAATCATCGGCTATAGAGCAGCCACCTACTTCAAACCCAGCA
CCGCAGATTGTGCAGGCTGCGTCTTCAGCACCAGCACTTGAAACTGACTCTTCCCCTCCACCATATAGTAGTATTACTGTGGAAGTACCT
ACAACTTCAGATACAGAAGTTTACGGTGAGTTTTATCCCGTGCCACCTCCCTATAGCGTTGCTACCTCTCTTCCTACATACGATGAAGCT
GAGAAGGCTAAAGCTGCTGCAATGGCAGCTGCAGCAGCAGAAACATCTCAAAGAATTCAGGAGGAAGAGTGTCCACCAAGAGATGACTTC
AGTGATGCAGACCAGCTCAGAGTGGGGAATGATGGCATTTTCATGCTGGCATTTTTCATGGCATTTATTTTCAACTGGCTTGGATTTTGT
TTATCCTTCTGTATCACCAATACCATAGCTGGAAGGTATGGTGCTATCTGCGGATTTGGCCTTTCCTTGATCAAATGGATCCTTATTGTC
AGGTTTTCTGATTATTTTACTGGATATTTCAATGGACAGTATTGGCTTTGGTGGATATTTCTTGTACTTGGCCTGCTCCTTTTCTTCAGA

>In-frame_NBEA_ENST00000310336_chr13_35517251_+_NDFIP2_ENST00000218652_chr13_80094945_+_984nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTTCTTAATGAAGAGGATAACTCAGAATCATCGGCTATAGAGCAGCCACCTACTTCAAACCCAGCA
CCGCAGATTGTGCAGGCTGCGTCTTCAGCACCAGCACTTGAAACTGACTCTTCCCCTCCACCATATAGTAGTATTACTGTGGAAGTACCT
ACAACTTCAGATACAGAAGTTTACGGTGAGTTTTATCCCGTGCCACCTCCCTATAGCGTTGCTACCTCTCTTCCTACATACGATGAAGCT
GAGAAGGCTAAAGCTGCTGCAATGGCAGCTGCAGCAGCAGAAACATCTCAAAGAATTCAGGAGGAAGAGTGTCCACCAAGAGATGACTTC
AGTGATGCAGACCAGCTCAGAGTGGGGAATGATGGCATTTTCATGCTGGCATTTTTCATGGCATTTATTTTCAACTGGCTTGGATTTTGT
TTATCCTTCTGTATCACCAATACCATAGCTGGAAGGTATGGTGCTATCTGCGGATTTGGCCTTTCCTTGATCAAATGGATCCTTATTGTC
AGGTTTTCTGATTATTTTACTGGATATTTCAATGGACAGTATTGGCTTTGGTGGATATTTCTTGTACTTGGCCTGCTCCTTTTCTTCAGA

>In-frame_NBEA_ENST00000379939_chr13_35517251_+_NDFIP2_ENST00000218652_chr13_80094945_+_984nt
ATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGG
GGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATG
ATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGAC
ATCGTGGAGACGGTGCTCAACCTGCTTCTTAATGAAGAGGATAACTCAGAATCATCGGCTATAGAGCAGCCACCTACTTCAAACCCAGCA
CCGCAGATTGTGCAGGCTGCGTCTTCAGCACCAGCACTTGAAACTGACTCTTCCCCTCCACCATATAGTAGTATTACTGTGGAAGTACCT
ACAACTTCAGATACAGAAGTTTACGGTGAGTTTTATCCCGTGCCACCTCCCTATAGCGTTGCTACCTCTCTTCCTACATACGATGAAGCT
GAGAAGGCTAAAGCTGCTGCAATGGCAGCTGCAGCAGCAGAAACATCTCAAAGAATTCAGGAGGAAGAGTGTCCACCAAGAGATGACTTC
AGTGATGCAGACCAGCTCAGAGTGGGGAATGATGGCATTTTCATGCTGGCATTTTTCATGGCATTTATTTTCAACTGGCTTGGATTTTGT
TTATCCTTCTGTATCACCAATACCATAGCTGGAAGGTATGGTGCTATCTGCGGATTTGGCCTTTCCTTGATCAAATGGATCCTTATTGTC
AGGTTTTCTGATTATTTTACTGGATATTTCAATGGACAGTATTGGCTTTGGTGGATATTTCTTGTACTTGGCCTGCTCCTTTTCTTCAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_NBEA_ENST00000540320_chr13_35517251_+_NDFIP2_ENST00000218652_chr13_80094945_+_5080nt
AGGCAGGGGGCGGCAACATGGCGGAGTGAGCGGCGGCGTCGGGGCTTCACAACAACAGTGGTGGCCGTAGCAGCGGCGGCAGCAGCGTCA
ATAGCATCGGCCACAGCCTGAGCTTCAGCACCGGCCAGCGTCGTGGCCAGCTGCTCGCGTCCTCGGGCTTCTCGGAGCGGCTGCAGCATC
TCCGCGGGGGGCGGGCCGGGCCGGACAGACCGGGAGAGGGAGAGAGCAGAGGCAGCGGCGGCGGCAGCGGCAGCGGCAGCGGCACACCTG
CTGGGCGGGCACAGCCGCTTGCCCGGCAGCGGTTAGCGGTACCGCCACCGCCGAGAATAAGCCTGCGGATCCCCCGCCGCCTCCGCGGGG
GAGAGCGCCGGAGCGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGGCGCTGGTGGATGCTGGGGCTCCGAGGCGACGG
CCGGGGGGCGGGGGCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTCTTCCCTTCTCCTCAGGAGGGGGGCCAATGGCT
AGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGC
GGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATGATTAAC
CCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGACATCGTG
GAGACGGTGCTCAACCTGCTTCTTAATGAAGAGGATAACTCAGAATCATCGGCTATAGAGCAGCCACCTACTTCAAACCCAGCACCGCAG
ATTGTGCAGGCTGCGTCTTCAGCACCAGCACTTGAAACTGACTCTTCCCCTCCACCATATAGTAGTATTACTGTGGAAGTACCTACAACT
TCAGATACAGAAGTTTACGGTGAGTTTTATCCCGTGCCACCTCCCTATAGCGTTGCTACCTCTCTTCCTACATACGATGAAGCTGAGAAG
GCTAAAGCTGCTGCAATGGCAGCTGCAGCAGCAGAAACATCTCAAAGAATTCAGGAGGAAGAGTGTCCACCAAGAGATGACTTCAGTGAT
GCAGACCAGCTCAGAGTGGGGAATGATGGCATTTTCATGCTGGCATTTTTCATGGCATTTATTTTCAACTGGCTTGGATTTTGTTTATCC
TTCTGTATCACCAATACCATAGCTGGAAGGTATGGTGCTATCTGCGGATTTGGCCTTTCCTTGATCAAATGGATCCTTATTGTCAGGTTT
TCTGATTATTTTACTGGATATTTCAATGGACAGTATTGGCTTTGGTGGATATTTCTTGTACTTGGCCTGCTCCTTTTCTTCAGAGGATTT
GTTAATTATCTAAAAGTCAGAAACATGTCTGAAAGTATGGCAGCTGCTCATAGAACAAGGTATTTCTTCTTATTGTAGAGACTGCATCAA
CCCGACATTCCTTTCTTATACCAATGTGAAATTTCCAGATCATCTGTAAACCTACAACTTTAATAGAAGACTACTAATAACAGAAGACAA
ATTAGTGAAGAAAAGACGGAGTTTCGAAATTGAATGGCAGGGTGGTTTTTGCTTACAAGCCATTTCTGTTCATTCTTTAAGTATCTATAT
TTCATTTGTTTTGCACATATGCATATGTGCCCATTTAAGATATTTGCATATACTTGATAGAAACCATAAAGTTGTAGCAGTTAAGTCCAG
TCACATTTGGTTAATCAGTGTTTGATATAATTGAAAGAGTTGAGTGGATAAACAGTCTTCCAGCTTGTAAATGCCATTGACTTCTGACCT
GACATTTAGTATAATAAAAATGAAATTCTTAACCATGTCAAATGATTTAGTTTCTGGCTCTTAGACTCATCTGGCAGTTCTACACATGAA
ACATCTTTTGTTATATAAGGTGTATTGAAACCTGCAGTGCTGATTATTAGAAAGGATTTGTCAGATTTTTGAACATGATATTTACATTAT
TATTTAGGAAAACTCTTCCTGTAAATAACCATGCATAACTTACTTTCTGCAATGTTTTCTTAGAAATTGTGTCCAGATAGCTTTCACTAA
TTTTAAATTAAGTGAACTAAATATATATGTGTATATGTATACACATATATATACACACACACATATATATATTTAGAAACGTGAGTGTTA
AAGATAGAATTTGTTTTAGGACAAATTTTAAGAAAATGTGGGAATACCAAATGTCCTTTATAAGAAAAATAAATTTTATTTTAAGGGACA
TACTAGTTTTAGGGATTTTCAGATGGGAAGCTGCATTTTTAGGATTGCCCATCTTAAGAGATCTTGCAGGAAGAGATTGTATTAGATATT
ATATTTATTTCATTTAAGATAATTTTCAAAGTTAATTTTCTAAATAAGATAATTCTCATTTGTGTTTGTCTTTTAAAAGGCCAATAAAAT
ATCTTTCAGTATCATTGTAATAATTTTTTAGAGTTTAATTTGTAAAGCTTAGCAAATAAAATCTTGTACTATGAATAGCTTCTTGCTTTA
TGACTTTAGGATTAACTTGTAAAAAACATATCCTGAACTGAGATATGCAAAATACTCATTTTCAAGTTATGGAAATGTGTTTGTGGCATA
TAGGACTGTGGGGTCTGTGTGTGTAGTGAGAGTGTGTAGCCACTATTATAACTGGAATTTAATTTACATTCATAAACTACTATATTTCCC
ATCTTGCAAATCATTTTATGTCTCATCTGTTTTTCCTTTCGGTTATATCTTTGGTTTTGAATACCAACATTTAAAATGATGGTATTTTAT
CTTTTAAACTTAAAAATTATTTAATACAGCTATATGGACCTTATAAAATTGATTTCTTATTTATTATTAGACATTACTACTAAAAGGTAC
ATCTAACTATTCAGGGACATTTTTCCATTTCCAAAAAATAAAATTTATTATGCTTTATAACCTCTTCTGTATTTTCTAATTTTTTCATTG
TCTTTGATAAATAAAACAGTTTTGTTTTGCTAATATAGCCTATTTTTTGTTTTGTCTCATTCAGTTTACTTTCCTGCGTAGAATTTTTAT
TGTTATATTAAAATTTTTATTGTTGTATTAAAGTACCTGTGTTACACCCCTTGAAGTAAGACAGTAGCATGGGGTAAAGAAAAAATATTT
AGTTTAGTTGCCTAATTTGGAAGTTAATTAAAATTAAACTGTACTAATAACATATTCAAACTCATGCTGGATCTCTTTCATATTAATTTC
