FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23263

FusionGeneSummary for N4BP2L2_ZAR1L

check button Fusion gene summary
Fusion gene informationFusion gene name: N4BP2L2_ZAR1L
Fusion gene ID: 23263
HgeneTgene
Gene symbol

N4BP2L2

ZAR1L

Gene ID

10443

646799

Gene nameNEDD4 binding protein 2 like 2zygote arrest 1 like
Synonyms92M18.3|CG005|CG016|PFAAP5Z3CXXC7|ZAR2
Cytomap

13q13.1

13q13.1

Type of geneprotein-codingprotein-coding
DescriptionNEDD4-binding protein 2-like 2phosphonoformate immuno-associated protein 5protein from BRCA2 regionZAR1-like proteinzinc finger, 3CxxC-type 7
Modification date2018051920180329
UniProtAcc

Q92802

A6NP61

Ensembl transtripts involved in fusion geneENST00000380121, ENST00000504114, 
ENST00000357505, ENST00000399396, 
ENST00000446957, ENST00000267068, 
ENST00000533490, ENST00000345108, 
Fusion gene scores* DoF score7 X 8 X 4=2241 X 1 X 1=1
# samples 201
** MAII scorelog2(20/224*10)=-0.163498732282879
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: N4BP2L2 [Title/Abstract] AND ZAR1L [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-AN-A04D-01AN4BP2L2chr13

33101545

-ZAR1Lchr13

32878159

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000380121ENST00000533490N4BP2L2chr13

33101545

-ZAR1Lchr13

32878159

-
intron-3CDSENST00000380121ENST00000345108N4BP2L2chr13

33101545

-ZAR1Lchr13

32878159

-
intron-3CDSENST00000504114ENST00000533490N4BP2L2chr13

33101545

-ZAR1Lchr13

32878159

-
intron-3CDSENST00000504114ENST00000345108N4BP2L2chr13

33101545

-ZAR1Lchr13

32878159

-
intron-3CDSENST00000357505ENST00000533490N4BP2L2chr13

33101545

-ZAR1Lchr13

32878159

-
intron-3CDSENST00000357505ENST00000345108N4BP2L2chr13

33101545

-ZAR1Lchr13

32878159

-
intron-3CDSENST00000399396ENST00000533490N4BP2L2chr13

33101545

-ZAR1Lchr13

32878159

-
intron-3CDSENST00000399396ENST00000345108N4BP2L2chr13

33101545

-ZAR1Lchr13

32878159

-
In-frameENST00000446957ENST00000533490N4BP2L2chr13

33101545

-ZAR1Lchr13

32878159

-
In-frameENST00000446957ENST00000345108N4BP2L2chr13

33101545

-ZAR1Lchr13

32878159

-
Frame-shiftENST00000267068ENST00000533490N4BP2L2chr13

33101545

-ZAR1Lchr13

32878159

-
Frame-shiftENST00000267068ENST00000345108N4BP2L2chr13

33101545

-ZAR1Lchr13

32878159

-

Top

FusionProtFeatures for N4BP2L2_ZAR1L


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
N4BP2L2

Q92802

ZAR1L

A6NP61


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for N4BP2L2_ZAR1L


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_N4BP2L2_ENST00000446957_chr13_33101545_-_ZAR1L_ENST00000533490_chr13_32878159_-_509aa
MSYGEIEGKFLGPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTIIDVRGHSYLQENKIKTTDLHRPLHDEMPGNR
PDVIESIDSQVLQEARPPLVSADDEIYSTSKAFIGPIYKPPEKKKRNEGRNEAHVLNGINDRGGQKEKQKFNSEKSEIDNELFQFYKEIE
ELEKEKDGFENSCKESEPSQEQFVPFYEGHNNGLLKPDEEKKDLSNKAMPSHCDYQQNLGNEPDKYPCNGQVIPTFCDTSFTSFRPEWQS
VYPFIVPYGPPLPSLNYHLNIQRFSGPPNPPSNIFQAQDDSQIQNGYYVNNCHVNWNCMTFDQNNEYTDCSENRSSVHPSGNGCSMQDRY
VSNGFCEVRERCWKDHCMDKHNGTDRFVNQQFQEEKLNKLQKLLILLRGLPGSGKTTLSRILLGQNRDGIVFSTDDYFHHQDGYRYNVNQ

