FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23433

FusionGeneSummary for NARS2_RSF1

check button Fusion gene summary
Fusion gene informationFusion gene name: NARS2_RSF1
Fusion gene ID: 23433
HgeneTgene
Gene symbol

NARS2

RSF1

Gene ID

79731

51773

Gene nameasparaginyl-tRNA synthetase 2, mitochondrialremodeling and spacing factor 1
SynonymsDFNB94|SLM5|asnRSHBXAP|RSF-1|XAP8|p325
Cytomap

11q14.1

11q14.1

Type of geneprotein-codingprotein-coding
Descriptionprobable asparagine--tRNA ligase, mitochondrialasparagine tRNA ligase 2, mitochondrial (putative)asparaginyl-tRNA synthetase 2, mitochondrial (putative)deafness, autosomal recessive 94probable asparaginyl-tRNA synthetase, mitochondrialremodeling and spacing factor 1HBV pX-associated protein 8hepatitis B virus x-associated proteinp325 subunit of RSF chromatin-remodeling complex
Modification date2018051920180523
UniProtAcc

Q96I59

Q96T23

Ensembl transtripts involved in fusion geneENST00000281038, ENST00000528850, 
ENST00000308488, ENST00000360355, 
ENST00000480887, ENST00000530604, 
Fusion gene scores* DoF score12 X 8 X 5=48010 X 8 X 7=560
# samples 1311
** MAII scorelog2(13/480*10)=-1.88452278258006
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/560*10)=-2.34792330342031
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NARS2 [Title/Abstract] AND RSF1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneRSF1

GO:0006334

nucleosome assembly

12972596

TgeneRSF1

GO:0006338

chromatin remodeling

9836642

TgeneRSF1

GO:0006352

DNA-templated transcription, initiation

9836642

TgeneRSF1

GO:0016584

nucleosome positioning

9836642

TgeneRSF1

GO:0043392

negative regulation of DNA binding

12972596

TgeneRSF1

GO:0045892

negative regulation of transcription, DNA-templated

11944984

TgeneRSF1

GO:0045893

positive regulation of transcription, DNA-templated

11788598

TgeneRSF1

GO:0050434

positive regulation of viral transcription

11788598


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-QQ-A5VC-01ANARS2chr11

78239888

-RSF1chr11

77378536

-
ChiTaRS3.1BF947498NARS2chr11

78240831

+RSF1chr11

77416392

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000281038ENST00000308488NARS2chr11

78239888

-RSF1chr11

77378536

-
In-frameENST00000281038ENST00000360355NARS2chr11

78239888

-RSF1chr11

77378536

-
Frame-shitENST00000281038ENST00000480887NARS2chr11

78239888

-RSF1chr11

77378536

-
5CDS-intronENST00000281038ENST00000530604NARS2chr11

78239888

-RSF1chr11

77378536

-
In-frameENST00000528850ENST00000308488NARS2chr11

78239888

-RSF1chr11

77378536

-
In-frameENST00000528850ENST00000360355NARS2chr11

78239888

-RSF1chr11

77378536

-
Frame-shitENST00000528850ENST00000480887NARS2chr11

78239888

-RSF1chr11

77378536

-
5CDS-intronENST00000528850ENST00000530604NARS2chr11

78239888

-RSF1chr11

77378536

-
intron-intronENST00000281038ENST00000308488NARS2chr11

78240831

+RSF1chr11

77416392

-
intron-intronENST00000281038ENST00000360355NARS2chr11

78240831

+RSF1chr11

77416392

-
intron-intronENST00000281038ENST00000480887NARS2chr11

78240831

+RSF1chr11

77416392

-
intron-intronENST00000281038ENST00000530604NARS2chr11

78240831

+RSF1chr11

77416392

-
intron-intronENST00000528850ENST00000308488NARS2chr11

78240831

+RSF1chr11

77416392

-
intron-intronENST00000528850ENST00000360355NARS2chr11

78240831

+RSF1chr11

77416392

-
intron-intronENST00000528850ENST00000480887NARS2chr11

78240831

+RSF1chr11

77416392

-
intron-intronENST00000528850ENST00000530604NARS2chr11

78240831

+RSF1chr11

77416392

-

Top

FusionProtFeatures for NARS2_RSF1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NARS2

Q96I59

RSF1

Q96T23

Required for assembly of regular nucleosome arrays bythe RSF chromatin-remodeling complex (PubMed:12972596).Facilitates transcription of hepatitis B virus (HBV) genes by thepX transcription activator. In case of infection by HBV, togetherwith pX, it represses TNF-alpha induced NF-kappa-B transcriptionactivation. Represses transcription when artificially recruited tochromatin by fusion to a heterogeneous DNA binding domain(PubMed:11944984, PubMed:11788598). {ECO:0000269|PubMed:11788598,ECO:0000269|PubMed:11944984, ECO:0000269|PubMed:12972596}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRSF1chr11:78239888chr11:77378536ENST00000308488-14161286_129212501442Compositional biasNote=Poly-Glu
TgeneRSF1chr11:78239888chr11:77378536ENST00000308488-14161419_142412501442Compositional biasNote=Poly-Glu
TgeneRSF1chr11:78239888chr11:77378536ENST00000360355-13151286_129212191411Compositional biasNote=Poly-Glu
TgeneRSF1chr11:78239888chr11:77378536ENST00000360355-13151419_142412191411Compositional biasNote=Poly-Glu
TgeneRSF1chr11:78239888chr11:77378536ENST00000480887-9111080_10839981190Compositional biasNote=Poly-Ala
TgeneRSF1chr11:78239888chr11:77378536ENST00000480887-9111146_12439981190Compositional biasNote=Arg-rich
TgeneRSF1chr11:78239888chr11:77378536ENST00000480887-9111286_12929981190Compositional biasNote=Poly-Glu
TgeneRSF1chr11:78239888chr11:77378536ENST00000480887-9111419_14249981190Compositional biasNote=Poly-Glu

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRSF1chr11:78239888chr11:77378536ENST00000308488-1416942_101212501442Coiled coilOntology_term=ECO:0000255
TgeneRSF1chr11:78239888chr11:77378536ENST00000360355-1315942_101212191411Coiled coilOntology_term=ECO:0000255
TgeneRSF1chr11:78239888chr11:77378536ENST00000480887-911942_10129981190Coiled coilOntology_term=ECO:0000255
TgeneRSF1chr11:78239888chr11:77378536ENST00000308488-14161080_108312501442Compositional biasNote=Poly-Ala
TgeneRSF1chr11:78239888chr11:77378536ENST00000308488-14161146_124312501442Compositional biasNote=Arg-rich
TgeneRSF1chr11:78239888chr11:77378536ENST00000308488-1416226_37212501442Compositional biasNote=Glu-rich
TgeneRSF1chr11:78239888chr11:77378536ENST00000308488-1416875_88412501442Compositional biasNote=Poly-Glu
TgeneRSF1chr11:78239888chr11:77378536ENST00000360355-13151080_108312191411Compositional biasNote=Poly-Ala
TgeneRSF1chr11:78239888chr11:77378536ENST00000360355-13151146_124312191411Compositional biasNote=Arg-rich
TgeneRSF1chr11:78239888chr11:77378536ENST00000360355-1315226_37212191411Compositional biasNote=Glu-rich
TgeneRSF1chr11:78239888chr11:77378536ENST00000360355-1315875_88412191411Compositional biasNote=Poly-Glu
TgeneRSF1chr11:78239888chr11:77378536ENST00000480887-911226_3729981190Compositional biasNote=Glu-rich
TgeneRSF1chr11:78239888chr11:77378536ENST00000480887-911875_8849981190Compositional biasNote=Poly-Glu
TgeneRSF1chr11:78239888chr11:77378536ENST00000308488-141617_8412501442DomainNote=DDT
TgeneRSF1chr11:78239888chr11:77378536ENST00000360355-131517_8412191411DomainNote=DDT
TgeneRSF1chr11:78239888chr11:77378536ENST00000480887-91117_849981190DomainNote=DDT
TgeneRSF1chr11:78239888chr11:77378536ENST00000308488-1416891_94112501442Zinc fingerPHD-type
TgeneRSF1chr11:78239888chr11:77378536ENST00000360355-1315891_94112191411Zinc fingerPHD-type
TgeneRSF1chr11:78239888chr11:77378536ENST00000480887-911891_9419981190Zinc fingerPHD-type