TTATAGACCTGTACTTTATTCTTTCAATAATTTTTAAATGAAATTAAGCTTTGCTACATGGTAATTAAATAATTACTAGGAAGCTTAGCT
ATCAAACATCGACTTACTAAAATTTCATTTTAGCTTTTATGGTATATGTGCTTGTTTTCTGAATATGGATACATGTTACTTTTGATCCAG
CATCAAAACTTCACTTTTTGTTTTGACTTTTCCCCCCAAATCTGTAAGGTTCAAGTATACATATTACTGAATCCTCTATAATTGGCATAA
TTCAATGGTAGCCTTAAATCTCATCATGTAAGCAGGGGAATCAGAATGTTATTTTCAAGAACTTAATGTTCCCTTCAGATATATAAAATC
CTGCATACTTCATTTCCTGTGAGCTTGAACAGCTGCTGTTGTGTTTTGGGGATGCTTGATCATCTTTGCACTCTGCCTTAAAGATTGAAA
AATCAAAACTCTTGTTAGGGTATCTAAACATTTTTGAGTGTGAACTGGGGATTGGAAGTTAATACAAAAAAATTTCAAATTATTTCTATT
GTAAATGAATAAGCTAGTCATGGCTAGGATAATCCATTTTCATGTATTTATGCAATAAACTGAATTTTAAGGCAAAAACAACACTTTTCT
ATATAGTGTATGCAGGACAGATTTTAGAAACTTAGATTAAAATACAAATCCCATTACATTTGGTTAAAATGAAAATCTCTGCTTAATGGA
AAAAATACTAATCTTTAGCCTATTTTGAGTCTATAAGATATATTTCATTTTAGACATGCCTTCTAAGTTGTTCACAGATTTTTACCTGCT
AAAACAATATTATTTCCAGTAAAACCTCTCCTAACAGGAAAAGTGGAGTTCAAAATATCCAATTGGAGAAAAATTCAGAGTTCCTTCATT
AAATATAATTTTTTTCATCTAGTATGTACTATTTCAAGAAGTGCAAAAAGTAATGATAGTGAATGTGATACCATACTTAACTAAGGTAAT
ATATATCCTTAGTTTGCTCAAAAGAGTCCTGGTTATTCCTGTTTTCTCAGCTTAATAGTGCCTCATCGTACTCTCAAAAGTGTTCTAATT
TGGAGGATAAGTTATATGATCATCCTGTGTATAATTGTAGACTGTACCAAGAAGCAACTACCTTAGCTCCACTGCCCTTTGAGGGATGGA
ACTGGGGTAAGGGCAGGAGCCAGTTATTATTGCCACAGTGTTTTCTAATGAACCATTTGGCCTGTAGAAGAGGAATAGTATTTTTTTTAA
TAGTTGTATTTGAATGATTCCAGCTTATCGTAAATACTAAACTGAATGGCTTTTATATTTTTAACTGCTGTTAAATGTTATTTTAGCATT
TATTAGTTGTTTATTATTTAATTCTTCAAATAGTCATATGAAAACATATATTTGATAAAGGTCAATTGTTAGATGATAATGTGCCATTCA
TTATCATAGGAATGTCCTTGCCCATATATAAAACATGCTGGCATGTATTTTACTTGTTAATAAAGTTGTATAGATGTGGAAGTGTGAACC
TGTGATGCATCCTTTTCAAAATCAGTTTAAGATTCGCATATTATCATGACTGTGACCTCACTAAACTGTTTATGTGACAAACCTTTCAAG
ATTGGAGATGAAAACAACACTTGTGAAATTAGGTTGGGGTTGCAACATCTTTTAACTTCTCAGTTATTTGTATGTCAGGAGACAGATTGT

>In-frame_NBEA_ENST00000400445_chr13_35517251_+_NDFIP2_ENST00000218652_chr13_80094945_+_5080nt
AGGCAGGGGGCGGCAACATGGCGGAGTGAGCGGCGGCGTCGGGGCTTCACAACAACAGTGGTGGCCGTAGCAGCGGCGGCAGCAGCGTCA
ATAGCATCGGCCACAGCCTGAGCTTCAGCACCGGCCAGCGTCGTGGCCAGCTGCTCGCGTCCTCGGGCTTCTCGGAGCGGCTGCAGCATC
TCCGCGGGGGGCGGGCCGGGCCGGACAGACCGGGAGAGGGAGAGAGCAGAGGCAGCGGCGGCGGCAGCGGCAGCGGCAGCGGCACACCTG
CTGGGCGGGCACAGCCGCTTGCCCGGCAGCGGTTAGCGGTACCGCCACCGCCGAGAATAAGCCTGCGGATCCCCCGCCGCCTCCGCGGGG
GAGAGCGCCGGAGCGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGGCGCTGGTGGATGCTGGGGCTCCGAGGCGACGG
CCGGGGGGCGGGGGCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTCTTCCCTTCTCCTCAGGAGGGGGGCCAATGGCT
AGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGC
GGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATGATTAAC
CCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGACATCGTG
GAGACGGTGCTCAACCTGCTTCTTAATGAAGAGGATAACTCAGAATCATCGGCTATAGAGCAGCCACCTACTTCAAACCCAGCACCGCAG
ATTGTGCAGGCTGCGTCTTCAGCACCAGCACTTGAAACTGACTCTTCCCCTCCACCATATAGTAGTATTACTGTGGAAGTACCTACAACT
TCAGATACAGAAGTTTACGGTGAGTTTTATCCCGTGCCACCTCCCTATAGCGTTGCTACCTCTCTTCCTACATACGATGAAGCTGAGAAG
