FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23341

FusionGeneSummary for NACC2_NUP214

check button Fusion gene summary
Fusion gene informationFusion gene name: NACC2_NUP214
Fusion gene ID: 23341
HgeneTgene
Gene symbol

NACC2

NUP214

Gene ID

138151

8021

Gene nameNACC family member 2nucleoporin 214
SynonymsBEND9|BTBD14|BTBD14A|BTBD31|NAC-2|RBBCAIN|CAN
Cytomap

9q34.3

9q34.13

Type of geneprotein-codingprotein-coding
Descriptionnucleus accumbens-associated protein 2BEN domain containing 9BTB (POZ) domain containing 14ABTB/POZ domain-containing protein 14ANACC family member 2, BEN and BTB (POZ) domain containingrepressor with BTB domain and BEN domaintranscription repressornuclear pore complex protein Nup214CAN protein, putative oncogenenucleoporin 214kDa
Modification date2018052320180523
UniProtAcc

Q96BF6

P35658

Ensembl transtripts involved in fusion geneENST00000371753, ENST00000277554, 
ENST00000467669, 
ENST00000359428, 
ENST00000411637, ENST00000451030, 
ENST00000483497, ENST00000465486, 
Fusion gene scores* DoF score2 X 1 X 2=46 X 7 X 4=168
# samples 27
** MAII scorelog2(2/4*10)=2.32192809488736log2(7/168*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: NACC2 [Title/Abstract] AND NUP214 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneNACC2

GO:0008285

negative regulation of cell proliferation

22926524

HgeneNACC2

GO:0034629

cellular protein-containing complex localization

22926524

HgeneNACC2

GO:0045892

negative regulation of transcription, DNA-templated

22926524

HgeneNACC2

GO:0051260

protein homooligomerization

22926524

HgeneNACC2

GO:1900477

negative regulation of G1/S transition of mitotic cell cycle by negative regulation of transcription from RNA polymerase II promoter

22926524

HgeneNACC2

GO:1902231

positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage

22926524


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A8-A08X-01ANACC2chr9

138941482

-NUP214chr9

134108841

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000371753ENST00000359428NACC2chr9

138941482

-NUP214chr9

134108841

+
In-frameENST00000371753ENST00000411637NACC2chr9

138941482

-NUP214chr9

134108841

+
Frame-shitENST00000371753ENST00000451030NACC2chr9

138941482

-NUP214chr9

134108841

+
In-frameENST00000371753ENST00000483497NACC2chr9

138941482

-NUP214chr9

134108841

+
5CDS-intronENST00000371753ENST00000465486NACC2chr9

138941482

-NUP214chr9

134108841

+
Frame-shitENST00000277554ENST00000359428NACC2chr9

138941482

-NUP214chr9

134108841

+
In-frameENST00000277554ENST00000411637NACC2chr9

138941482

-NUP214chr9

134108841

+
Frame-shitENST00000277554ENST00000451030NACC2chr9

138941482

-NUP214chr9

134108841

+
In-frameENST00000277554ENST00000483497NACC2chr9

138941482

-NUP214chr9

134108841

+
5CDS-intronENST00000277554ENST00000465486NACC2chr9

138941482

-NUP214chr9

134108841

+
intron-3CDSENST00000467669ENST00000359428NACC2chr9

138941482

-NUP214chr9

134108841

+
intron-3CDSENST00000467669ENST00000411637NACC2chr9

138941482

-NUP214chr9

134108841

+
intron-3CDSENST00000467669ENST00000451030NACC2chr9

138941482

-NUP214chr9

134108841

+
intron-3CDSENST00000467669ENST00000483497NACC2chr9

138941482

-NUP214chr9

134108841

+
intron-intronENST00000467669ENST00000465486NACC2chr9

138941482

-NUP214chr9

134108841

+

Top

FusionProtFeatures for NACC2_NUP214


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
NACC2

Q96BF6

NUP214

P35658

Functions as a transcriptional repressor through itsassociation with the NuRD complex. Recruits the NuRD complex tothe promoter of MDM2, leading to the repression of MDM2transcription and subsequent stability of p53/TP53.{ECO:0000269|PubMed:22926524}. May serve as a docking site in the receptor-mediatedimport of substrates across the nuclear pore complex.{ECO:0000303|PubMed:8108440}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for NACC2_NUP214