Top

FusionGeneSequence for NARS2_RSF1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NARS2_ENST00000281038_chr11_78239888_-_RSF1_ENST00000308488_chr11_77378536_-_421aa
MLGVRCLLRSVRFCSSAPFPKHKPSAKLSVRDALGAQNASGERIKIQGWIRSVRSQKEVLFLHVNDGSSLESLQVVADSGLDSRELNFGS
SVEVQGQLIKSPSKRQNVELKAEKIKVIGNCDAKDFPIKTKERHPLETLRQTPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHT
PIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGELFVQEL_R__AS_RIKAVSSKAGPKHRRVFRSR_GGGGR
GRQTIPQTATPD_DG_GGEL_QCSWRCKSACP_QPA_GPALRTREHQEALPDRK__GRGL_KCRQSGEPIGL_LSGLTFNQWTEPWQSH_

>In-frame_NARS2_ENST00000281038_chr11_78239888_-_RSF1_ENST00000360355_chr11_77378536_-_421aa
MLGVRCLLRSVRFCSSAPFPKHKPSAKLSVRDALGAQNASGERIKIQGWIRSVRSQKEVLFLHVNDGSSLESLQVVADSGLDSRELNFGS
SVEVQGQLIKSPSKRQNVELKAEKIKVIGNCDAKDFPIKTKERHPLETLRQTPHFRCRTNVLGSILRIRSEATAAIHSFFKDSGFVHIHT
PIITSNDSEGAGELFQLEPSGKLKVPEENFFNVPAFLTVSGQLHLEVMSGELFVQEL_R__AS_RIKAVSSKAGPKHRRVFRSR_GGGGR
GRQTIPQTATPD_DG_GGEL_QCSWRCKSACP_QPA_GPALRTREHQEALPDRK__GRGL_KCRQSGEPIGL_LSGLTFNQWTEPWQSH_

>In-frame_NARS2_ENST00000528850_chr11_78239888_-_RSF1_ENST00000308488_chr11_77378536_-_194aa
MSGELFVQEL_R__AS_RIKAVSSKAGPKHRRVFRSR_GGGGRGRQTIPQTATPD_DG_GGEL_QCSWRCKSACP_QPA_GPALRTREHQ
EALPDRK__GRGL_KCRQSGEPIGL_LSGLTFNQWTEPWQSH_ELDWQAY_EVSDPQGQQHSQCKPSLQWDKWWAGGRSTRRGGR_AFES

>In-frame_NARS2_ENST00000528850_chr11_78239888_-_RSF1_ENST00000360355_chr11_77378536_-_194aa
MSGELFVQEL_R__AS_RIKAVSSKAGPKHRRVFRSR_GGGGRGRQTIPQTATPD_DG_GGEL_QCSWRCKSACP_QPA_GPALRTREHQ
EALPDRK__GRGL_KCRQSGEPIGL_LSGLTFNQWTEPWQSH_ELDWQAY_EVSDPQGQQHSQCKPSLQWDKWWAGGRSTRRGGR_AFES


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NARS2_ENST00000281038_chr11_78239888_-_RSF1_ENST00000308488_chr11_77378536_-_1264nt
ATGCTGGGGGTCCGCTGCCTGCTGCGGTCCGTGCGCTTCTGTTCCTCCGCCCCCTTCCCCAAGCACAAACCTTCAGCCAAACTGAGCGTG
CGGGACGCTCTCGGGGCTCAGAACGCGAGTGGGGAGCGCATTAAGATCCAGGGATGGATTCGTTCTGTCCGATCCCAGAAGGAAGTCTTG
TTCCTGCATGTAAATGATGGGTCATCTTTGGAAAGCCTTCAGGTTGTTGCAGATTCAGGCCTTGACAGTAGAGAATTAAATTTTGGGAGT
TCTGTGGAAGTACAAGGGCAGCTGATAAAAAGTCCATCCAAAAGGCAAAATGTGGAACTGAAGGCAGAAAAAATTAAAGTTATTGGAAAT
TGTGATGCCAAGGATTTCCCCATCAAATATAAAGAGAGGCATCCTCTGGAGTATCTGCGACAATATCCTCACTTTAGGTGTAGGACTAAC
GTTCTGGGTTCTATATTGAGGATTCGCAGTGAAGCGACAGCTGCTATTCATTCTTTCTTTAAGGACAGTGGCTTTGTACATATTCATACT
CCAATAATCACATCCAATGACTCTGAGGGAGCTGGAGAACTTTTTCAACTTGAACCTTCAGGCAAACTTAAGGTACCTGAGGAGAATTTC
TTCAATGTTCCTGCTTTCTTAACTGTCTCAGGACAACTTCATCTAGAAGTGATGTCAGGAGAGCTATTTGTCCAAGAACTCTGAAGATGA
TGAGCTAGCTAAAGAATCAAAGCGGTCAGTTCGAAAGCGGGGCCGAAGCACAGACGAGTATTCAGAAGCAGATGAGGAGGAGGAGGAAGA
GGAAGGCAAACCATCCCGCAAACGGCTACACCGGATTGAGACGGATGAGGAGGAGAGTTGTGACAATGCTCATGGAGATGCAAATCAGCC
TGCCCGTGACAGCCAGCCTAGGGTCCTGCCCTCAGAACAAGAGAGCACCAAGAAGCCCTACCGGATAGAAAGTGATGAGGAAGAGGACTT
TGAAAATGTAGGCAAAGTGGGGAGCCCATTGGACTATAGCTTAGTGGACTTACCTTCAACCAATGGACAGAGCCCTGGCAAAGCCATTGA
GAACTTGATTGGCAAGCCTACTGAGAAGTCTCAGACCCCCAAGGACAACAGCACAGCCAGTGCAAGCCTAGCCTCCAATGGGACAAGTGG
TGGGCAGGAGGCAGGAGCACCAGAAGAGGAGGAAGATGAGCTTTTGAGAGTGACTGACCTTGTTGATTATGTCTGTAACAGTGAACAGTT

>In-frame_NARS2_ENST00000281038_chr11_78239888_-_RSF1_ENST00000360355_chr11_77378536_-_1264nt
ATGCTGGGGGTCCGCTGCCTGCTGCGGTCCGTGCGCTTCTGTTCCTCCGCCCCCTTCCCCAAGCACAAACCTTCAGCCAAACTGAGCGTG
CGGGACGCTCTCGGGGCTCAGAACGCGAGTGGGGAGCGCATTAAGATCCAGGGATGGATTCGTTCTGTCCGATCCCAGAAGGAAGTCTTG
TTCCTGCATGTAAATGATGGGTCATCTTTGGAAAGCCTTCAGGTTGTTGCAGATTCAGGCCTTGACAGTAGAGAATTAAATTTTGGGAGT
TCTGTGGAAGTACAAGGGCAGCTGATAAAAAGTCCATCCAAAAGGCAAAATGTGGAACTGAAGGCAGAAAAAATTAAAGTTATTGGAAAT
TGTGATGCCAAGGATTTCCCCATCAAATATAAAGAGAGGCATCCTCTGGAGTATCTGCGACAATATCCTCACTTTAGGTGTAGGACTAAC
GTTCTGGGTTCTATATTGAGGATTCGCAGTGAAGCGACAGCTGCTATTCATTCTTTCTTTAAGGACAGTGGCTTTGTACATATTCATACT
CCAATAATCACATCCAATGACTCTGAGGGAGCTGGAGAACTTTTTCAACTTGAACCTTCAGGCAAACTTAAGGTACCTGAGGAGAATTTC
TTCAATGTTCCTGCTTTCTTAACTGTCTCAGGACAACTTCATCTAGAAGTGATGTCAGGAGAGCTATTTGTCCAAGAACTCTGAAGATGA
TGAGCTAGCTAAAGAATCAAAGCGGTCAGTTCGAAAGCGGGGCCGAAGCACAGACGAGTATTCAGAAGCAGATGAGGAGGAGGAGGAAGA
GGAAGGCAAACCATCCCGCAAACGGCTACACCGGATTGAGACGGATGAGGAGGAGAGTTGTGACAATGCTCATGGAGATGCAAATCAGCC
TGCCCGTGACAGCCAGCCTAGGGTCCTGCCCTCAGAACAAGAGAGCACCAAGAAGCCCTACCGGATAGAAAGTGATGAGGAAGAGGACTT
TGAAAATGTAGGCAAAGTGGGGAGCCCATTGGACTATAGCTTAGTGGACTTACCTTCAACCAATGGACAGAGCCCTGGCAAAGCCATTGA
GAACTTGATTGGCAAGCCTACTGAGAAGTCTCAGACCCCCAAGGACAACAGCACAGCCAGTGCAAGCCTAGCCTCCAATGGGACAAGTGG
TGGGCAGGAGGCAGGAGCACCAGAAGAGGAGGAAGATGAGCTTTTGAGAGTGACTGACCTTGTTGATTATGTCTGTAACAGTGAACAGTT