GCTAAAGCTGCTGCAATGGCAGCTGCAGCAGCAGAAACATCTCAAAGAATTCAGGAGGAAGAGTGTCCACCAAGAGATGACTTCAGTGAT
GCAGACCAGCTCAGAGTGGGGAATGATGGCATTTTCATGCTGGCATTTTTCATGGCATTTATTTTCAACTGGCTTGGATTTTGTTTATCC
TTCTGTATCACCAATACCATAGCTGGAAGGTATGGTGCTATCTGCGGATTTGGCCTTTCCTTGATCAAATGGATCCTTATTGTCAGGTTT
TCTGATTATTTTACTGGATATTTCAATGGACAGTATTGGCTTTGGTGGATATTTCTTGTACTTGGCCTGCTCCTTTTCTTCAGAGGATTT
GTTAATTATCTAAAAGTCAGAAACATGTCTGAAAGTATGGCAGCTGCTCATAGAACAAGGTATTTCTTCTTATTGTAGAGACTGCATCAA
CCCGACATTCCTTTCTTATACCAATGTGAAATTTCCAGATCATCTGTAAACCTACAACTTTAATAGAAGACTACTAATAACAGAAGACAA
ATTAGTGAAGAAAAGACGGAGTTTCGAAATTGAATGGCAGGGTGGTTTTTGCTTACAAGCCATTTCTGTTCATTCTTTAAGTATCTATAT
TTCATTTGTTTTGCACATATGCATATGTGCCCATTTAAGATATTTGCATATACTTGATAGAAACCATAAAGTTGTAGCAGTTAAGTCCAG
TCACATTTGGTTAATCAGTGTTTGATATAATTGAAAGAGTTGAGTGGATAAACAGTCTTCCAGCTTGTAAATGCCATTGACTTCTGACCT
GACATTTAGTATAATAAAAATGAAATTCTTAACCATGTCAAATGATTTAGTTTCTGGCTCTTAGACTCATCTGGCAGTTCTACACATGAA
ACATCTTTTGTTATATAAGGTGTATTGAAACCTGCAGTGCTGATTATTAGAAAGGATTTGTCAGATTTTTGAACATGATATTTACATTAT
TATTTAGGAAAACTCTTCCTGTAAATAACCATGCATAACTTACTTTCTGCAATGTTTTCTTAGAAATTGTGTCCAGATAGCTTTCACTAA
TTTTAAATTAAGTGAACTAAATATATATGTGTATATGTATACACATATATATACACACACACATATATATATTTAGAAACGTGAGTGTTA
AAGATAGAATTTGTTTTAGGACAAATTTTAAGAAAATGTGGGAATACCAAATGTCCTTTATAAGAAAAATAAATTTTATTTTAAGGGACA
TACTAGTTTTAGGGATTTTCAGATGGGAAGCTGCATTTTTAGGATTGCCCATCTTAAGAGATCTTGCAGGAAGAGATTGTATTAGATATT
ATATTTATTTCATTTAAGATAATTTTCAAAGTTAATTTTCTAAATAAGATAATTCTCATTTGTGTTTGTCTTTTAAAAGGCCAATAAAAT
ATCTTTCAGTATCATTGTAATAATTTTTTAGAGTTTAATTTGTAAAGCTTAGCAAATAAAATCTTGTACTATGAATAGCTTCTTGCTTTA
TGACTTTAGGATTAACTTGTAAAAAACATATCCTGAACTGAGATATGCAAAATACTCATTTTCAAGTTATGGAAATGTGTTTGTGGCATA
TAGGACTGTGGGGTCTGTGTGTGTAGTGAGAGTGTGTAGCCACTATTATAACTGGAATTTAATTTACATTCATAAACTACTATATTTCCC
ATCTTGCAAATCATTTTATGTCTCATCTGTTTTTCCTTTCGGTTATATCTTTGGTTTTGAATACCAACATTTAAAATGATGGTATTTTAT
CTTTTAAACTTAAAAATTATTTAATACAGCTATATGGACCTTATAAAATTGATTTCTTATTTATTATTAGACATTACTACTAAAAGGTAC
ATCTAACTATTCAGGGACATTTTTCCATTTCCAAAAAATAAAATTTATTATGCTTTATAACCTCTTCTGTATTTTCTAATTTTTTCATTG
TCTTTGATAAATAAAACAGTTTTGTTTTGCTAATATAGCCTATTTTTTGTTTTGTCTCATTCAGTTTACTTTCCTGCGTAGAATTTTTAT
TGTTATATTAAAATTTTTATTGTTGTATTAAAGTACCTGTGTTACACCCCTTGAAGTAAGACAGTAGCATGGGGTAAAGAAAAAATATTT
AGTTTAGTTGCCTAATTTGGAAGTTAATTAAAATTAAACTGTACTAATAACATATTCAAACTCATGCTGGATCTCTTTCATATTAATTTC
TTATAGACCTGTACTTTATTCTTTCAATAATTTTTAAATGAAATTAAGCTTTGCTACATGGTAATTAAATAATTACTAGGAAGCTTAGCT
ATCAAACATCGACTTACTAAAATTTCATTTTAGCTTTTATGGTATATGTGCTTGTTTTCTGAATATGGATACATGTTACTTTTGATCCAG
CATCAAAACTTCACTTTTTGTTTTGACTTTTCCCCCCAAATCTGTAAGGTTCAAGTATACATATTACTGAATCCTCTATAATTGGCATAA
TTCAATGGTAGCCTTAAATCTCATCATGTAAGCAGGGGAATCAGAATGTTATTTTCAAGAACTTAATGTTCCCTTCAGATATATAAAATC
CTGCATACTTCATTTCCTGTGAGCTTGAACAGCTGCTGTTGTGTTTTGGGGATGCTTGATCATCTTTGCACTCTGCCTTAAAGATTGAAA
AATCAAAACTCTTGTTAGGGTATCTAAACATTTTTGAGTGTGAACTGGGGATTGGAAGTTAATACAAAAAAATTTCAAATTATTTCTATT
GTAAATGAATAAGCTAGTCATGGCTAGGATAATCCATTTTCATGTATTTATGCAATAAACTGAATTTTAAGGCAAAAACAACACTTTTCT