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_NACC2_ENST00000371753_chr9_138941482_-_NUP214_ENST00000411637_chr9_134108841_+_306aa
MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELPGSVPPACFQQILSFCYTGRL
TMTASEQLVVMYTAGFLQIQHIVERGTDLMFKVSSPHCDSQTAVIEDAGSEPQSPCNQLQPAAAAAAPYVVSPSVPIPLLTRVKHEAMEL
PPAGPGLAPKRPLETGPRDGVAVAAGAAVAAGTAPLKLPRVSYYGVPSLATLIPGIQQMPYPQGERTSPGASSLPTTDSPTSYHNEEDEE

>In-frame_NACC2_ENST00000371753_chr9_138941482_-_NUP214_ENST00000483497_chr9_134108841_+_306aa
MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELPGSVPPACFQQILSFCYTGRL
TMTASEQLVVMYTAGFLQIQHIVERGTDLMFKVSSPHCDSQTAVIEDAGSEPQSPCNQLQPAAAAAAPYVVSPSVPIPLLTRVKHEAMEL
PPAGPGLAPKRPLETGPRDGVAVAAGAAVAAGTAPLKLPRVSYYGVPSLATLIPGIQQMPYPQGERTSPGASSLPTTDSPTSYHNEEDEE

>In-frame_NACC2_ENST00000277554_chr9_138941482_-_NUP214_ENST00000411637_chr9_134108841_+_306aa
MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELPGSVPPACFQQILSFCYTGRL
TMTASEQLVVMYTAGFLQIQHIVERGTDLMFKVSSPHCDSQTAVIEDAGSEPQSPCNQLQPAAAAAAPYVVSPSVPIPLLTRVKHEAMEL
PPAGPGLAPKRPLETGPRDGVAVAAGAAVAAGTAPLKLPRVSYYGVPSLATLIPGIQQMPYPQGERTSPGASSLPTTDSPTSYHNEEDEE

>In-frame_NACC2_ENST00000277554_chr9_138941482_-_NUP214_ENST00000483497_chr9_134108841_+_306aa
MSQMLHIEIPNFGNTVLGCLNEQRLLGLYCDVSIVVKGQAFKAHRAVLAASSLYFRDLFSGNSKSAFELPGSVPPACFQQILSFCYTGRL
TMTASEQLVVMYTAGFLQIQHIVERGTDLMFKVSSPHCDSQTAVIEDAGSEPQSPCNQLQPAAAAAAPYVVSPSVPIPLLTRVKHEAMEL
PPAGPGLAPKRPLETGPRDGVAVAAGAAVAAGTAPLKLPRVSYYGVPSLATLIPGIQQMPYPQGERTSPGASSLPTTDSPTSYHNEEDEE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_NACC2_ENST00000371753_chr9_138941482_-_NUP214_ENST00000411637_chr9_134108841_+_920nt
ATGTCTCAGATGCTGCACATCGAGATCCCCAACTTCGGGAACACAGTGCTGGGCTGCCTGAACGAGCAGCGCCTGCTGGGCCTCTACTGC
GATGTGTCCATCGTGGTCAAGGGCCAGGCCTTCAAGGCCCACCGGGCGGTGCTGGCCGCCAGCAGCCTCTACTTCCGCGACCTGTTCAGC
GGCAACAGCAAGAGCGCCTTCGAGCTGCCCGGCTCCGTGCCGCCCGCCTGCTTCCAGCAGATCCTGTCCTTCTGCTACACGGGCAGGCTC
ACCATGACGGCCAGCGAGCAGCTCGTGGTCATGTACACGGCCGGCTTCCTGCAGATCCAGCACATCGTGGAGCGCGGCACCGACCTCATG
TTCAAGGTGAGCTCGCCCCACTGCGACTCGCAGACCGCTGTGATCGAGGACGCCGGCTCCGAGCCCCAGAGCCCCTGCAACCAGCTGCAG
CCGGCCGCCGCCGCCGCGGCCCCCTACGTCGTGTCCCCCTCGGTGCCCATCCCGCTGCTGACCCGAGTAAAGCATGAAGCCATGGAGCTG
CCGCCGGCCGGCCCAGGCCTGGCCCCCAAGCGCCCGCTGGAGACGGGGCCCCGGGACGGCGTGGCGGTGGCCGCGGGGGCTGCGGTGGCG
GCGGGCACAGCCCCTCTCAAACTGCCCCGTGTCTCCTACTACGGGGTGCCCAGCCTGGCCACCCTCATCCCCGGCATCCAGCAGATGCCC
TACCCCCAGGGGGAGCGGACCAGTCCAGGCGCCAGCAGCCTGCCCACCACCGACAGCCCCACCTCGTACCACAACGAGGAGGACGAGGAG
GACGACGAGGCCTACGACACCATGGTGGAGGAGCAGTACGGCCAGATGTACATCAAGGCCTCCGGCAGCTATGCAGGTCTGTCCAGGGTT