>In-frame_N4BP2L2_ENST00000446957_chr13_33101545_-_ZAR1L_ENST00000345108_chr13_32878159_-_509aa
MSYGEIEGKFLGPREEVTSEPRCKKLKSTTESYVFHNHSNADFHRIQEKTGNDWVPVTIIDVRGHSYLQENKIKTTDLHRPLHDEMPGNR
PDVIESIDSQVLQEARPPLVSADDEIYSTSKAFIGPIYKPPEKKKRNEGRNEAHVLNGINDRGGQKEKQKFNSEKSEIDNELFQFYKEIE
ELEKEKDGFENSCKESEPSQEQFVPFYEGHNNGLLKPDEEKKDLSNKAMPSHCDYQQNLGNEPDKYPCNGQVIPTFCDTSFTSFRPEWQS
VYPFIVPYGPPLPSLNYHLNIQRFSGPPNPPSNIFQAQDDSQIQNGYYVNNCHVNWNCMTFDQNNEYTDCSENRSSVHPSGNGCSMQDRY
VSNGFCEVRERCWKDHCMDKHNGTDRFVNQQFQEEKLNKLQKLLILLRGLPGSGKTTLSRILLGQNRDGIVFSTDDYFHHQDGYRYNVNQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_N4BP2L2_ENST00000446957_chr13_33101545_-_ZAR1L_ENST00000533490_chr13_32878159_-_1528nt
ATGTCTTATGGTGAAATTGAAGGTAAATTCTTGGGACCTAGAGAAGAAGTAACGAGTGAGCCACGCTGTAAAAAATTGAAGTCAACCACA
GAGTCGTATGTTTTTCACAATCATAGTAATGCTGATTTTCACAGAATCCAAGAGAAAACTGGAAATGATTGGGTCCCTGTGACCATCATT
GATGTCAGAGGACATAGTTATTTGCAGGAGAACAAAATCAAAACTACAGATTTGCATAGACCTTTGCATGATGAGATGCCTGGTAATAGA
CCAGATGTTATTGAATCCATTGATTCACAGGTTTTACAGGAAGCACGTCCTCCATTAGTATCCGCAGACGATGAGATATATAGCACAAGT
AAAGCATTTATAGGACCCATTTACAAACCCCCTGAGAAAAAGAAACGTAATGAAGGGAGGAATGAGGCACATGTTCTAAATGGTATAAAT
GACAGAGGAGGACAAAAAGAGAAACAGAAATTTAACTCTGAAAAATCAGAGATTGACAATGAATTATTCCAGTTTTACAAAGAAATTGAA
GAGCTTGAAAAGGAAAAAGATGGTTTTGAGAACAGTTGTAAAGAATCTGAACCTTCTCAGGAACAATTTGTTCCATTTTATGAGGGTCAT
AATAATGGTCTCTTAAAACCTGATGAAGAAAAGAAAGATCTTAGTAATAAAGCTATGCCATCACATTGTGATTATCAGCAGAACTTGGGG
AATGAGCCAGACAAATATCCCTGTAATGGACAAGTAATACCTACATTTTGTGACACTTCATTTACTTCTTTCAGGCCTGAATGGCAGTCA
GTATATCCTTTTATAGTGCCCTATGGTCCCCCTCTTCCCAGTTTGAACTATCATTTAAACATTCAGAGATTCAGTGGTCCACCAAATCCA
CCATCAAATATTTTCCAAGCCCAAGATGACTCTCAGATACAAAATGGATATTATGTAAATAATTGTCATGTTAACTGGAATTGCATGACT
TTTGATCAGAACAATGAATATACTGACTGTAGTGAGAATAGGAGTAGTGTTCATCCCTCTGGAAATGGCTGCAGTATGCAAGATCGATAT
GTGAGTAATGGTTTCTGTGAAGTCAGAGAAAGATGCTGGAAAGATCATTGTATGGACAAGCATAATGGAACAGACAGGTTTGTGAACCAG
CAGTTTCAAGAGGAAAAGTTAAATAAATTGCAGAAGTTACTTATTCTTTTAAGAGGTCTGCCTGGTTCTGGGAAAACAACATTGTCTCGA
ATTCTGCTTGGTCAGAATCGTGATGGCATTGTGTTCAGCACTGATGACTATTTTCACCATCAAGATGGGTACAGGTATAATGTTAATCAA
CTTGGTGATGCCCATGACTGGAACCAGAACAGAGACCTGCTCAAAGTCTCATTGTTCCTGTCCTCAAAAGAAGAGACACATTGATCTAAG