>In-frame_NARS2_ENST00000528850_chr11_78239888_-_RSF1_ENST00000308488_chr11_77378536_-_583nt
ATGTCAGGAGAGCTATTTGTCCAAGAACTCTGAAGATGATGAGCTAGCTAAAGAATCAAAGCGGTCAGTTCGAAAGCGGGGCCGAAGCAC
AGACGAGTATTCAGAAGCAGATGAGGAGGAGGAGGAAGAGGAAGGCAAACCATCCCGCAAACGGCTACACCGGATTGAGACGGATGAGGA
GGAGAGTTGTGACAATGCTCATGGAGATGCAAATCAGCCTGCCCGTGACAGCCAGCCTAGGGTCCTGCCCTCAGAACAAGAGAGCACCAA
GAAGCCCTACCGGATAGAAAGTGATGAGGAAGAGGACTTTGAAAATGTAGGCAAAGTGGGGAGCCCATTGGACTATAGCTTAGTGGACTT
ACCTTCAACCAATGGACAGAGCCCTGGCAAAGCCATTGAGAACTTGATTGGCAAGCCTACTGAGAAGTCTCAGACCCCCAAGGACAACAG
CACAGCCAGTGCAAGCCTAGCCTCCAATGGGACAAGTGGTGGGCAGGAGGCAGGAGCACCAGAAGAGGAGGAAGATGAGCTTTTGAGAGT