>In-frame_NACC2_ENST00000371753_chr9_138941482_-_NUP214_ENST00000483497_chr9_134108841_+_920nt
ATGTCTCAGATGCTGCACATCGAGATCCCCAACTTCGGGAACACAGTGCTGGGCTGCCTGAACGAGCAGCGCCTGCTGGGCCTCTACTGC
GATGTGTCCATCGTGGTCAAGGGCCAGGCCTTCAAGGCCCACCGGGCGGTGCTGGCCGCCAGCAGCCTCTACTTCCGCGACCTGTTCAGC
GGCAACAGCAAGAGCGCCTTCGAGCTGCCCGGCTCCGTGCCGCCCGCCTGCTTCCAGCAGATCCTGTCCTTCTGCTACACGGGCAGGCTC
ACCATGACGGCCAGCGAGCAGCTCGTGGTCATGTACACGGCCGGCTTCCTGCAGATCCAGCACATCGTGGAGCGCGGCACCGACCTCATG
TTCAAGGTGAGCTCGCCCCACTGCGACTCGCAGACCGCTGTGATCGAGGACGCCGGCTCCGAGCCCCAGAGCCCCTGCAACCAGCTGCAG
CCGGCCGCCGCCGCCGCGGCCCCCTACGTCGTGTCCCCCTCGGTGCCCATCCCGCTGCTGACCCGAGTAAAGCATGAAGCCATGGAGCTG
CCGCCGGCCGGCCCAGGCCTGGCCCCCAAGCGCCCGCTGGAGACGGGGCCCCGGGACGGCGTGGCGGTGGCCGCGGGGGCTGCGGTGGCG
GCGGGCACAGCCCCTCTCAAACTGCCCCGTGTCTCCTACTACGGGGTGCCCAGCCTGGCCACCCTCATCCCCGGCATCCAGCAGATGCCC
TACCCCCAGGGGGAGCGGACCAGTCCAGGCGCCAGCAGCCTGCCCACCACCGACAGCCCCACCTCGTACCACAACGAGGAGGACGAGGAG
GACGACGAGGCCTACGACACCATGGTGGAGGAGCAGTACGGCCAGATGTACATCAAGGCCTCCGGCAGCTATGCAGGTCTGTCCAGGGTT