ATATAGTGTATGCAGGACAGATTTTAGAAACTTAGATTAAAATACAAATCCCATTACATTTGGTTAAAATGAAAATCTCTGCTTAATGGA
AAAAATACTAATCTTTAGCCTATTTTGAGTCTATAAGATATATTTCATTTTAGACATGCCTTCTAAGTTGTTCACAGATTTTTACCTGCT
AAAACAATATTATTTCCAGTAAAACCTCTCCTAACAGGAAAAGTGGAGTTCAAAATATCCAATTGGAGAAAAATTCAGAGTTCCTTCATT
AAATATAATTTTTTTCATCTAGTATGTACTATTTCAAGAAGTGCAAAAAGTAATGATAGTGAATGTGATACCATACTTAACTAAGGTAAT
ATATATCCTTAGTTTGCTCAAAAGAGTCCTGGTTATTCCTGTTTTCTCAGCTTAATAGTGCCTCATCGTACTCTCAAAAGTGTTCTAATT
TGGAGGATAAGTTATATGATCATCCTGTGTATAATTGTAGACTGTACCAAGAAGCAACTACCTTAGCTCCACTGCCCTTTGAGGGATGGA
ACTGGGGTAAGGGCAGGAGCCAGTTATTATTGCCACAGTGTTTTCTAATGAACCATTTGGCCTGTAGAAGAGGAATAGTATTTTTTTTAA
TAGTTGTATTTGAATGATTCCAGCTTATCGTAAATACTAAACTGAATGGCTTTTATATTTTTAACTGCTGTTAAATGTTATTTTAGCATT
TATTAGTTGTTTATTATTTAATTCTTCAAATAGTCATATGAAAACATATATTTGATAAAGGTCAATTGTTAGATGATAATGTGCCATTCA
TTATCATAGGAATGTCCTTGCCCATATATAAAACATGCTGGCATGTATTTTACTTGTTAATAAAGTTGTATAGATGTGGAAGTGTGAACC
TGTGATGCATCCTTTTCAAAATCAGTTTAAGATTCGCATATTATCATGACTGTGACCTCACTAAACTGTTTATGTGACAAACCTTTCAAG
ATTGGAGATGAAAACAACACTTGTGAAATTAGGTTGGGGTTGCAACATCTTTTAACTTCTCAGTTATTTGTATGTCAGGAGACAGATTGT

>In-frame_NBEA_ENST00000310336_chr13_35517251_+_NDFIP2_ENST00000218652_chr13_80094945_+_4752nt
GCGGCGTCGGGGCTTCACAACAACAGTGGTGGCCGTAGCAGCGGCCGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGG
CGCTGGTGGATGCTGGGGCTCCGAGGCGACGGCCGGGGGGCGGGGGCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTC
TTCCCTTCTCCTCAGGAGGGGGGCCAATGGCTAGCGAGAAGCCGGGCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCG
TCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGCGGTGGTGGCGGCACCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCG
GCTCGGTGATGCTCCCCGCGGGGATGATTAACCCTTCGGTGCCGATCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATAC
AGGTCGGAGAGGTCAGCAACAGGGACATCGTGGAGACGGTGCTCAACCTGCTTCTTAATGAAGAGGATAACTCAGAATCATCGGCTATAG
AGCAGCCACCTACTTCAAACCCAGCACCGCAGATTGTGCAGGCTGCGTCTTCAGCACCAGCACTTGAAACTGACTCTTCCCCTCCACCAT
ATAGTAGTATTACTGTGGAAGTACCTACAACTTCAGATACAGAAGTTTACGGTGAGTTTTATCCCGTGCCACCTCCCTATAGCGTTGCTA
CCTCTCTTCCTACATACGATGAAGCTGAGAAGGCTAAAGCTGCTGCAATGGCAGCTGCAGCAGCAGAAACATCTCAAAGAATTCAGGAGG
AAGAGTGTCCACCAAGAGATGACTTCAGTGATGCAGACCAGCTCAGAGTGGGGAATGATGGCATTTTCATGCTGGCATTTTTCATGGCAT
TTATTTTCAACTGGCTTGGATTTTGTTTATCCTTCTGTATCACCAATACCATAGCTGGAAGGTATGGTGCTATCTGCGGATTTGGCCTTT
CCTTGATCAAATGGATCCTTATTGTCAGGTTTTCTGATTATTTTACTGGATATTTCAATGGACAGTATTGGCTTTGGTGGATATTTCTTG
TACTTGGCCTGCTCCTTTTCTTCAGAGGATTTGTTAATTATCTAAAAGTCAGAAACATGTCTGAAAGTATGGCAGCTGCTCATAGAACAA
GGTATTTCTTCTTATTGTAGAGACTGCATCAACCCGACATTCCTTTCTTATACCAATGTGAAATTTCCAGATCATCTGTAAACCTACAAC
TTTAATAGAAGACTACTAATAACAGAAGACAAATTAGTGAAGAAAAGACGGAGTTTCGAAATTGAATGGCAGGGTGGTTTTTGCTTACAA
GCCATTTCTGTTCATTCTTTAAGTATCTATATTTCATTTGTTTTGCACATATGCATATGTGCCCATTTAAGATATTTGCATATACTTGAT
AGAAACCATAAAGTTGTAGCAGTTAAGTCCAGTCACATTTGGTTAATCAGTGTTTGATATAATTGAAAGAGTTGAGTGGATAAACAGTCT