>In-frame_NARS2_ENST00000528850_chr11_78239888_-_RSF1_ENST00000360355_chr11_77378536_-_583nt
ATGTCAGGAGAGCTATTTGTCCAAGAACTCTGAAGATGATGAGCTAGCTAAAGAATCAAAGCGGTCAGTTCGAAAGCGGGGCCGAAGCAC
AGACGAGTATTCAGAAGCAGATGAGGAGGAGGAGGAAGAGGAAGGCAAACCATCCCGCAAACGGCTACACCGGATTGAGACGGATGAGGA
GGAGAGTTGTGACAATGCTCATGGAGATGCAAATCAGCCTGCCCGTGACAGCCAGCCTAGGGTCCTGCCCTCAGAACAAGAGAGCACCAA
GAAGCCCTACCGGATAGAAAGTGATGAGGAAGAGGACTTTGAAAATGTAGGCAAAGTGGGGAGCCCATTGGACTATAGCTTAGTGGACTT
ACCTTCAACCAATGGACAGAGCCCTGGCAAAGCCATTGAGAACTTGATTGGCAAGCCTACTGAGAAGTCTCAGACCCCCAAGGACAACAG
CACAGCCAGTGCAAGCCTAGCCTCCAATGGGACAAGTGGTGGGCAGGAGGCAGGAGCACCAGAAGAGGAGGAAGATGAGCTTTTGAGAGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_NARS2_ENST00000281038_chr11_78239888_-_RSF1_ENST00000308488_chr11_77378536_-_8561nt
GTAGCGTGATGACGTAAGCGGCGTTGGCGTGGTGTGGTAGGAGTGGTTGCGCGTGTTGCGGCCCGGGTTCTGTTCGTAGGTTTACAATTG
TCGCGGGTAGTGGGGCGCCCCAGCTGCCAACTGCACGTGGTTTCTTTCTGGCGTTTGCCTAGTGTCCTGTCCATTCCGCCCCGTTGGGAA
GTGGGAAGCGGAGAGGTTCTGTGGGGACAGAGCTGGGAGTCCTGAAGGAGAAAGCGCGCAGCCGAGGGGCTCTGGAGTGCCTTAGAGCAG
AGCTGCGGCCGCGGAAGGGGAGCAGCTGAGAAAGGAGGGCCGCTGCAGGCGGGGTTCGAACCGTGGGGTCTGGGCTGCTCCCGCGGAGGG
CCTGGGCGGACGCGGGATGCTGGGGGTCCGCTGCCTGCTGCGGTCCGTGCGCTTCTGTTCCTCCGCCCCCTTCCCCAAGCACAAACCTTC
AGCCAAACTGAGCGTGCGGGACGCTCTCGGGGCTCAGAACGCGAGTGGGGAGCGCATTAAGATCCAGGGATGGATTCGTTCTGTCCGATC
CCAGAAGGAAGTCTTGTTCCTGCATGTAAATGATGGGTCATCTTTGGAAAGCCTTCAGGTTGTTGCAGATTCAGGCCTTGACAGTAGAGA
ATTAAATTTTGGGAGTTCTGTGGAAGTACAAGGGCAGCTGATAAAAAGTCCATCCAAAAGGCAAAATGTGGAACTGAAGGCAGAAAAAAT
TAAAGTTATTGGAAATTGTGATGCCAAGGATTTCCCCATCAAATATAAAGAGAGGCATCCTCTGGAGTATCTGCGACAATATCCTCACTT
TAGGTGTAGGACTAACGTTCTGGGTTCTATATTGAGGATTCGCAGTGAAGCGACAGCTGCTATTCATTCTTTCTTTAAGGACAGTGGCTT
TGTACATATTCATACTCCAATAATCACATCCAATGACTCTGAGGGAGCTGGAGAACTTTTTCAACTTGAACCTTCAGGCAAACTTAAGGT
ACCTGAGGAGAATTTCTTCAATGTTCCTGCTTTCTTAACTGTCTCAGGACAACTTCATCTAGAAGTGATGTCAGGAGAGCTATTTGTCCA
AGAACTCTGAAGATGATGAGCTAGCTAAAGAATCAAAGCGGTCAGTTCGAAAGCGGGGCCGAAGCACAGACGAGTATTCAGAAGCAGATG
AGGAGGAGGAGGAAGAGGAAGGCAAACCATCCCGCAAACGGCTACACCGGATTGAGACGGATGAGGAGGAGAGTTGTGACAATGCTCATG
GAGATGCAAATCAGCCTGCCCGTGACAGCCAGCCTAGGGTCCTGCCCTCAGAACAAGAGAGCACCAAGAAGCCCTACCGGATAGAAAGTG
ATGAGGAAGAGGACTTTGAAAATGTAGGCAAAGTGGGGAGCCCATTGGACTATAGCTTAGTGGACTTACCTTCAACCAATGGACAGAGCC
CTGGCAAAGCCATTGAGAACTTGATTGGCAAGCCTACTGAGAAGTCTCAGACCCCCAAGGACAACAGCACAGCCAGTGCAAGCCTAGCCT
CCAATGGGACAAGTGGTGGGCAGGAGGCAGGAGCACCAGAAGAGGAGGAAGATGAGCTTTTGAGAGTGACTGACCTTGTTGATTATGTCT
GTAACAGTGAACAGTTATAAGACTTTTTTTCCATTTTTGTGCTAATTTATTCCACGGTAGCTCTCACACCAGCGGGCCAGTTATTAAAAG
CTGTTTAATTTTTCCTAGAAAACTCCACTACAGAATGACTTTTAGAAGAAAAATTTCAACAAATCCTGAAGTCTTTCTGTGAAGTGACCA
GTTCTGAACTTTGAAGATAAATAATTGCTGTAAATTCCTTTTGATTTTCTTTTTCCAGGTTCATGGTCCTTGGTAATTTCATTCATGGAA
AAAAATCTTATTATAATAACAACAAAGATTTGTATATTTTTGACTTTATATTTCCTGAGCTCTCCTGACTTTGTGAAAAAGGGTGGATGA
AAATGCATTCCGAATCTGTGAGGGCCCAAAACAGAATTTAGGGGTGGGTGAAAGCACTTGTGCTTTAGCTTTTTCATATTAAATATATAT
TATATTTAAACATTCATGGCATAGATGATGATTTACAGACAATTTAAAAGTTCAAGTCTGTACTGTTACAGTTTGAGAATTGTAGATAAC
ATCATACATAAGTCATTTAGTAACAGCCTTTGTGAAATGAACTTGTTTACTATTGGAGATAACCACACTTAATAAAGAAGAGACAGTGAA
AGTACCATCATAATTAACCTAAATTTTTGTTATAGCAGAGTTTCTTGTTTAAAAAAAAATAAAATCATCTGAAAAGCATTTGTACAGTAA
AATGTATAATGAAGCTTTGCCAACCAGACTGTGCTAGCAACAAATTTTTTTAAATAAGCTTTATGCAGTGGTAATAAGGTGGCCTCAAAT
ATATTGTGTCTGATGGAGAGTTATTAGTGAAATGAATGTGGTCTTTCTTAAGGCCTGGGTGGACTGTAAACTTTGCCAATAGTATAACTC
TTGTCTTCTGGCCACTTGATGTTTAAATATCTGAAATATCATTTTGAAAAAAATACATCTATATATAACATACATGAAGAGATGCTAAGC
TGACAGTGATATTTTAGCACATTTGAAGACTGGGAAGAGATTTTCAGGTGAATTTTAACTGGTCTATTCTTGCCCTTAGTATCTACTTCA
AATTGAAGTCTACAAACAAAGCAGTTCCTTTGGGAGGTTTTTAGTTTGAGTTTTAGCGTGTGTGTGTGTTTGTGTGTGTGCGTGTGCGTG
TGTGTGTGTGTTGGAATTTCCTATCTGCCTGGATATATTAGCAGAGTTTGAATGTAGTTTTGGCCTTTGGCCATTAGACTTCTATTAAAA
TTCATTAATAGTCATACAACCAACATAGAGTTGAATGAGAACTGCCGATGTAATTAATAGGCATGACATCCATTTCAAACATCTCAACAC
TTTAAAGAAAAGCCCTTTGTTTCAAGAAAAAAGGGTTTGTAACTAACTAAATACCTAACATGTAATTGACACTAAAATATGAACTTTGTC
TTATTTAGTTTCTGTTATAGCTGTAAAATTTCAGGCAGAGCCATAACATTGTACAGAGTGTAGCACTTGTGATTAAACCTAGCCTGTTAA
ATCCTGAAACCTTCAACCATTACTTCTGTGAATACTTTAGCCCTGGGATTTGGGTTTTTCTGTTCCGGTGTTGTGTCTGTTGCCGGCAAT
GGACACACCATATCTGCTGCTGGCCCAAGGAACGTCATTAATTTTTCTTTCCAAATTAAGTATTATGTGCTAGTCAGTGTATAGTAAAGC
ACTTCTCTTTTTTATTACTAAAAAGCTGGCATTAGATTTGCATTATAAATACCTCTCTAGGAACTTTATACTCCTTTTCCTTCTTCAACA
GGTATTGCCCTTAAATCTTATCTTTTGGCCTTGAAAGTTTATAGCTATTGTTTTTCAGTTGTTCGTTGTTTTGTTTTGTTTCACTTTAGT
TCTGTAGTACCTGCCCATTAATATTTTTGCTTTGATTCTAGCAATGTGTATGTATCTGTATAAAAAATAAAATAATGAAAGCAACCTAAA
AATAGGATGCACCAATAGCATGTGGTTCCAAGTAAGTTGTGATTTTTATTTTGAGACAGTGTTCCACTGGAAGGGAGGGAAGGGCTTACA
TTCACAGACAGTAAAGCAGGGCTGTGTAAGGAGCTACATTTACTTAACAGTCTCCTTTCCAGCTAGGTTTGTTTTATTTATTTGCAAGTC
AGCTAAGAATTAACCTTTTAAACCATCTAAAACAGGCAAGCAATATAAAGATTTCTACTAGTGCAAGGTAAGTGGTTTGAATATACAAGT