>In-frame_NACC2_ENST00000277554_chr9_138941482_-_NUP214_ENST00000411637_chr9_134108841_+_920nt
ATGTCTCAGATGCTGCACATCGAGATCCCCAACTTCGGGAACACAGTGCTGGGCTGCCTGAACGAGCAGCGCCTGCTGGGCCTCTACTGC
GATGTGTCCATCGTGGTCAAGGGCCAGGCCTTCAAGGCCCACCGGGCGGTGCTGGCCGCCAGCAGCCTCTACTTCCGCGACCTGTTCAGC
GGCAACAGCAAGAGCGCCTTCGAGCTGCCCGGCTCCGTGCCGCCCGCCTGCTTCCAGCAGATCCTGTCCTTCTGCTACACGGGCAGGCTC
ACCATGACGGCCAGCGAGCAGCTCGTGGTCATGTACACGGCCGGCTTCCTGCAGATCCAGCACATCGTGGAGCGCGGCACCGACCTCATG
TTCAAGGTGAGCTCGCCCCACTGCGACTCGCAGACCGCTGTGATCGAGGACGCCGGCTCCGAGCCCCAGAGCCCCTGCAACCAGCTGCAG
CCGGCCGCCGCCGCCGCGGCCCCCTACGTCGTGTCCCCCTCGGTGCCCATCCCGCTGCTGACCCGAGTAAAGCATGAAGCCATGGAGCTG
CCGCCGGCCGGCCCAGGCCTGGCCCCCAAGCGCCCGCTGGAGACGGGGCCCCGGGACGGCGTGGCGGTGGCCGCGGGGGCTGCGGTGGCG
GCGGGCACAGCCCCTCTCAAACTGCCCCGTGTCTCCTACTACGGGGTGCCCAGCCTGGCCACCCTCATCCCCGGCATCCAGCAGATGCCC
TACCCCCAGGGGGAGCGGACCAGTCCAGGCGCCAGCAGCCTGCCCACCACCGACAGCCCCACCTCGTACCACAACGAGGAGGACGAGGAG
GACGACGAGGCCTACGACACCATGGTGGAGGAGCAGTACGGCCAGATGTACATCAAGGCCTCCGGCAGCTATGCAGGTCTGTCCAGGGTT