TCCAGCTTGTAAATGCCATTGACTTCTGACCTGACATTTAGTATAATAAAAATGAAATTCTTAACCATGTCAAATGATTTAGTTTCTGGC
TCTTAGACTCATCTGGCAGTTCTACACATGAAACATCTTTTGTTATATAAGGTGTATTGAAACCTGCAGTGCTGATTATTAGAAAGGATT
TGTCAGATTTTTGAACATGATATTTACATTATTATTTAGGAAAACTCTTCCTGTAAATAACCATGCATAACTTACTTTCTGCAATGTTTT
CTTAGAAATTGTGTCCAGATAGCTTTCACTAATTTTAAATTAAGTGAACTAAATATATATGTGTATATGTATACACATATATATACACAC
ACACATATATATATTTAGAAACGTGAGTGTTAAAGATAGAATTTGTTTTAGGACAAATTTTAAGAAAATGTGGGAATACCAAATGTCCTT
TATAAGAAAAATAAATTTTATTTTAAGGGACATACTAGTTTTAGGGATTTTCAGATGGGAAGCTGCATTTTTAGGATTGCCCATCTTAAG
AGATCTTGCAGGAAGAGATTGTATTAGATATTATATTTATTTCATTTAAGATAATTTTCAAAGTTAATTTTCTAAATAAGATAATTCTCA
TTTGTGTTTGTCTTTTAAAAGGCCAATAAAATATCTTTCAGTATCATTGTAATAATTTTTTAGAGTTTAATTTGTAAAGCTTAGCAAATA
AAATCTTGTACTATGAATAGCTTCTTGCTTTATGACTTTAGGATTAACTTGTAAAAAACATATCCTGAACTGAGATATGCAAAATACTCA
TTTTCAAGTTATGGAAATGTGTTTGTGGCATATAGGACTGTGGGGTCTGTGTGTGTAGTGAGAGTGTGTAGCCACTATTATAACTGGAAT
TTAATTTACATTCATAAACTACTATATTTCCCATCTTGCAAATCATTTTATGTCTCATCTGTTTTTCCTTTCGGTTATATCTTTGGTTTT
GAATACCAACATTTAAAATGATGGTATTTTATCTTTTAAACTTAAAAATTATTTAATACAGCTATATGGACCTTATAAAATTGATTTCTT
ATTTATTATTAGACATTACTACTAAAAGGTACATCTAACTATTCAGGGACATTTTTCCATTTCCAAAAAATAAAATTTATTATGCTTTAT
AACCTCTTCTGTATTTTCTAATTTTTTCATTGTCTTTGATAAATAAAACAGTTTTGTTTTGCTAATATAGCCTATTTTTTGTTTTGTCTC
ATTCAGTTTACTTTCCTGCGTAGAATTTTTATTGTTATATTAAAATTTTTATTGTTGTATTAAAGTACCTGTGTTACACCCCTTGAAGTA
AGACAGTAGCATGGGGTAAAGAAAAAATATTTAGTTTAGTTGCCTAATTTGGAAGTTAATTAAAATTAAACTGTACTAATAACATATTCA
AACTCATGCTGGATCTCTTTCATATTAATTTCTTATAGACCTGTACTTTATTCTTTCAATAATTTTTAAATGAAATTAAGCTTTGCTACA
TGGTAATTAAATAATTACTAGGAAGCTTAGCTATCAAACATCGACTTACTAAAATTTCATTTTAGCTTTTATGGTATATGTGCTTGTTTT
CTGAATATGGATACATGTTACTTTTGATCCAGCATCAAAACTTCACTTTTTGTTTTGACTTTTCCCCCCAAATCTGTAAGGTTCAAGTAT
ACATATTACTGAATCCTCTATAATTGGCATAATTCAATGGTAGCCTTAAATCTCATCATGTAAGCAGGGGAATCAGAATGTTATTTTCAA
GAACTTAATGTTCCCTTCAGATATATAAAATCCTGCATACTTCATTTCCTGTGAGCTTGAACAGCTGCTGTTGTGTTTTGGGGATGCTTG
ATCATCTTTGCACTCTGCCTTAAAGATTGAAAAATCAAAACTCTTGTTAGGGTATCTAAACATTTTTGAGTGTGAACTGGGGATTGGAAG
TTAATACAAAAAAATTTCAAATTATTTCTATTGTAAATGAATAAGCTAGTCATGGCTAGGATAATCCATTTTCATGTATTTATGCAATAA
ACTGAATTTTAAGGCAAAAACAACACTTTTCTATATAGTGTATGCAGGACAGATTTTAGAAACTTAGATTAAAATACAAATCCCATTACA
TTTGGTTAAAATGAAAATCTCTGCTTAATGGAAAAAATACTAATCTTTAGCCTATTTTGAGTCTATAAGATATATTTCATTTTAGACATG
CCTTCTAAGTTGTTCACAGATTTTTACCTGCTAAAACAATATTATTTCCAGTAAAACCTCTCCTAACAGGAAAAGTGGAGTTCAAAATAT
CCAATTGGAGAAAAATTCAGAGTTCCTTCATTAAATATAATTTTTTTCATCTAGTATGTACTATTTCAAGAAGTGCAAAAAGTAATGATA
GTGAATGTGATACCATACTTAACTAAGGTAATATATATCCTTAGTTTGCTCAAAAGAGTCCTGGTTATTCCTGTTTTCTCAGCTTAATAG
TGCCTCATCGTACTCTCAAAAGTGTTCTAATTTGGAGGATAAGTTATATGATCATCCTGTGTATAATTGTAGACTGTACCAAGAAGCAAC
TACCTTAGCTCCACTGCCCTTTGAGGGATGGAACTGGGGTAAGGGCAGGAGCCAGTTATTATTGCCACAGTGTTTTCTAATGAACCATTT
GGCCTGTAGAAGAGGAATAGTATTTTTTTTAATAGTTGTATTTGAATGATTCCAGCTTATCGTAAATACTAAACTGAATGGCTTTTATAT
TTTTAACTGCTGTTAAATGTTATTTTAGCATTTATTAGTTGTTTATTATTTAATTCTTCAAATAGTCATATGAAAACATATATTTGATAA