>In-frame_N4BP2L2_ENST00000446957_chr13_33101545_-_ZAR1L_ENST00000345108_chr13_32878159_-_1528nt
ATGTCTTATGGTGAAATTGAAGGTAAATTCTTGGGACCTAGAGAAGAAGTAACGAGTGAGCCACGCTGTAAAAAATTGAAGTCAACCACA
GAGTCGTATGTTTTTCACAATCATAGTAATGCTGATTTTCACAGAATCCAAGAGAAAACTGGAAATGATTGGGTCCCTGTGACCATCATT
GATGTCAGAGGACATAGTTATTTGCAGGAGAACAAAATCAAAACTACAGATTTGCATAGACCTTTGCATGATGAGATGCCTGGTAATAGA
CCAGATGTTATTGAATCCATTGATTCACAGGTTTTACAGGAAGCACGTCCTCCATTAGTATCCGCAGACGATGAGATATATAGCACAAGT
AAAGCATTTATAGGACCCATTTACAAACCCCCTGAGAAAAAGAAACGTAATGAAGGGAGGAATGAGGCACATGTTCTAAATGGTATAAAT
GACAGAGGAGGACAAAAAGAGAAACAGAAATTTAACTCTGAAAAATCAGAGATTGACAATGAATTATTCCAGTTTTACAAAGAAATTGAA
GAGCTTGAAAAGGAAAAAGATGGTTTTGAGAACAGTTGTAAAGAATCTGAACCTTCTCAGGAACAATTTGTTCCATTTTATGAGGGTCAT
AATAATGGTCTCTTAAAACCTGATGAAGAAAAGAAAGATCTTAGTAATAAAGCTATGCCATCACATTGTGATTATCAGCAGAACTTGGGG
AATGAGCCAGACAAATATCCCTGTAATGGACAAGTAATACCTACATTTTGTGACACTTCATTTACTTCTTTCAGGCCTGAATGGCAGTCA
GTATATCCTTTTATAGTGCCCTATGGTCCCCCTCTTCCCAGTTTGAACTATCATTTAAACATTCAGAGATTCAGTGGTCCACCAAATCCA
CCATCAAATATTTTCCAAGCCCAAGATGACTCTCAGATACAAAATGGATATTATGTAAATAATTGTCATGTTAACTGGAATTGCATGACT
TTTGATCAGAACAATGAATATACTGACTGTAGTGAGAATAGGAGTAGTGTTCATCCCTCTGGAAATGGCTGCAGTATGCAAGATCGATAT
GTGAGTAATGGTTTCTGTGAAGTCAGAGAAAGATGCTGGAAAGATCATTGTATGGACAAGCATAATGGAACAGACAGGTTTGTGAACCAG
CAGTTTCAAGAGGAAAAGTTAAATAAATTGCAGAAGTTACTTATTCTTTTAAGAGGTCTGCCTGGTTCTGGGAAAACAACATTGTCTCGA
ATTCTGCTTGGTCAGAATCGTGATGGCATTGTGTTCAGCACTGATGACTATTTTCACCATCAAGATGGGTACAGGTATAATGTTAATCAA
CTTGGTGATGCCCATGACTGGAACCAGAACAGAGACCTGCTCAAAGTCTCATTGTTCCTGTCCTCAAAAGAAGAGACACATTGATCTAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_N4BP2L2_ENST00000446957_chr13_33101545_-_ZAR1L_ENST00000533490_chr13_32878159_-_1707nt