>In-frame_NACC2_ENST00000277554_chr9_138941482_-_NUP214_ENST00000483497_chr9_134108841_+_920nt
ATGTCTCAGATGCTGCACATCGAGATCCCCAACTTCGGGAACACAGTGCTGGGCTGCCTGAACGAGCAGCGCCTGCTGGGCCTCTACTGC
GATGTGTCCATCGTGGTCAAGGGCCAGGCCTTCAAGGCCCACCGGGCGGTGCTGGCCGCCAGCAGCCTCTACTTCCGCGACCTGTTCAGC
GGCAACAGCAAGAGCGCCTTCGAGCTGCCCGGCTCCGTGCCGCCCGCCTGCTTCCAGCAGATCCTGTCCTTCTGCTACACGGGCAGGCTC
ACCATGACGGCCAGCGAGCAGCTCGTGGTCATGTACACGGCCGGCTTCCTGCAGATCCAGCACATCGTGGAGCGCGGCACCGACCTCATG
TTCAAGGTGAGCTCGCCCCACTGCGACTCGCAGACCGCTGTGATCGAGGACGCCGGCTCCGAGCCCCAGAGCCCCTGCAACCAGCTGCAG
CCGGCCGCCGCCGCCGCGGCCCCCTACGTCGTGTCCCCCTCGGTGCCCATCCCGCTGCTGACCCGAGTAAAGCATGAAGCCATGGAGCTG
CCGCCGGCCGGCCCAGGCCTGGCCCCCAAGCGCCCGCTGGAGACGGGGCCCCGGGACGGCGTGGCGGTGGCCGCGGGGGCTGCGGTGGCG
GCGGGCACAGCCCCTCTCAAACTGCCCCGTGTCTCCTACTACGGGGTGCCCAGCCTGGCCACCCTCATCCCCGGCATCCAGCAGATGCCC
TACCCCCAGGGGGAGCGGACCAGTCCAGGCGCCAGCAGCCTGCCCACCACCGACAGCCCCACCTCGTACCACAACGAGGAGGACGAGGAG
GACGACGAGGCCTACGACACCATGGTGGAGGAGCAGTACGGCCAGATGTACATCAAGGCCTCCGGCAGCTATGCAGGTCTGTCCAGGGTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_NACC2_ENST00000371753_chr9_138941482_-_NUP214_ENST00000411637_chr9_134108841_+_2155nt
ATGAGCCCCGCTAGGGCCGCCCCGCGCTGAGAGCCCAGCCCCGCCGCTGCCCGCCCGCCATGTCTCAGATGCTGCACATCGAGATCCCCA
ACTTCGGGAACACAGTGCTGGGCTGCCTGAACGAGCAGCGCCTGCTGGGCCTCTACTGCGATGTGTCCATCGTGGTCAAGGGCCAGGCCT
TCAAGGCCCACCGGGCGGTGCTGGCCGCCAGCAGCCTCTACTTCCGCGACCTGTTCAGCGGCAACAGCAAGAGCGCCTTCGAGCTGCCCG
GCTCCGTGCCGCCCGCCTGCTTCCAGCAGATCCTGTCCTTCTGCTACACGGGCAGGCTCACCATGACGGCCAGCGAGCAGCTCGTGGTCA
TGTACACGGCCGGCTTCCTGCAGATCCAGCACATCGTGGAGCGCGGCACCGACCTCATGTTCAAGGTGAGCTCGCCCCACTGCGACTCGC
AGACCGCTGTGATCGAGGACGCCGGCTCCGAGCCCCAGAGCCCCTGCAACCAGCTGCAGCCGGCCGCCGCCGCCGCGGCCCCCTACGTCG
TGTCCCCCTCGGTGCCCATCCCGCTGCTGACCCGAGTAAAGCATGAAGCCATGGAGCTGCCGCCGGCCGGCCCAGGCCTGGCCCCCAAGC
GCCCGCTGGAGACGGGGCCCCGGGACGGCGTGGCGGTGGCCGCGGGGGCTGCGGTGGCGGCGGGCACAGCCCCTCTCAAACTGCCCCGTG
TCTCCTACTACGGGGTGCCCAGCCTGGCCACCCTCATCCCCGGCATCCAGCAGATGCCCTACCCCCAGGGGGAGCGGACCAGTCCAGGCG
CCAGCAGCCTGCCCACCACCGACAGCCCCACCTCGTACCACAACGAGGAGGACGAGGAGGACGACGAGGCCTACGACACCATGGTGGAGG
AGCAGTACGGCCAGATGTACATCAAGGCCTCCGGCAGCTATGCAGGTCTGTCCAGGGTTTTGGTGGCTGGCGAAGCTGAGGGCGTGTCAG
CAGGCCTTTCGATCCCTGGGACCAACCGCATCCTCAGCTTCTTCCCCGAGAAATGCTGGAGCAGGCTGTTCAGACCGACGTTGCCATCAA
AACACATACACCCAGAAAGAAACAACAGAAACCAAAACTCACAAGGCGCATGATTACTTGTTTTATATTTCATGTTGGGTTTTCCCTCCC
ACTATTAAACAGTCTGTTTCCGTACAGAACGTATGTGGGTTTTTTCAGATCACAGCCAAGAAGATTGCCCCGTTTCTGTGGCTCTGAGAA
GCCAGCAGAGCCTCCATCAGCCAGAACACTGTGTCTTCAAGGATGGCATCAGAAGTCACCAGCGTCGGGTGTTGATAAACAGCATCGAAT
GTGCCGTGGTCTCACTTGGACCTAGCGCCCTCCACATAGGGAAGAGGTTGAATGCTGGTGGGTCATCTTTTTGAGGCTGAAACTTGGTTA
TCTCCTCTCCTTGTTCTTTTAGCCATTGTGTATCAGGACCATCCAAGGACGCACTCTGCGATTGAGTGGAGGCAGAGGAAGCCACTCATG
CCAGCAGCAGTTGAGTTTCAGAAGCAGCCATAGCGCTTTTCAGTACAGTACAATAGTAGCCAGCGTGAGGCAGGACAGTGCTGCGCCTTA
GCCGGCCTTGGCTCTCATCTCCATGTGGCTCTTGGGTGCCATGTGTCCTACTCCAGAGAGGAGGGGGCCGGTCACTTGAGAAGACAGCCT
TTATATTCTGTATGTGGCAGTGACATTGGTAGCCACACCTACCCAGTGTCTACTAACCACAGTGCAGATAGCCCTTGGGTAGACCCAGGA
AGTGTGAAGACAGACACTGCTGTTGCCAGACAACACTAGCAGAACGATGCTGGATTTGACAACAGTGTTTGCTAGGACGGCCCAGAGCTC
ATCACTGCAGTTTTATTAGAGTGCTTCTTTATCTTTAATGCAGTATCTTTGAGGCCTGTAACATCCTAGATAGTTGCCATCAAACAAGGA
CCGTCTCGCATTGAAAACAGATGTAAGAATTTCTCTTTCAGGCCCAGAATCTGACAGTGCTTTGGCTTGGGTCATGAGCAGCGGGGAGTT