AGGTCAATTGTTAGATGATAATGTGCCATTCATTATCATAGGAATGTCCTTGCCCATATATAAAACATGCTGGCATGTATTTTACTTGTT
AATAAAGTTGTATAGATGTGGAAGTGTGAACCTGTGATGCATCCTTTTCAAAATCAGTTTAAGATTCGCATATTATCATGACTGTGACCT
CACTAAACTGTTTATGTGACAAACCTTTCAAGATTGGAGATGAAAACAACACTTGTGAAATTAGGTTGGGGTTGCAACATCTTTTAACTT

>In-frame_NBEA_ENST00000379939_chr13_35517251_+_NDFIP2_ENST00000218652_chr13_80094945_+_4707nt
CGGGCCGGGCTGAGGCGCAGGCGGGGAGCGGGCCCGGCGCCGCGGCGCTGGTGGATGCTGGGGCTCCGAGGCGACGGCCGGGGGGCGGGG
GCCGAGGCAGGTATAACGGTACCGGCGGCGGCAGCGCCGCTGCTCTTCCCTTCTCCTCAGGAGGGGGGCCAATGGCTAGCGAGAAGCCGG
GCCCGGGCCCGGGGCTCGAGCCTCAGCCCGTGGGGCTCATTGCCGTCGGGGCCGCTGGCGGAGGCGGCGGGGGCAGCGGTGGTGGCGGCA
CCGGGGGCAGCGGGATGGGGGAGCTAAGGGGGGCGTCCGGCTCCGGCTCGGTGATGCTCCCCGCGGGGATGATTAACCCTTCGGTGCCGA
TCCGCAACATCCGGATGAAATTCGCAGTGTTGATTGGACTCATACAGGTCGGAGAGGTCAGCAACAGGGACATCGTGGAGACGGTGCTCA
ACCTGCTTCTTAATGAAGAGGATAACTCAGAATCATCGGCTATAGAGCAGCCACCTACTTCAAACCCAGCACCGCAGATTGTGCAGGCTG
CGTCTTCAGCACCAGCACTTGAAACTGACTCTTCCCCTCCACCATATAGTAGTATTACTGTGGAAGTACCTACAACTTCAGATACAGAAG
TTTACGGTGAGTTTTATCCCGTGCCACCTCCCTATAGCGTTGCTACCTCTCTTCCTACATACGATGAAGCTGAGAAGGCTAAAGCTGCTG
CAATGGCAGCTGCAGCAGCAGAAACATCTCAAAGAATTCAGGAGGAAGAGTGTCCACCAAGAGATGACTTCAGTGATGCAGACCAGCTCA
GAGTGGGGAATGATGGCATTTTCATGCTGGCATTTTTCATGGCATTTATTTTCAACTGGCTTGGATTTTGTTTATCCTTCTGTATCACCA
ATACCATAGCTGGAAGGTATGGTGCTATCTGCGGATTTGGCCTTTCCTTGATCAAATGGATCCTTATTGTCAGGTTTTCTGATTATTTTA
CTGGATATTTCAATGGACAGTATTGGCTTTGGTGGATATTTCTTGTACTTGGCCTGCTCCTTTTCTTCAGAGGATTTGTTAATTATCTAA
AAGTCAGAAACATGTCTGAAAGTATGGCAGCTGCTCATAGAACAAGGTATTTCTTCTTATTGTAGAGACTGCATCAACCCGACATTCCTT
TCTTATACCAATGTGAAATTTCCAGATCATCTGTAAACCTACAACTTTAATAGAAGACTACTAATAACAGAAGACAAATTAGTGAAGAAA
AGACGGAGTTTCGAAATTGAATGGCAGGGTGGTTTTTGCTTACAAGCCATTTCTGTTCATTCTTTAAGTATCTATATTTCATTTGTTTTG
CACATATGCATATGTGCCCATTTAAGATATTTGCATATACTTGATAGAAACCATAAAGTTGTAGCAGTTAAGTCCAGTCACATTTGGTTA
ATCAGTGTTTGATATAATTGAAAGAGTTGAGTGGATAAACAGTCTTCCAGCTTGTAAATGCCATTGACTTCTGACCTGACATTTAGTATA
ATAAAAATGAAATTCTTAACCATGTCAAATGATTTAGTTTCTGGCTCTTAGACTCATCTGGCAGTTCTACACATGAAACATCTTTTGTTA
TATAAGGTGTATTGAAACCTGCAGTGCTGATTATTAGAAAGGATTTGTCAGATTTTTGAACATGATATTTACATTATTATTTAGGAAAAC
TCTTCCTGTAAATAACCATGCATAACTTACTTTCTGCAATGTTTTCTTAGAAATTGTGTCCAGATAGCTTTCACTAATTTTAAATTAAGT
GAACTAAATATATATGTGTATATGTATACACATATATATACACACACACATATATATATTTAGAAACGTGAGTGTTAAAGATAGAATTTG
TTTTAGGACAAATTTTAAGAAAATGTGGGAATACCAAATGTCCTTTATAAGAAAAATAAATTTTATTTTAAGGGACATACTAGTTTTAGG
GATTTTCAGATGGGAAGCTGCATTTTTAGGATTGCCCATCTTAAGAGATCTTGCAGGAAGAGATTGTATTAGATATTATATTTATTTCAT
TTAAGATAATTTTCAAAGTTAATTTTCTAAATAAGATAATTCTCATTTGTGTTTGTCTTTTAAAAGGCCAATAAAATATCTTTCAGTATC
ATTGTAATAATTTTTTAGAGTTTAATTTGTAAAGCTTAGCAAATAAAATCTTGTACTATGAATAGCTTCTTGCTTTATGACTTTAGGATT
AACTTGTAAAAAACATATCCTGAACTGAGATATGCAAAATACTCATTTTCAAGTTATGGAAATGTGTTTGTGGCATATAGGACTGTGGGG
TCTGTGTGTGTAGTGAGAGTGTGTAGCCACTATTATAACTGGAATTTAATTTACATTCATAAACTACTATATTTCCCATCTTGCAAATCA