ATGTCTTATGGTGAAATTGAAGGTAAATTCTTGGGACCTAGAGAAGAAGTAACGAGTGAGCCACGCTGTAAAAAATTGAAGTCAACCACA
GAGTCGTATGTTTTTCACAATCATAGTAATGCTGATTTTCACAGAATCCAAGAGAAAACTGGAAATGATTGGGTCCCTGTGACCATCATT
GATGTCAGAGGACATAGTTATTTGCAGGAGAACAAAATCAAAACTACAGATTTGCATAGACCTTTGCATGATGAGATGCCTGGTAATAGA
CCAGATGTTATTGAATCCATTGATTCACAGGTTTTACAGGAAGCACGTCCTCCATTAGTATCCGCAGACGATGAGATATATAGCACAAGT
AAAGCATTTATAGGACCCATTTACAAACCCCCTGAGAAAAAGAAACGTAATGAAGGGAGGAATGAGGCACATGTTCTAAATGGTATAAAT
GACAGAGGAGGACAAAAAGAGAAACAGAAATTTAACTCTGAAAAATCAGAGATTGACAATGAATTATTCCAGTTTTACAAAGAAATTGAA
GAGCTTGAAAAGGAAAAAGATGGTTTTGAGAACAGTTGTAAAGAATCTGAACCTTCTCAGGAACAATTTGTTCCATTTTATGAGGGTCAT
AATAATGGTCTCTTAAAACCTGATGAAGAAAAGAAAGATCTTAGTAATAAAGCTATGCCATCACATTGTGATTATCAGCAGAACTTGGGG
AATGAGCCAGACAAATATCCCTGTAATGGACAAGTAATACCTACATTTTGTGACACTTCATTTACTTCTTTCAGGCCTGAATGGCAGTCA
GTATATCCTTTTATAGTGCCCTATGGTCCCCCTCTTCCCAGTTTGAACTATCATTTAAACATTCAGAGATTCAGTGGTCCACCAAATCCA
CCATCAAATATTTTCCAAGCCCAAGATGACTCTCAGATACAAAATGGATATTATGTAAATAATTGTCATGTTAACTGGAATTGCATGACT
TTTGATCAGAACAATGAATATACTGACTGTAGTGAGAATAGGAGTAGTGTTCATCCCTCTGGAAATGGCTGCAGTATGCAAGATCGATAT
GTGAGTAATGGTTTCTGTGAAGTCAGAGAAAGATGCTGGAAAGATCATTGTATGGACAAGCATAATGGAACAGACAGGTTTGTGAACCAG
CAGTTTCAAGAGGAAAAGTTAAATAAATTGCAGAAGTTACTTATTCTTTTAAGAGGTCTGCCTGGTTCTGGGAAAACAACATTGTCTCGA
ATTCTGCTTGGTCAGAATCGTGATGGCATTGTGTTCAGCACTGATGACTATTTTCACCATCAAGATGGGTACAGGTATAATGTTAATCAA
CTTGGTGATGCCCATGACTGGAACCAGAACAGAGACCTGCTCAAAGTCTCATTGTTCCTGTCCTCAAAAGAAGAGACACATTGATCTAAG
GAGGCCTCATCGACAGGAACTGTGTGGTCGCTGCAAAGACAAGAGATTCTCCTGTGGCAATATTTACAGCTTTAAATATGTGATGTGACT
TGTACAGTGTGACTTGTAATGGACCCCTGAGCTCTTCTTGTAACTTACTGTGCTGTCTTCCTTTTTTGCAACTTGGCTCTGACCTGGCAT