>In-frame_NACC2_ENST00000371753_chr9_138941482_-_NUP214_ENST00000483497_chr9_134108841_+_1195nt
ATGAGCCCCGCTAGGGCCGCCCCGCGCTGAGAGCCCAGCCCCGCCGCTGCCCGCCCGCCATGTCTCAGATGCTGCACATCGAGATCCCCA
ACTTCGGGAACACAGTGCTGGGCTGCCTGAACGAGCAGCGCCTGCTGGGCCTCTACTGCGATGTGTCCATCGTGGTCAAGGGCCAGGCCT
TCAAGGCCCACCGGGCGGTGCTGGCCGCCAGCAGCCTCTACTTCCGCGACCTGTTCAGCGGCAACAGCAAGAGCGCCTTCGAGCTGCCCG
GCTCCGTGCCGCCCGCCTGCTTCCAGCAGATCCTGTCCTTCTGCTACACGGGCAGGCTCACCATGACGGCCAGCGAGCAGCTCGTGGTCA
TGTACACGGCCGGCTTCCTGCAGATCCAGCACATCGTGGAGCGCGGCACCGACCTCATGTTCAAGGTGAGCTCGCCCCACTGCGACTCGC
AGACCGCTGTGATCGAGGACGCCGGCTCCGAGCCCCAGAGCCCCTGCAACCAGCTGCAGCCGGCCGCCGCCGCCGCGGCCCCCTACGTCG
TGTCCCCCTCGGTGCCCATCCCGCTGCTGACCCGAGTAAAGCATGAAGCCATGGAGCTGCCGCCGGCCGGCCCAGGCCTGGCCCCCAAGC
GCCCGCTGGAGACGGGGCCCCGGGACGGCGTGGCGGTGGCCGCGGGGGCTGCGGTGGCGGCGGGCACAGCCCCTCTCAAACTGCCCCGTG
TCTCCTACTACGGGGTGCCCAGCCTGGCCACCCTCATCCCCGGCATCCAGCAGATGCCCTACCCCCAGGGGGAGCGGACCAGTCCAGGCG
CCAGCAGCCTGCCCACCACCGACAGCCCCACCTCGTACCACAACGAGGAGGACGAGGAGGACGACGAGGCCTACGACACCATGGTGGAGG
AGCAGTACGGCCAGATGTACATCAAGGCCTCCGGCAGCTATGCAGGTCTGTCCAGGGTTTTGGTGGCTGGCGAAGCTGAGGGCGTGTCAG
CAGGCCTTTCGATCCCTGGGACCAACCGCATCCTCAGCTTCTTCCCCGAGAAATGCTGGAGCAGGCTGTTCAGACCGACGTTGCCATCAA
AACACATACACCCAGAAAGAAACAACAGAAACCAAAACTCACAAGGCGCATGATTACTTGTTTTATATTTCATGTTGGGTTTTCCCTCCC