TTTTATGTCTCATCTGTTTTTCCTTTCGGTTATATCTTTGGTTTTGAATACCAACATTTAAAATGATGGTATTTTATCTTTTAAACTTAA
AAATTATTTAATACAGCTATATGGACCTTATAAAATTGATTTCTTATTTATTATTAGACATTACTACTAAAAGGTACATCTAACTATTCA
GGGACATTTTTCCATTTCCAAAAAATAAAATTTATTATGCTTTATAACCTCTTCTGTATTTTCTAATTTTTTCATTGTCTTTGATAAATA
AAACAGTTTTGTTTTGCTAATATAGCCTATTTTTTGTTTTGTCTCATTCAGTTTACTTTCCTGCGTAGAATTTTTATTGTTATATTAAAA
TTTTTATTGTTGTATTAAAGTACCTGTGTTACACCCCTTGAAGTAAGACAGTAGCATGGGGTAAAGAAAAAATATTTAGTTTAGTTGCCT
AATTTGGAAGTTAATTAAAATTAAACTGTACTAATAACATATTCAAACTCATGCTGGATCTCTTTCATATTAATTTCTTATAGACCTGTA
CTTTATTCTTTCAATAATTTTTAAATGAAATTAAGCTTTGCTACATGGTAATTAAATAATTACTAGGAAGCTTAGCTATCAAACATCGAC
TTACTAAAATTTCATTTTAGCTTTTATGGTATATGTGCTTGTTTTCTGAATATGGATACATGTTACTTTTGATCCAGCATCAAAACTTCA
CTTTTTGTTTTGACTTTTCCCCCCAAATCTGTAAGGTTCAAGTATACATATTACTGAATCCTCTATAATTGGCATAATTCAATGGTAGCC
TTAAATCTCATCATGTAAGCAGGGGAATCAGAATGTTATTTTCAAGAACTTAATGTTCCCTTCAGATATATAAAATCCTGCATACTTCAT
TTCCTGTGAGCTTGAACAGCTGCTGTTGTGTTTTGGGGATGCTTGATCATCTTTGCACTCTGCCTTAAAGATTGAAAAATCAAAACTCTT
GTTAGGGTATCTAAACATTTTTGAGTGTGAACTGGGGATTGGAAGTTAATACAAAAAAATTTCAAATTATTTCTATTGTAAATGAATAAG
CTAGTCATGGCTAGGATAATCCATTTTCATGTATTTATGCAATAAACTGAATTTTAAGGCAAAAACAACACTTTTCTATATAGTGTATGC
AGGACAGATTTTAGAAACTTAGATTAAAATACAAATCCCATTACATTTGGTTAAAATGAAAATCTCTGCTTAATGGAAAAAATACTAATC
TTTAGCCTATTTTGAGTCTATAAGATATATTTCATTTTAGACATGCCTTCTAAGTTGTTCACAGATTTTTACCTGCTAAAACAATATTAT
TTCCAGTAAAACCTCTCCTAACAGGAAAAGTGGAGTTCAAAATATCCAATTGGAGAAAAATTCAGAGTTCCTTCATTAAATATAATTTTT
TTCATCTAGTATGTACTATTTCAAGAAGTGCAAAAAGTAATGATAGTGAATGTGATACCATACTTAACTAAGGTAATATATATCCTTAGT
TTGCTCAAAAGAGTCCTGGTTATTCCTGTTTTCTCAGCTTAATAGTGCCTCATCGTACTCTCAAAAGTGTTCTAATTTGGAGGATAAGTT
ATATGATCATCCTGTGTATAATTGTAGACTGTACCAAGAAGCAACTACCTTAGCTCCACTGCCCTTTGAGGGATGGAACTGGGGTAAGGG
CAGGAGCCAGTTATTATTGCCACAGTGTTTTCTAATGAACCATTTGGCCTGTAGAAGAGGAATAGTATTTTTTTTAATAGTTGTATTTGA
ATGATTCCAGCTTATCGTAAATACTAAACTGAATGGCTTTTATATTTTTAACTGCTGTTAAATGTTATTTTAGCATTTATTAGTTGTTTA
TTATTTAATTCTTCAAATAGTCATATGAAAACATATATTTGATAAAGGTCAATTGTTAGATGATAATGTGCCATTCATTATCATAGGAAT
GTCCTTGCCCATATATAAAACATGCTGGCATGTATTTTACTTGTTAATAAAGTTGTATAGATGTGGAAGTGTGAACCTGTGATGCATCCT
TTTCAAAATCAGTTTAAGATTCGCATATTATCATGACTGTGACCTCACTAAACTGTTTATGTGACAAACCTTTCAAGATTGGAGATGAAA
ACAACACTTGTGAAATTAGGTTGGGGTTGCAACATCTTTTAACTTCTCAGTTATTTGTATGTCAGGAGACAGATTGTGGTTTAATTTTAA


Top

FusionGenePPI for NBEA_NDFIP2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NBEASTRN4, DTNBP1, NOTCH1, VCP, FOSL2, RD3, TMEM17, PTPRH, ALOXE3, SHC4, RBM48, MRPL21, NAB2, STRADBNDFIP2NEDD4, SLC11A2, PTEN, EGFR, LYN, FYN, SRC, ITCH, WWP2, NEDD4L, ELAVL1, TSPAN3, IL20RB, TMEM231, PTGFR, IL2RG, FAM8A1, SDHA, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NBEA_NDFIP2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NBEA_NDFIP2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNBEAC0004352Autistic Disorder2CTD_human
HgeneNBEAC0023893Liver Cirrhosis, Experimental1CTD_human