GCCCTTTCCTGCCACCCAGTCTCACTACCGTTTTAGTCCTGCAGCTGGGTAAAGCCACTATTGTGTGGAAACTCTCCCATGTGCCCTGTC
TCTACCTCTGGACACACCAGCTCCTTCTTCCACCTATTCTATTCCTCAGTTAAGCCAAGTGATCAGAAGTAGTATTAAATGGGTAGATAA
TTTTAACAGGATGCCTAATGTGAAATAAGGAGTTATTTTTACTCTTCTACTATAGAAAGCCTAAGGTAATTCTTACCATCTCAAAGACTG
AGTATTCCATTTAGGTTTGGAGACCACTTGTGCTGTGCTGCCTGATATTTACCAAACTTGAATAAGTGTTCGTCAACTTGATAGTGAATG
TACCCCTTCTCACCTTATATTTTGATTAAATCAATTAACTATAGGTCATCTACCAAGAATGTAATCCAAGCGGTTGATAAAACATTATTA
GGCAGATAGATTATTGATTATTAAATTTTGAGCAGTGCAAAAACGGTTTTGCTGCTTGGAGTTCAGATTCAGTCCCTCAAAGAGTTTATG
ATCACTGAAATACACTCTGAAGGTATTCTGAAGAAGTTAAAAAATTTTAGAAAACGAAATGTTCTGTATACAAAGACAATACAGTCACTA
CGAACTGCAGAAAGTATAGGAAAGCAGTAATTGATGTAGAGTTTAGACAGTCTTGGATCTTTTTTAGAGCACTAACCATGGATTTAGACT
CAAAATAGCTGCTACATAATAGAGCCCTTTAATAATTTAAACCCCCCTTGTTGAAATACAAGTTGGACTCCCAGTGTCAAACTCTAGACT
GTAGCTAATGTATTAAAGGGAGATGTAGATTAATATTCAGTATATTTAGTTTGCAATTTCTGAAAAGGTTTGAAAACTAGTCAGCTTTTC
ACACAGCAGAAGCTTTGAACTGAAATATGTGTGAAAAGGACGCAGACTGAAAACGTTTTGGTTTTGTACATCAGTGCTGATGAAATTAGT
GTAAAACATTTTCCATCATTGGCACATTACTGCAAAATGATGGCAGAGATATTTTCAAGAATGTACATCAAGTTATATTTCCTTGACATC
CTTTTTTCAATTGGTCAAGGTTACAGATTCAGAGGATAAAGGGTAGTTTCATTTAGAATAAATTCATGTCTACTGGCAATCTATATATAA
AAGTGACCTGCCCAAGAACCAAAAACTTTAAATGCTAATGAAGCTTTTGAAAAATAATTTTTAAACAAATTAATTTTAAAAGGGTGTTAC
ACGTACCCAGTTTTTACTTTTTAGTTGATGAAACCCATCCTATAATATACATTTGAGCAAAGTACACATATTAAGAAAAACATGGACATT
TACTTGTTTAATAGTCAAAATGATGAGGAAATGTTAGCTGTTTTTAAGTGGGACTGGTGGGGTGTCCTTTGTCACAAGGAATGCTTTTTT
AGCTTGTTTGTGGGCATAAGAGATGTTAACCCTTTGCTGATTCTACCACACAACTGTAAAGAACCTAATGAATCTACAAGTTTAATATTC
AGAAAAAGCTAGGAACTCCGCTCTTTACCAGTACAGTGGAACAGGCCCGTTATTCAAGGTGATGCCTCACAGCTATAGAACAACTATTCA
AAGACCCAGAGTTAAATGGTACATGTGTATATGTGTGTGTGTGTGTGCACACGCACACACTTCAGATAAGTATCAGAAAAAATAAAAATG
AATCCATCATTAACTTGAAAGAAATAAGATGGCTGCATTGCAACAGATACAAATATTATGAACATCATTTAATTACAGAAAATCTAGACA
ACAGTTTCTCCTGATGTTTGACATTCTCAAAATATATTCCTCATTCTCGAAGAAGCAGAGAATGCCAAGGCTGCATATCTGCTGTAATCT
ACCTAGCCCTCTTCTGCTTAATATGATCCATTATTGAATCTTCTCAGATTAAAATCCATTCCTATATCATCTACCTTTCCCAAAGTGTGT
GCCTGTAAACCTACCTTGGAAGTGGCAAGTTAACTGATTTTTTTGTGTCATTTTTATACCAATCCTTAAGGTCAAAGCCTTTTGCTATCA
ATGTATTTAAACTGAGTTGCTATATGTTCACTAATTTGTTTTCAAAATGTTTTGCTCCAACTTAAATTATCTTTTAACATCTTTTGAGTG
CCAAGAATTGCTAAGTAACTGTAATATGTTGAAGAGAGTAATTGCCAAGCAAGCAGTCATAAGCCAAAATGTAATGAGCTTAGTATATAA
CCACTTTAGAGTATACACTCACCACTTTTTGTATTCATTCATGCAAACCCTCCTGGAAGTCGATTAGAAGAGGATCCAATTTGTGGACCT
TTTTTCCTCCTTTTGGACACCTGAGCACAATTTTTTTTTTCCTTTCATATTTATACCACTTTGGAAAATTCAGTAAACCCAATTCTGGCA
CATCATAATGGTTTCAGTTAGTGAAGATGTTTATTTTAATAACTTTAAAATATGACTATCCTATACATAAGTTATATAAGAGGGCATAAC
AATAGATGAGTAGAAATTTATAAAATTTCTTGGATATTTTGAATGAGAAAAAAACATTTTTAAAGGAATTTTGTTTTTTCCTTTTTTGGC
CAAACCGGTACAAGTTAGAAAGTGTGCTAAGGACTGAATACTTGCCTCGTGCTTTTTGCCACTGGATGATGTAAGTTAAGAATGGAATTG
TTAATCCTAAGTATATATTTTCTTGACTTTCATCAGTTTCTAAAGAAATCTAATTTAAGTGTTTTGCGGTTTTGTTTGATCTGTATTTAT
TGAGTTCTGGTCATAGACCAGCAGCTTGCACGTCATGCTCATGAACAGCCAGAACATAGTTATTGGGGAACTTCATGGCTCAAAACCTTC
TGAATCATTTAACTTATTTTGTATGTTGCAAAAAAAAAAAAAAAGTTTATTTTGCTTGAGAGTCACCTTTTTTTAAAAAAAATAACTGTA
CAGCTTTTAAGGGATGGGAGGTGGGAAAATACCCTAAAATAGGATGTAGATTTTTTACAATTGTGTTTATGCTAGATCATCTACAGGTGC
ATTATGTAATTAAACCTAAAATTGTTTAAAAATTTGTGCCATGTCTTTTTCATTCTCCTGCCCTTTAGCAGAATTGGTGCATGTCAACTG
CTATGTGGACAAGCCTTGAAATTAGAGTAACAAGCCCTGTCTCCAAAGCTTTAAGGTCACTGCATGAAAATTGCACACACACACACACAC
ACACACACATCTAGCTTATATTAGTAAATGGATTTTCAGGATCAGAACAGCTACAGTAGCCCAGATTTGGCTGTTAACAGCATATTCTTA
CAGCACATGATTTTTGTGATGCCTAACTAGGGTATTCTCAATGTTAGTCTGGTGTTCTATTCTCTTTCAAAGTAGCTTCTTGAGATGGTA
TCTGTTGTAGCTTGCCCAAACCTGCCATGAGGTTGTGTGTACACTTTGAAAGGGTATGTCCTATGCTAAGATGGTGGTAGAGCAGGGCTT
GATTTTAATCTATTCATATAAAAGAAGGAAAAAACTAGAATTGGTCTATTTGGTTATTCAGTGGACTTAATTCCACAGGAATAGTTGTCT
GCTGAAGCGTGGCAGCAAGAGAAGTCAAATTCAAGTTTCAGTTCCTTCCTTATTCACTAAGTATTTTGAAATCTTGTAGAACTTCTGATT
CTAGCACAGTCTTTTACATGGCACATTTTACCATGGTATATTCACAGCTTCGTTTAAATGTCAGTACTTTTTCCCATCTGATAATTTTGC
CATTCTAATTTCTCACCTTTGTAGTACAAGTGTATTCTTGAAAATAATTAAATTCATCTAAGTGTGTCATAATTTCAATCAAAGCTATAT
TCATGTGTTGCCAGCGTCAGTTTTTTGCTATCCTCATTCAGAAGGGAAGCCTGCAGATCATGAGTTTCCATATGAAGAATACAAATTCCA
CATAAAAATTTATAAATGGTATCTTTAGAATTTTGATTTAAAGTAATAGCTGGAATTCAGGGACTGATCAGAATGCCTCTTGAATTTTCC
AACATGCTTATATGAAATGCTTTATTTTCCTATGCGTTAAAAAAAATATTCCTGGAATAGGTTCTCAGAATGTTTTATTTGGTTTCTAGG
AGATGAGATTTAAAGCAGAAGCTCCAAGATTGGCATAAAACTAACTCTTGAGGTAATCAGGACCATGCTGTTAGTCAAATAGAAGCTGGA
GTGCTCTCTGTCACATAATGTACTGCATGTGTGTGGGGGTGGGGGGGCAGGGAAGATCAGAAAACTGGAAATGTAATTCTGATAACACGC
AAAGTAAATTGTGCATTAAAAGTATGGGAATTCTTGGTAGCTTAAAGCTTCAGGGGTTAACTTCAGTGTATGAACACCTAGTGTGTTAGA
ATTGCAGTGCATAGTTGTTTAAATACAATATTCCTTGTAAGTGACAACCAAAATATGTTGTGGCTGGTGCCAGTATTTTTGTTAATGAAA
TGTTCAGTGTCTCACTACAGTCTGATCAGAACTCTTGGTGTTATAAGCCAGGCCTAAAGCCATTTTATAGCTATTGGCCTAATTGTGTAA
CTTTTTCTTTCAAAATGTTTTATTATAATACTTCTGTCATTTCTTTCACTTAATATGTCAATTGTCATAATAAAAATTTAAATTTGAATT