>In-frame_NACC2_ENST00000277554_chr9_138941482_-_NUP214_ENST00000411637_chr9_134108841_+_2252nt
AAAGTCCATGGGAGCCGGAGCGCCGGGACGCCAAGCACTTCCTGCCGCGGGCGGCGCGCCGCAGCTGCCCAGGCCGGACCGGGCCGGGCG
CCCGCAGATGAGCCCCGCTAGGGCCGCCCCGCGCTGAGAGCCCAGCCCCGCCGCTGCCCGCCCGCCATGTCTCAGATGCTGCACATCGAG
ATCCCCAACTTCGGGAACACAGTGCTGGGCTGCCTGAACGAGCAGCGCCTGCTGGGCCTCTACTGCGATGTGTCCATCGTGGTCAAGGGC
CAGGCCTTCAAGGCCCACCGGGCGGTGCTGGCCGCCAGCAGCCTCTACTTCCGCGACCTGTTCAGCGGCAACAGCAAGAGCGCCTTCGAG
CTGCCCGGCTCCGTGCCGCCCGCCTGCTTCCAGCAGATCCTGTCCTTCTGCTACACGGGCAGGCTCACCATGACGGCCAGCGAGCAGCTC
GTGGTCATGTACACGGCCGGCTTCCTGCAGATCCAGCACATCGTGGAGCGCGGCACCGACCTCATGTTCAAGGTGAGCTCGCCCCACTGC
GACTCGCAGACCGCTGTGATCGAGGACGCCGGCTCCGAGCCCCAGAGCCCCTGCAACCAGCTGCAGCCGGCCGCCGCCGCCGCGGCCCCC
TACGTCGTGTCCCCCTCGGTGCCCATCCCGCTGCTGACCCGAGTAAAGCATGAAGCCATGGAGCTGCCGCCGGCCGGCCCAGGCCTGGCC
CCCAAGCGCCCGCTGGAGACGGGGCCCCGGGACGGCGTGGCGGTGGCCGCGGGGGCTGCGGTGGCGGCGGGCACAGCCCCTCTCAAACTG
CCCCGTGTCTCCTACTACGGGGTGCCCAGCCTGGCCACCCTCATCCCCGGCATCCAGCAGATGCCCTACCCCCAGGGGGAGCGGACCAGT
CCAGGCGCCAGCAGCCTGCCCACCACCGACAGCCCCACCTCGTACCACAACGAGGAGGACGAGGAGGACGACGAGGCCTACGACACCATG
GTGGAGGAGCAGTACGGCCAGATGTACATCAAGGCCTCCGGCAGCTATGCAGGTCTGTCCAGGGTTTTGGTGGCTGGCGAAGCTGAGGGC
GTGTCAGCAGGCCTTTCGATCCCTGGGACCAACCGCATCCTCAGCTTCTTCCCCGAGAAATGCTGGAGCAGGCTGTTCAGACCGACGTTG
CCATCAAAACACATACACCCAGAAAGAAACAACAGAAACCAAAACTCACAAGGCGCATGATTACTTGTTTTATATTTCATGTTGGGTTTT
CCCTCCCACTATTAAACAGTCTGTTTCCGTACAGAACGTATGTGGGTTTTTTCAGATCACAGCCAAGAAGATTGCCCCGTTTCTGTGGCT
CTGAGAAGCCAGCAGAGCCTCCATCAGCCAGAACACTGTGTCTTCAAGGATGGCATCAGAAGTCACCAGCGTCGGGTGTTGATAAACAGC
ATCGAATGTGCCGTGGTCTCACTTGGACCTAGCGCCCTCCACATAGGGAAGAGGTTGAATGCTGGTGGGTCATCTTTTTGAGGCTGAAAC
TTGGTTATCTCCTCTCCTTGTTCTTTTAGCCATTGTGTATCAGGACCATCCAAGGACGCACTCTGCGATTGAGTGGAGGCAGAGGAAGCC
ACTCATGCCAGCAGCAGTTGAGTTTCAGAAGCAGCCATAGCGCTTTTCAGTACAGTACAATAGTAGCCAGCGTGAGGCAGGACAGTGCTG
CGCCTTAGCCGGCCTTGGCTCTCATCTCCATGTGGCTCTTGGGTGCCATGTGTCCTACTCCAGAGAGGAGGGGGCCGGTCACTTGAGAAG
ACAGCCTTTATATTCTGTATGTGGCAGTGACATTGGTAGCCACACCTACCCAGTGTCTACTAACCACAGTGCAGATAGCCCTTGGGTAGA
CCCAGGAAGTGTGAAGACAGACACTGCTGTTGCCAGACAACACTAGCAGAACGATGCTGGATTTGACAACAGTGTTTGCTAGGACGGCCC
AGAGCTCATCACTGCAGTTTTATTAGAGTGCTTCTTTATCTTTAATGCAGTATCTTTGAGGCCTGTAACATCCTAGATAGTTGCCATCAA
ACAAGGACCGTCTCGCATTGAAAACAGATGTAAGAATTTCTCTTTCAGGCCCAGAATCTGACAGTGCTTTGGCTTGGGTCATGAGCAGCG
GGGAGTTGGGAAGAGATTTTTTTTTTTAGAGTTTTACATATTGGCAGGTTGTATTTTTTTAATGTTTTAATAAAAGTTTGACATGACATT