>In-frame_N4BP2L2_ENST00000446957_chr13_33101545_-_ZAR1L_ENST00000345108_chr13_32878159_-_1636nt
ATGTCTTATGGTGAAATTGAAGGTAAATTCTTGGGACCTAGAGAAGAAGTAACGAGTGAGCCACGCTGTAAAAAATTGAAGTCAACCACA
GAGTCGTATGTTTTTCACAATCATAGTAATGCTGATTTTCACAGAATCCAAGAGAAAACTGGAAATGATTGGGTCCCTGTGACCATCATT
GATGTCAGAGGACATAGTTATTTGCAGGAGAACAAAATCAAAACTACAGATTTGCATAGACCTTTGCATGATGAGATGCCTGGTAATAGA
CCAGATGTTATTGAATCCATTGATTCACAGGTTTTACAGGAAGCACGTCCTCCATTAGTATCCGCAGACGATGAGATATATAGCACAAGT
AAAGCATTTATAGGACCCATTTACAAACCCCCTGAGAAAAAGAAACGTAATGAAGGGAGGAATGAGGCACATGTTCTAAATGGTATAAAT
GACAGAGGAGGACAAAAAGAGAAACAGAAATTTAACTCTGAAAAATCAGAGATTGACAATGAATTATTCCAGTTTTACAAAGAAATTGAA
GAGCTTGAAAAGGAAAAAGATGGTTTTGAGAACAGTTGTAAAGAATCTGAACCTTCTCAGGAACAATTTGTTCCATTTTATGAGGGTCAT
AATAATGGTCTCTTAAAACCTGATGAAGAAAAGAAAGATCTTAGTAATAAAGCTATGCCATCACATTGTGATTATCAGCAGAACTTGGGG
AATGAGCCAGACAAATATCCCTGTAATGGACAAGTAATACCTACATTTTGTGACACTTCATTTACTTCTTTCAGGCCTGAATGGCAGTCA
GTATATCCTTTTATAGTGCCCTATGGTCCCCCTCTTCCCAGTTTGAACTATCATTTAAACATTCAGAGATTCAGTGGTCCACCAAATCCA
CCATCAAATATTTTCCAAGCCCAAGATGACTCTCAGATACAAAATGGATATTATGTAAATAATTGTCATGTTAACTGGAATTGCATGACT
TTTGATCAGAACAATGAATATACTGACTGTAGTGAGAATAGGAGTAGTGTTCATCCCTCTGGAAATGGCTGCAGTATGCAAGATCGATAT
GTGAGTAATGGTTTCTGTGAAGTCAGAGAAAGATGCTGGAAAGATCATTGTATGGACAAGCATAATGGAACAGACAGGTTTGTGAACCAG
CAGTTTCAAGAGGAAAAGTTAAATAAATTGCAGAAGTTACTTATTCTTTTAAGAGGTCTGCCTGGTTCTGGGAAAACAACATTGTCTCGA
ATTCTGCTTGGTCAGAATCGTGATGGCATTGTGTTCAGCACTGATGACTATTTTCACCATCAAGATGGGTACAGGTATAATGTTAATCAA
CTTGGTGATGCCCATGACTGGAACCAGAACAGAGACCTGCTCAAAGTCTCATTGTTCCTGTCCTCAAAAGAAGAGACACATTGATCTAAG
GAGGCCTCATCGACAGGAACTGTGTGGTCGCTGCAAAGACAAGAGATTCTCCTGTGGCAATATTTACAGCTTTAAATATGTGATGTGACT
TGTACAGTGTGACTTGTAATGGACCCCTGAGCTCTTCTTGTAACTTACTGTGCTGTCTTCCTTTTTTGCAACTTGGCTCTGACCTGGCAT


Top

FusionGenePPI for N4BP2L2_ZAR1L


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
N4BP2L2PRPF4, LGR4, HOXA1, LMO2, PPIH, NAA38, PRMT6, CGRRF1, TMPRSS5, WNT4, PRG2, PPIA, KIAA1683, SIRT6, HNRNPLL, PIGT, LYZL1, RFXANK, LGALS3BP, LYPD4, OLFM2, DNAJC10, NCAPH2, WNT16, PROZ, F11, IRAK2, NXF2ZAR1L


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for N4BP2L2_ZAR1L


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for N4BP2L2_ZAR1L


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneN4BP2L2C0037274Dermatologic disorders1CTD_human
HgeneN4BP2L2C0311375Arsenic Poisoning1CTD_human