>In-frame_NARS2_ENST00000281038_chr11_78239888_-_RSF1_ENST00000360355_chr11_77378536_-_2327nt
GTAGCGTGATGACGTAAGCGGCGTTGGCGTGGTGTGGTAGGAGTGGTTGCGCGTGTTGCGGCCCGGGTTCTGTTCGTAGGTTTACAATTG
TCGCGGGTAGTGGGGCGCCCCAGCTGCCAACTGCACGTGGTTTCTTTCTGGCGTTTGCCTAGTGTCCTGTCCATTCCGCCCCGTTGGGAA
GTGGGAAGCGGAGAGGTTCTGTGGGGACAGAGCTGGGAGTCCTGAAGGAGAAAGCGCGCAGCCGAGGGGCTCTGGAGTGCCTTAGAGCAG
AGCTGCGGCCGCGGAAGGGGAGCAGCTGAGAAAGGAGGGCCGCTGCAGGCGGGGTTCGAACCGTGGGGTCTGGGCTGCTCCCGCGGAGGG
CCTGGGCGGACGCGGGATGCTGGGGGTCCGCTGCCTGCTGCGGTCCGTGCGCTTCTGTTCCTCCGCCCCCTTCCCCAAGCACAAACCTTC
AGCCAAACTGAGCGTGCGGGACGCTCTCGGGGCTCAGAACGCGAGTGGGGAGCGCATTAAGATCCAGGGATGGATTCGTTCTGTCCGATC
CCAGAAGGAAGTCTTGTTCCTGCATGTAAATGATGGGTCATCTTTGGAAAGCCTTCAGGTTGTTGCAGATTCAGGCCTTGACAGTAGAGA
ATTAAATTTTGGGAGTTCTGTGGAAGTACAAGGGCAGCTGATAAAAAGTCCATCCAAAAGGCAAAATGTGGAACTGAAGGCAGAAAAAAT
TAAAGTTATTGGAAATTGTGATGCCAAGGATTTCCCCATCAAATATAAAGAGAGGCATCCTCTGGAGTATCTGCGACAATATCCTCACTT
TAGGTGTAGGACTAACGTTCTGGGTTCTATATTGAGGATTCGCAGTGAAGCGACAGCTGCTATTCATTCTTTCTTTAAGGACAGTGGCTT
TGTACATATTCATACTCCAATAATCACATCCAATGACTCTGAGGGAGCTGGAGAACTTTTTCAACTTGAACCTTCAGGCAAACTTAAGGT
ACCTGAGGAGAATTTCTTCAATGTTCCTGCTTTCTTAACTGTCTCAGGACAACTTCATCTAGAAGTGATGTCAGGAGAGCTATTTGTCCA
AGAACTCTGAAGATGATGAGCTAGCTAAAGAATCAAAGCGGTCAGTTCGAAAGCGGGGCCGAAGCACAGACGAGTATTCAGAAGCAGATG
AGGAGGAGGAGGAAGAGGAAGGCAAACCATCCCGCAAACGGCTACACCGGATTGAGACGGATGAGGAGGAGAGTTGTGACAATGCTCATG
GAGATGCAAATCAGCCTGCCCGTGACAGCCAGCCTAGGGTCCTGCCCTCAGAACAAGAGAGCACCAAGAAGCCCTACCGGATAGAAAGTG
ATGAGGAAGAGGACTTTGAAAATGTAGGCAAAGTGGGGAGCCCATTGGACTATAGCTTAGTGGACTTACCTTCAACCAATGGACAGAGCC
CTGGCAAAGCCATTGAGAACTTGATTGGCAAGCCTACTGAGAAGTCTCAGACCCCCAAGGACAACAGCACAGCCAGTGCAAGCCTAGCCT
CCAATGGGACAAGTGGTGGGCAGGAGGCAGGAGCACCAGAAGAGGAGGAAGATGAGCTTTTGAGAGTGACTGACCTTGTTGATTATGTCT
GTAACAGTGAACAGTTATAAGACTTTTTTTCCATTTTTGTGCTAATTTATTCCACGGTAGCTCTCACACCAGCGGGCCAGTTATTAAAAG
CTGTTTAATTTTTCCTAGAAAACTCCACTACAGAATGACTTTTAGAAGAAAAATTTCAACAAATCCTGAAGTCTTTCTGTGAAGTGACCA
GTTCTGAACTTTGAAGATAAATAATTGCTGTAAATTCCTTTTGATTTTCTTTTTCCAGGTTCATGGTCCTTGGTAATTTCATTCATGGAA
AAAAATCTTATTATAATAACAACAAAGATTTGTATATTTTTGACTTTATATTTCCTGAGCTCTCCTGACTTTGTGAAAAAGGGTGGATGA
AAATGCATTCCGAATCTGTGAGGGCCCAAAACAGAATTTAGGGGTGGGTGAAAGCACTTGTGCTTTAGCTTTTTCATATTAAATATATAT
TATATTTAAACATTCATGGCATAGATGATGATTTACAGACAATTTAAAAGTTCAAGTCTGTACTGTTACAGTTTGAGAATTGTAGATAAC
ATCATACATAAGTCATTTAGTAACAGCCTTTGTGAAATGAACTTGTTTACTATTGGAGATAACCACACTTAATAAAGAAGAGACAGTGAA

>In-frame_NARS2_ENST00000528850_chr11_78239888_-_RSF1_ENST00000308488_chr11_77378536_-_8441nt
AGGGTCTAGCTCTGTCACCCAGACTGGAGCGCAGTGATGTGATCTCAGATGACTACAACCTCCATCTCCCAGGCTCAAGCAATCCTCCTG
CCTCGGCCTCCAGAGTAGCTGAAACTATAGGCATGCACCACCACACTCTATAATTTTTTAAGTTTTTTGTGAAGATGAGTCTCACTGTAT
TGCCCAGGCTGGTCTCAAACTCCTGGACTCAAGCAGTCCTCCTCCTTCGGCATCCCAAAATGCTGGGATTACAGGCATAAGCCTGGTAGA
TGTTGTTATAATAAATACTTATTTTTTGAGTAGGTTCTTGCTTTGTCACCCATGATTGTACTGACACAGTCATGGCTTGCCGTTGCAGTG
ATTTCTGTTGTCCTCACATATCCTTTACTTTTTAGCGGGATGGATTCGTTCTGTCCGATCCCAGAAGGAAGTCTTGTTCCTGCATGTAAA
TGATGGGTCATCTTTGGAAAGCCTTCAGGTTGTTGCAGATTCAGGCCTTGACAGTAGAGAATTAAATTTTGGGAGTTCTGTGGAAGTACA
AGGGCAGCTGATAAAAAGTCCATCCAAAAGGCAAAATGTGGAACTGAAGGCAGAAAAAATTAAAGTTATTGGAAATTGTGATGCCAAGGA
TTTCCCCATCAAATATAAAGAGAGGCATCCTCTGGAGTATCTGCGACAATATCCTCACTTTAGGTGTAGGACTAACGTTCTGGGTTCTAT
ATTGAGGATTCGCAGTGAAGCGACAGCTGCTATTCATTCTTTCTTTAAGGACAGTGGCTTTGTACATATTCATACTCCAATAATCACATC
CAATGACTCTGAGGGAGCTGGAGAACTTTTTCAACTTGAACCTTCAGGCAAACTTAAGGTACCTGAGGAGAATTTCTTCAATGTTCCTGC
TTTCTTAACTGTCTCAGGACAACTTCATCTAGAAGTGATGTCAGGAGAGCTATTTGTCCAAGAACTCTGAAGATGATGAGCTAGCTAAAG
AATCAAAGCGGTCAGTTCGAAAGCGGGGCCGAAGCACAGACGAGTATTCAGAAGCAGATGAGGAGGAGGAGGAAGAGGAAGGCAAACCAT
CCCGCAAACGGCTACACCGGATTGAGACGGATGAGGAGGAGAGTTGTGACAATGCTCATGGAGATGCAAATCAGCCTGCCCGTGACAGCC
AGCCTAGGGTCCTGCCCTCAGAACAAGAGAGCACCAAGAAGCCCTACCGGATAGAAAGTGATGAGGAAGAGGACTTTGAAAATGTAGGCA
AAGTGGGGAGCCCATTGGACTATAGCTTAGTGGACTTACCTTCAACCAATGGACAGAGCCCTGGCAAAGCCATTGAGAACTTGATTGGCA
AGCCTACTGAGAAGTCTCAGACCCCCAAGGACAACAGCACAGCCAGTGCAAGCCTAGCCTCCAATGGGACAAGTGGTGGGCAGGAGGCAG
GAGCACCAGAAGAGGAGGAAGATGAGCTTTTGAGAGTGACTGACCTTGTTGATTATGTCTGTAACAGTGAACAGTTATAAGACTTTTTTT
CCATTTTTGTGCTAATTTATTCCACGGTAGCTCTCACACCAGCGGGCCAGTTATTAAAAGCTGTTTAATTTTTCCTAGAAAACTCCACTA
CAGAATGACTTTTAGAAGAAAAATTTCAACAAATCCTGAAGTCTTTCTGTGAAGTGACCAGTTCTGAACTTTGAAGATAAATAATTGCTG
TAAATTCCTTTTGATTTTCTTTTTCCAGGTTCATGGTCCTTGGTAATTTCATTCATGGAAAAAAATCTTATTATAATAACAACAAAGATT
TGTATATTTTTGACTTTATATTTCCTGAGCTCTCCTGACTTTGTGAAAAAGGGTGGATGAAAATGCATTCCGAATCTGTGAGGGCCCAAA
ACAGAATTTAGGGGTGGGTGAAAGCACTTGTGCTTTAGCTTTTTCATATTAAATATATATTATATTTAAACATTCATGGCATAGATGATG
ATTTACAGACAATTTAAAAGTTCAAGTCTGTACTGTTACAGTTTGAGAATTGTAGATAACATCATACATAAGTCATTTAGTAACAGCCTT
TGTGAAATGAACTTGTTTACTATTGGAGATAACCACACTTAATAAAGAAGAGACAGTGAAAGTACCATCATAATTAACCTAAATTTTTGT
TATAGCAGAGTTTCTTGTTTAAAAAAAAATAAAATCATCTGAAAAGCATTTGTACAGTAAAATGTATAATGAAGCTTTGCCAACCAGACT
GTGCTAGCAACAAATTTTTTTAAATAAGCTTTATGCAGTGGTAATAAGGTGGCCTCAAATATATTGTGTCTGATGGAGAGTTATTAGTGA
AATGAATGTGGTCTTTCTTAAGGCCTGGGTGGACTGTAAACTTTGCCAATAGTATAACTCTTGTCTTCTGGCCACTTGATGTTTAAATAT
CTGAAATATCATTTTGAAAAAAATACATCTATATATAACATACATGAAGAGATGCTAAGCTGACAGTGATATTTTAGCACATTTGAAGAC
TGGGAAGAGATTTTCAGGTGAATTTTAACTGGTCTATTCTTGCCCTTAGTATCTACTTCAAATTGAAGTCTACAAACAAAGCAGTTCCTT
TGGGAGGTTTTTAGTTTGAGTTTTAGCGTGTGTGTGTGTTTGTGTGTGTGCGTGTGCGTGTGTGTGTGTGTTGGAATTTCCTATCTGCCT
GGATATATTAGCAGAGTTTGAATGTAGTTTTGGCCTTTGGCCATTAGACTTCTATTAAAATTCATTAATAGTCATACAACCAACATAGAG
TTGAATGAGAACTGCCGATGTAATTAATAGGCATGACATCCATTTCAAACATCTCAACACTTTAAAGAAAAGCCCTTTGTTTCAAGAAAA
AAGGGTTTGTAACTAACTAAATACCTAACATGTAATTGACACTAAAATATGAACTTTGTCTTATTTAGTTTCTGTTATAGCTGTAAAATT
TCAGGCAGAGCCATAACATTGTACAGAGTGTAGCACTTGTGATTAAACCTAGCCTGTTAAATCCTGAAACCTTCAACCATTACTTCTGTG
AATACTTTAGCCCTGGGATTTGGGTTTTTCTGTTCCGGTGTTGTGTCTGTTGCCGGCAATGGACACACCATATCTGCTGCTGGCCCAAGG
AACGTCATTAATTTTTCTTTCCAAATTAAGTATTATGTGCTAGTCAGTGTATAGTAAAGCACTTCTCTTTTTTATTACTAAAAAGCTGGC
ATTAGATTTGCATTATAAATACCTCTCTAGGAACTTTATACTCCTTTTCCTTCTTCAACAGGTATTGCCCTTAAATCTTATCTTTTGGCC
TTGAAAGTTTATAGCTATTGTTTTTCAGTTGTTCGTTGTTTTGTTTTGTTTCACTTTAGTTCTGTAGTACCTGCCCATTAATATTTTTGC
TTTGATTCTAGCAATGTGTATGTATCTGTATAAAAAATAAAATAATGAAAGCAACCTAAAAATAGGATGCACCAATAGCATGTGGTTCCA
AGTAAGTTGTGATTTTTATTTTGAGACAGTGTTCCACTGGAAGGGAGGGAAGGGCTTACATTCACAGACAGTAAAGCAGGGCTGTGTAAG
GAGCTACATTTACTTAACAGTCTCCTTTCCAGCTAGGTTTGTTTTATTTATTTGCAAGTCAGCTAAGAATTAACCTTTTAAACCATCTAA
AACAGGCAAGCAATATAAAGATTTCTACTAGTGCAAGGTAAGTGGTTTGAATATACAAGTGCCCTTTCCTGCCACCCAGTCTCACTACCG
TTTTAGTCCTGCAGCTGGGTAAAGCCACTATTGTGTGGAAACTCTCCCATGTGCCCTGTCTCTACCTCTGGACACACCAGCTCCTTCTTC
CACCTATTCTATTCCTCAGTTAAGCCAAGTGATCAGAAGTAGTATTAAATGGGTAGATAATTTTAACAGGATGCCTAATGTGAAATAAGG
AGTTATTTTTACTCTTCTACTATAGAAAGCCTAAGGTAATTCTTACCATCTCAAAGACTGAGTATTCCATTTAGGTTTGGAGACCACTTG
TGCTGTGCTGCCTGATATTTACCAAACTTGAATAAGTGTTCGTCAACTTGATAGTGAATGTACCCCTTCTCACCTTATATTTTGATTAAA
TCAATTAACTATAGGTCATCTACCAAGAATGTAATCCAAGCGGTTGATAAAACATTATTAGGCAGATAGATTATTGATTATTAAATTTTG
AGCAGTGCAAAAACGGTTTTGCTGCTTGGAGTTCAGATTCAGTCCCTCAAAGAGTTTATGATCACTGAAATACACTCTGAAGGTATTCTG
AAGAAGTTAAAAAATTTTAGAAAACGAAATGTTCTGTATACAAAGACAATACAGTCACTACGAACTGCAGAAAGTATAGGAAAGCAGTAA
TTGATGTAGAGTTTAGACAGTCTTGGATCTTTTTTAGAGCACTAACCATGGATTTAGACTCAAAATAGCTGCTACATAATAGAGCCCTTT
AATAATTTAAACCCCCCTTGTTGAAATACAAGTTGGACTCCCAGTGTCAAACTCTAGACTGTAGCTAATGTATTAAAGGGAGATGTAGAT
TAATATTCAGTATATTTAGTTTGCAATTTCTGAAAAGGTTTGAAAACTAGTCAGCTTTTCACACAGCAGAAGCTTTGAACTGAAATATGT
GTGAAAAGGACGCAGACTGAAAACGTTTTGGTTTTGTACATCAGTGCTGATGAAATTAGTGTAAAACATTTTCCATCATTGGCACATTAC
TGCAAAATGATGGCAGAGATATTTTCAAGAATGTACATCAAGTTATATTTCCTTGACATCCTTTTTTCAATTGGTCAAGGTTACAGATTC
AGAGGATAAAGGGTAGTTTCATTTAGAATAAATTCATGTCTACTGGCAATCTATATATAAAAGTGACCTGCCCAAGAACCAAAAACTTTA
AATGCTAATGAAGCTTTTGAAAAATAATTTTTAAACAAATTAATTTTAAAAGGGTGTTACACGTACCCAGTTTTTACTTTTTAGTTGATG
AAACCCATCCTATAATATACATTTGAGCAAAGTACACATATTAAGAAAAACATGGACATTTACTTGTTTAATAGTCAAAATGATGAGGAA
ATGTTAGCTGTTTTTAAGTGGGACTGGTGGGGTGTCCTTTGTCACAAGGAATGCTTTTTTAGCTTGTTTGTGGGCATAAGAGATGTTAAC
CCTTTGCTGATTCTACCACACAACTGTAAAGAACCTAATGAATCTACAAGTTTAATATTCAGAAAAAGCTAGGAACTCCGCTCTTTACCA
GTACAGTGGAACAGGCCCGTTATTCAAGGTGATGCCTCACAGCTATAGAACAACTATTCAAAGACCCAGAGTTAAATGGTACATGTGTAT
ATGTGTGTGTGTGTGTGCACACGCACACACTTCAGATAAGTATCAGAAAAAATAAAAATGAATCCATCATTAACTTGAAAGAAATAAGAT
GGCTGCATTGCAACAGATACAAATATTATGAACATCATTTAATTACAGAAAATCTAGACAACAGTTTCTCCTGATGTTTGACATTCTCAA
AATATATTCCTCATTCTCGAAGAAGCAGAGAATGCCAAGGCTGCATATCTGCTGTAATCTACCTAGCCCTCTTCTGCTTAATATGATCCA
TTATTGAATCTTCTCAGATTAAAATCCATTCCTATATCATCTACCTTTCCCAAAGTGTGTGCCTGTAAACCTACCTTGGAAGTGGCAAGT
TAACTGATTTTTTTGTGTCATTTTTATACCAATCCTTAAGGTCAAAGCCTTTTGCTATCAATGTATTTAAACTGAGTTGCTATATGTTCA
CTAATTTGTTTTCAAAATGTTTTGCTCCAACTTAAATTATCTTTTAACATCTTTTGAGTGCCAAGAATTGCTAAGTAACTGTAATATGTT
GAAGAGAGTAATTGCCAAGCAAGCAGTCATAAGCCAAAATGTAATGAGCTTAGTATATAACCACTTTAGAGTATACACTCACCACTTTTT
GTATTCATTCATGCAAACCCTCCTGGAAGTCGATTAGAAGAGGATCCAATTTGTGGACCTTTTTTCCTCCTTTTGGACACCTGAGCACAA
TTTTTTTTTTCCTTTCATATTTATACCACTTTGGAAAATTCAGTAAACCCAATTCTGGCACATCATAATGGTTTCAGTTAGTGAAGATGT
TTATTTTAATAACTTTAAAATATGACTATCCTATACATAAGTTATATAAGAGGGCATAACAATAGATGAGTAGAAATTTATAAAATTTCT
TGGATATTTTGAATGAGAAAAAAACATTTTTAAAGGAATTTTGTTTTTTCCTTTTTTGGCCAAACCGGTACAAGTTAGAAAGTGTGCTAA
GGACTGAATACTTGCCTCGTGCTTTTTGCCACTGGATGATGTAAGTTAAGAATGGAATTGTTAATCCTAAGTATATATTTTCTTGACTTT
CATCAGTTTCTAAAGAAATCTAATTTAAGTGTTTTGCGGTTTTGTTTGATCTGTATTTATTGAGTTCTGGTCATAGACCAGCAGCTTGCA
CGTCATGCTCATGAACAGCCAGAACATAGTTATTGGGGAACTTCATGGCTCAAAACCTTCTGAATCATTTAACTTATTTTGTATGTTGCA
AAAAAAAAAAAAAAGTTTATTTTGCTTGAGAGTCACCTTTTTTTAAAAAAAATAACTGTACAGCTTTTAAGGGATGGGAGGTGGGAAAAT
ACCCTAAAATAGGATGTAGATTTTTTACAATTGTGTTTATGCTAGATCATCTACAGGTGCATTATGTAATTAAACCTAAAATTGTTTAAA
AATTTGTGCCATGTCTTTTTCATTCTCCTGCCCTTTAGCAGAATTGGTGCATGTCAACTGCTATGTGGACAAGCCTTGAAATTAGAGTAA
CAAGCCCTGTCTCCAAAGCTTTAAGGTCACTGCATGAAAATTGCACACACACACACACACACACACACATCTAGCTTATATTAGTAAATG
GATTTTCAGGATCAGAACAGCTACAGTAGCCCAGATTTGGCTGTTAACAGCATATTCTTACAGCACATGATTTTTGTGATGCCTAACTAG
GGTATTCTCAATGTTAGTCTGGTGTTCTATTCTCTTTCAAAGTAGCTTCTTGAGATGGTATCTGTTGTAGCTTGCCCAAACCTGCCATGA
GGTTGTGTGTACACTTTGAAAGGGTATGTCCTATGCTAAGATGGTGGTAGAGCAGGGCTTGATTTTAATCTATTCATATAAAAGAAGGAA
AAAACTAGAATTGGTCTATTTGGTTATTCAGTGGACTTAATTCCACAGGAATAGTTGTCTGCTGAAGCGTGGCAGCAAGAGAAGTCAAAT
TCAAGTTTCAGTTCCTTCCTTATTCACTAAGTATTTTGAAATCTTGTAGAACTTCTGATTCTAGCACAGTCTTTTACATGGCACATTTTA
CCATGGTATATTCACAGCTTCGTTTAAATGTCAGTACTTTTTCCCATCTGATAATTTTGCCATTCTAATTTCTCACCTTTGTAGTACAAG
TGTATTCTTGAAAATAATTAAATTCATCTAAGTGTGTCATAATTTCAATCAAAGCTATATTCATGTGTTGCCAGCGTCAGTTTTTTGCTA
TCCTCATTCAGAAGGGAAGCCTGCAGATCATGAGTTTCCATATGAAGAATACAAATTCCACATAAAAATTTATAAATGGTATCTTTAGAA
TTTTGATTTAAAGTAATAGCTGGAATTCAGGGACTGATCAGAATGCCTCTTGAATTTTCCAACATGCTTATATGAAATGCTTTATTTTCC
TATGCGTTAAAAAAAATATTCCTGGAATAGGTTCTCAGAATGTTTTATTTGGTTTCTAGGAGATGAGATTTAAAGCAGAAGCTCCAAGAT
TGGCATAAAACTAACTCTTGAGGTAATCAGGACCATGCTGTTAGTCAAATAGAAGCTGGAGTGCTCTCTGTCACATAATGTACTGCATGT
GTGTGGGGGTGGGGGGGCAGGGAAGATCAGAAAACTGGAAATGTAATTCTGATAACACGCAAAGTAAATTGTGCATTAAAAGTATGGGAA
TTCTTGGTAGCTTAAAGCTTCAGGGGTTAACTTCAGTGTATGAACACCTAGTGTGTTAGAATTGCAGTGCATAGTTGTTTAAATACAATA
TTCCTTGTAAGTGACAACCAAAATATGTTGTGGCTGGTGCCAGTATTTTTGTTAATGAAATGTTCAGTGTCTCACTACAGTCTGATCAGA
ACTCTTGGTGTTATAAGCCAGGCCTAAAGCCATTTTATAGCTATTGGCCTAATTGTGTAACTTTTTCTTTCAAAATGTTTTATTATAATA

>In-frame_NARS2_ENST00000528850_chr11_78239888_-_RSF1_ENST00000360355_chr11_77378536_-_2207nt
AGGGTCTAGCTCTGTCACCCAGACTGGAGCGCAGTGATGTGATCTCAGATGACTACAACCTCCATCTCCCAGGCTCAAGCAATCCTCCTG
CCTCGGCCTCCAGAGTAGCTGAAACTATAGGCATGCACCACCACACTCTATAATTTTTTAAGTTTTTTGTGAAGATGAGTCTCACTGTAT
TGCCCAGGCTGGTCTCAAACTCCTGGACTCAAGCAGTCCTCCTCCTTCGGCATCCCAAAATGCTGGGATTACAGGCATAAGCCTGGTAGA
TGTTGTTATAATAAATACTTATTTTTTGAGTAGGTTCTTGCTTTGTCACCCATGATTGTACTGACACAGTCATGGCTTGCCGTTGCAGTG
ATTTCTGTTGTCCTCACATATCCTTTACTTTTTAGCGGGATGGATTCGTTCTGTCCGATCCCAGAAGGAAGTCTTGTTCCTGCATGTAAA
TGATGGGTCATCTTTGGAAAGCCTTCAGGTTGTTGCAGATTCAGGCCTTGACAGTAGAGAATTAAATTTTGGGAGTTCTGTGGAAGTACA
AGGGCAGCTGATAAAAAGTCCATCCAAAAGGCAAAATGTGGAACTGAAGGCAGAAAAAATTAAAGTTATTGGAAATTGTGATGCCAAGGA
TTTCCCCATCAAATATAAAGAGAGGCATCCTCTGGAGTATCTGCGACAATATCCTCACTTTAGGTGTAGGACTAACGTTCTGGGTTCTAT
ATTGAGGATTCGCAGTGAAGCGACAGCTGCTATTCATTCTTTCTTTAAGGACAGTGGCTTTGTACATATTCATACTCCAATAATCACATC
CAATGACTCTGAGGGAGCTGGAGAACTTTTTCAACTTGAACCTTCAGGCAAACTTAAGGTACCTGAGGAGAATTTCTTCAATGTTCCTGC
TTTCTTAACTGTCTCAGGACAACTTCATCTAGAAGTGATGTCAGGAGAGCTATTTGTCCAAGAACTCTGAAGATGATGAGCTAGCTAAAG
AATCAAAGCGGTCAGTTCGAAAGCGGGGCCGAAGCACAGACGAGTATTCAGAAGCAGATGAGGAGGAGGAGGAAGAGGAAGGCAAACCAT
CCCGCAAACGGCTACACCGGATTGAGACGGATGAGGAGGAGAGTTGTGACAATGCTCATGGAGATGCAAATCAGCCTGCCCGTGACAGCC
AGCCTAGGGTCCTGCCCTCAGAACAAGAGAGCACCAAGAAGCCCTACCGGATAGAAAGTGATGAGGAAGAGGACTTTGAAAATGTAGGCA
AAGTGGGGAGCCCATTGGACTATAGCTTAGTGGACTTACCTTCAACCAATGGACAGAGCCCTGGCAAAGCCATTGAGAACTTGATTGGCA
AGCCTACTGAGAAGTCTCAGACCCCCAAGGACAACAGCACAGCCAGTGCAAGCCTAGCCTCCAATGGGACAAGTGGTGGGCAGGAGGCAG
GAGCACCAGAAGAGGAGGAAGATGAGCTTTTGAGAGTGACTGACCTTGTTGATTATGTCTGTAACAGTGAACAGTTATAAGACTTTTTTT
CCATTTTTGTGCTAATTTATTCCACGGTAGCTCTCACACCAGCGGGCCAGTTATTAAAAGCTGTTTAATTTTTCCTAGAAAACTCCACTA
CAGAATGACTTTTAGAAGAAAAATTTCAACAAATCCTGAAGTCTTTCTGTGAAGTGACCAGTTCTGAACTTTGAAGATAAATAATTGCTG
TAAATTCCTTTTGATTTTCTTTTTCCAGGTTCATGGTCCTTGGTAATTTCATTCATGGAAAAAAATCTTATTATAATAACAACAAAGATT
TGTATATTTTTGACTTTATATTTCCTGAGCTCTCCTGACTTTGTGAAAAAGGGTGGATGAAAATGCATTCCGAATCTGTGAGGGCCCAAA
ACAGAATTTAGGGGTGGGTGAAAGCACTTGTGCTTTAGCTTTTTCATATTAAATATATATTATATTTAAACATTCATGGCATAGATGATG
ATTTACAGACAATTTAAAAGTTCAAGTCTGTACTGTTACAGTTTGAGAATTGTAGATAACATCATACATAAGTCATTTAGTAACAGCCTT
TGTGAAATGAACTTGTTTACTATTGGAGATAACCACACTTAATAAAGAAGAGACAGTGAAAGTACCATCATAATTAACCTAAATTTTTGT


Top

FusionGenePPI for NARS2_RSF1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NARS2SLC25A41, OXLD1, DARS2, ADRBK1, CHCHD2, RAB8B, PDK4, LAMP3, NDUFS7, HSPD1, ACSM5, TRNT1, CD70, YBEY, TMEM70, NIT1, GATC, CLEC2D, FOXRED1, OTC, BPNT1, CHRM3RSF1NFKB1, SMARCA5, CENPA, SIRT7, SP1, COPS6, CSNK2A1, HIST1H2BG, HIST1H3A, EWSR1, MARK2, ATXN3, KAT6A, MCM2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NARS2_RSF1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NARS2_RSF1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneNARS2C0023264Leigh Disease1UNIPROT
HgeneNARS2C4015643COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 241ORPHANET;UNIPROT