>In-frame_NACC2_ENST00000277554_chr9_138941482_-_NUP214_ENST00000483497_chr9_134108841_+_1292nt
AAAGTCCATGGGAGCCGGAGCGCCGGGACGCCAAGCACTTCCTGCCGCGGGCGGCGCGCCGCAGCTGCCCAGGCCGGACCGGGCCGGGCG
CCCGCAGATGAGCCCCGCTAGGGCCGCCCCGCGCTGAGAGCCCAGCCCCGCCGCTGCCCGCCCGCCATGTCTCAGATGCTGCACATCGAG
ATCCCCAACTTCGGGAACACAGTGCTGGGCTGCCTGAACGAGCAGCGCCTGCTGGGCCTCTACTGCGATGTGTCCATCGTGGTCAAGGGC
CAGGCCTTCAAGGCCCACCGGGCGGTGCTGGCCGCCAGCAGCCTCTACTTCCGCGACCTGTTCAGCGGCAACAGCAAGAGCGCCTTCGAG
CTGCCCGGCTCCGTGCCGCCCGCCTGCTTCCAGCAGATCCTGTCCTTCTGCTACACGGGCAGGCTCACCATGACGGCCAGCGAGCAGCTC
GTGGTCATGTACACGGCCGGCTTCCTGCAGATCCAGCACATCGTGGAGCGCGGCACCGACCTCATGTTCAAGGTGAGCTCGCCCCACTGC
GACTCGCAGACCGCTGTGATCGAGGACGCCGGCTCCGAGCCCCAGAGCCCCTGCAACCAGCTGCAGCCGGCCGCCGCCGCCGCGGCCCCC
TACGTCGTGTCCCCCTCGGTGCCCATCCCGCTGCTGACCCGAGTAAAGCATGAAGCCATGGAGCTGCCGCCGGCCGGCCCAGGCCTGGCC
CCCAAGCGCCCGCTGGAGACGGGGCCCCGGGACGGCGTGGCGGTGGCCGCGGGGGCTGCGGTGGCGGCGGGCACAGCCCCTCTCAAACTG
CCCCGTGTCTCCTACTACGGGGTGCCCAGCCTGGCCACCCTCATCCCCGGCATCCAGCAGATGCCCTACCCCCAGGGGGAGCGGACCAGT
CCAGGCGCCAGCAGCCTGCCCACCACCGACAGCCCCACCTCGTACCACAACGAGGAGGACGAGGAGGACGACGAGGCCTACGACACCATG
GTGGAGGAGCAGTACGGCCAGATGTACATCAAGGCCTCCGGCAGCTATGCAGGTCTGTCCAGGGTTTTGGTGGCTGGCGAAGCTGAGGGC
GTGTCAGCAGGCCTTTCGATCCCTGGGACCAACCGCATCCTCAGCTTCTTCCCCGAGAAATGCTGGAGCAGGCTGTTCAGACCGACGTTG
CCATCAAAACACATACACCCAGAAAGAAACAACAGAAACCAAAACTCACAAGGCGCATGATTACTTGTTTTATATTTCATGTTGGGTTTT


Top

FusionGenePPI for NACC2_NUP214


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
NACC2EPS8, NACC2, HDAC1, HDAC2, MTA1, MTA2, RBBP7, RBBP4, CHD4, MTA3, FOXP3, TRIM25NUP214ZFP36, XPO1, NUP107, NXF2, NXF1, XPO5, IPO5, G3BP1, G3BP2, RAE1, APC, HDAC4, HDAC5, HDAC9, NUP88, SMAD1, CLEC4G, SMAD2, SMAD3, SMAD4, SIRT7, RANBP2, CUL3, CUL2, NUPL2, NUP214, ACOT13, PNPT1, HSPA1L, VPS4B, S100A6, EEF1A1, STRIP1, RPL19, NDUFA7, ITGA4, SOX2, LMNA, FBXO6, CUL7, OBSL1, NUP62, CLEC11A, DDX19A, KCMF1, CFL1, CSRP1, DYNC1LI1, TRIM28, TXNDC9, NTRK1, IFI16, NUP85, NUP35, KPNB1, UBE2I, NUPL1, NUP153, SEH1L, C11orf30, CDH1, RAN, FXR2, EMILIN1, SERPINB2, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for NACC2_NUP214


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for NACC2_NUP214


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource