FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 23254

FusionGeneSummary for N4BP1_NAV3

check button Fusion gene summary
Fusion gene informationFusion gene name: N4BP1_NAV3
Fusion gene ID: 23254
HgeneTgene
Gene symbol

N4BP1

NAV3

Gene ID

9683

89795

Gene nameNEDD4 binding protein 1neuron navigator 3
Synonyms-POMFIL1|STEERIN3|unc53H3
Cytomap

16q12.1

12q21.2

Type of geneprotein-codingprotein-coding
DescriptionNEDD4-binding protein 1neuron navigator 3pore membrane and/or filament interacting like protein 1unc-53 homolog 3
Modification date2018052220180523
UniProtAcc

O75113

Q8IVL0

Ensembl transtripts involved in fusion geneENST00000262384, ENST00000565423, 
ENST00000536525, ENST00000397909, 
ENST00000228327, ENST00000266692, 
ENST00000552300, ENST00000541270, 
Fusion gene scores* DoF score7 X 5 X 4=14015 X 13 X 4=780
# samples 911
** MAII scorelog2(9/140*10)=-0.637429920615292
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/780*10)=-2.82597060022495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: N4BP1 [Title/Abstract] AND NAV3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A23R-01AN4BP1chr16

48594665

-NAV3chr12

78510552

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000262384ENST00000536525N4BP1chr16

48594665

-NAV3chr12

78510552

+
In-frameENST00000262384ENST00000397909N4BP1chr16

48594665

-NAV3chr12

78510552

+
In-frameENST00000262384ENST00000228327N4BP1chr16

48594665

-NAV3chr12

78510552

+
In-frameENST00000262384ENST00000266692N4BP1chr16

48594665

-NAV3chr12

78510552

+
5CDS-intronENST00000262384ENST00000552300N4BP1chr16

48594665

-NAV3chr12

78510552

+
5CDS-intronENST00000262384ENST00000541270N4BP1chr16

48594665

-NAV3chr12

78510552

+
intron-3CDSENST00000565423ENST00000536525N4BP1chr16

48594665

-NAV3chr12

78510552

+
intron-3CDSENST00000565423ENST00000397909N4BP1chr16

48594665

-NAV3chr12

78510552

+
intron-3CDSENST00000565423ENST00000228327N4BP1chr16

48594665

-NAV3chr12

78510552

+
intron-3CDSENST00000565423ENST00000266692N4BP1chr16

48594665

-NAV3chr12

78510552

+
intron-intronENST00000565423ENST00000552300N4BP1chr16

48594665

-NAV3chr12

78510552

+
intron-intronENST00000565423ENST00000541270N4BP1chr16

48594665

-NAV3chr12

78510552

+

Top

FusionProtFeatures for N4BP1_NAV3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
N4BP1

O75113

NAV3

Q8IVL0

Inhibitor of the E3 ubiquitin-protein ligase ITCH. Actsby interacting with the second WW domain of ITCH, leading tocompete with ITCH's substrates and impairing ubiquitination ofsubstrates (By similarity). {ECO:0000250}. May regulate IL2 production by T-cells. May be involvedin neuron regeneration. {ECO:0000269|PubMed:16166283}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneNAV3chr16:48594665chr12:78510552ENST00000397909+11401562_16538782386Coiled coilOntology_term=ECO:0000255
TgeneNAV3chr16:48594665chr12:78510552ENST00000397909+11401794_18618782386Coiled coilOntology_term=ECO:0000255
TgeneNAV3chr16:48594665chr12:78510552ENST00000536525+11391562_16538782364Coiled coilOntology_term=ECO:0000255
TgeneNAV3chr16:48594665chr12:78510552ENST00000536525+11391794_18618782364Coiled coilOntology_term=ECO:0000255
TgeneNAV3chr16:48594665chr12:78510552ENST00000397909+11401032_15608782386Compositional biasNote=Ser-rich
TgeneNAV3chr16:48594665chr12:78510552ENST00000397909+11401694_16998782386Compositional biasNote=Poly-Lys
TgeneNAV3chr16:48594665chr12:78510552ENST00000397909+11401867_18858782386Compositional biasNote=Ser-rich
TgeneNAV3chr16:48594665chr12:78510552ENST00000536525+11391032_15608782364Compositional biasNote=Ser-rich
TgeneNAV3chr16:48594665chr12:78510552ENST00000536525+11391694_16998782364Compositional biasNote=Poly-Lys
TgeneNAV3chr16:48594665chr12:78510552ENST00000536525+11391867_18858782364Compositional biasNote=Ser-rich

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneNAV3chr16:48594665chr12:78510552ENST00000397909+1140679_7078782386Coiled coilOntology_term=ECO:0000255
TgeneNAV3chr16:48594665chr12:78510552ENST00000536525+1139679_7078782364Coiled coilOntology_term=ECO:0000255
TgeneNAV3chr16:48594665chr12:78510552ENST00000397909+1140618_6218782386Compositional biasNote=Poly-Gln
TgeneNAV3chr16:48594665chr12:78510552ENST00000536525+1139618_6218782364Compositional biasNote=Poly-Gln
TgeneNAV3chr16:48594665chr12:78510552ENST00000397909+114077_1848782386DomainCalponin-homology (CH)
TgeneNAV3chr16:48594665chr12:78510552ENST00000536525+113977_1848782364DomainCalponin-homology (CH)


Top

FusionGeneSequence for N4BP1_NAV3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_N4BP1_ENST00000262384_chr16_48594665_-_NAV3_ENST00000536525_chr12_78510552_+_2115aa
MAARAVLDEFTAPAEKAELLEQSRGRIEGLFGVSLAVLGALGAEEPLPARIWLQLCGAQEAVHSAKETIKGICEPELEERECYPKDMHCI
FVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKLFENKENLPSSQKESEVKREFKQFVEAHADNYTMDLLILPT
SLKKELLTLTQGEENLFETGDDEVIEMRDSQQTEFTQNAATGLNISRDETVLQEEARNKAGTPVSELTKQMDTVLSSSPDVLFDPINGLT
PDEEALSNERICQKRRFSDSEERHTKKQFSLENVQEGEILHDAKTLAGNVIADLSDSSADSENLSPDIKETTEEMEYNILVNFFKTMGYS
QEIVEKVIKVTGPSTEPLLLLEEIEKENKRFQEDREFSAGTVTPETNKTKNKGVTSSTNELTTDSTPKKTQAHTQQNMVEKFSQLPFKVE
AKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPRVPLFPENGLHQQPEPLLPNNMKS
ACEKRLGCCSSPHSKPNCSTLSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTLKIPYKLELKNEPGRTDLKHIVIDGSNVAIT
WDDSSSVSSGLSDTLDNISTDDLNTTSSVSSYSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLP
EDPEKAGQKASLSVSQTGSWRRGMSAQGGAPSRQKAGTSALKTPGKTDDAKASEKGKAPLKGSSLQRSPSDAGKSSGDEGKKPPSGIGRS
TATSSFGFKKPSGVGSSAMITSSGATITSGSATLGKIPKSAAIGGKSNAGRKTSLDGSQNQDDVVLHVSSKTTLQTRSLPRPSKSSTSGI
PGRGGHRSSTSSIDSNVSSKSAGATTSKLREPTKIGSGRSSPVTVNQTDKEKEKVAVSDSESVSLSGSPKSSPTSASACGAQGLRQPGSK
TPDIASPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSDLTTDVISLSHSL
ASSPASVHSFTSGGLVWAANMSSSSAGSKDTPSYQSMTSLHTSSESIDLPLSHHGSLSGLTTGTHEVQSLLMRTGSVRSTLSESMQLDRN
TLPKKGLRTTPSSRQANQEEGKEWLRSHSTGGLQDTGNQSPLVSPSAMSSSAAGKYHFSNLVSPTNLSQFNLPGPSMMRSNSIPAQDSSF
DLTDDSQLCGSATSLEERPRAISHSGSFRDSMEEVHGSSLSLVSSTSSLYSTAEEKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLV
AAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKAQNSAAQAAIQGALNGPDHPPKDLRIRRQHSSESVSSINSATSHSSIGSGN
DADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGDCGSASMKPSQSASAICECTEAEAEIIL
QLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPTRPPSESSSSTSSSSSRQSLGLSLNNLNI
TEAVSSDILLDDAGDATGHKDGRSVKIIVSISKGTGRAKDQKSQATLIGSIGVSGKTKWDVLDGVIRRLFKETVFRIDTSTSLGLSSDCI
ASYCIGDLIRSHNLEVPELLPCGYLVGDNNIITVNLKGVEENSLDSFVFDTLIPKPITQRYFNLLMEHHRIILSGPSGTGKTTLANKLAE
TVITKSGRKKTEDAIATFNVDHKSSKELQQTLANLAEQCSADNNGVELPVVIILDNLHHVGSLSDIFNGFLNCKYNKCPTIIGTMNQGVS
SSPNLELHHNFRWVLCANHTEPVKGFLGRTLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGPRLFLPCPMDVE
GSRVWFMDLWNTSLVPTILEAVREGLQMTGKRTPWEDPSKWVLDTTPWSSATLPQESPALLQLRPEDVGTESCTSTKEATTSKHIPQTDT

>In-frame_N4BP1_ENST00000262384_chr16_48594665_-_NAV3_ENST00000397909_chr12_78510552_+_2137aa
MAARAVLDEFTAPAEKAELLEQSRGRIEGLFGVSLAVLGALGAEEPLPARIWLQLCGAQEAVHSAKETIKGICEPELEERECYPKDMHCI
FVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKLFENKENLPSSQKESEVKREFKQFVEAHADNYTMDLLILPT
SLKKELLTLTQGEENLFETGDDEVIEMRDSQQTEFTQNAATGLNISRDETVLQEEARNKAGTPVSELTKQMDTVLSSSPDVLFDPINGLT
PDEEALSNERICQKRRFSDSEERHTKKQFSLENVQEGEILHDAKTLAGNVIADLSDSSADSENLSPDIKETTEEMEYNILVNFFKTMGYS
QEIVEKVIKVTGPSTEPLLLLEEIEKENKRFQEDREFSAGTVTPETNKTKNKGVTSSTNELTTDSTPKKTQAHTQQNMVEKFSQLPFKVE
AKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPRVPLFPENGLHQQPEPLLPNNMKS
ACEKRLGCCSSPHSKPNCSTLSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTLKIPYKLELKNEPGRTDLKHIVIDGSNVAIT
WDDSSSVSSGLSDTLDNISTDDLNTTSSVSSYSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLP
EDPEKAGQKASLSVSQTGSWRRGMSAQGGAPSRQKAGTSALKTPGKTDDAKASEKGKAPLKGSSLQRSPSDAGKSSGDEGKKPPSGIGRS
TATSSFGFKKPSGVGSSAMITSSGATITSGSATLGKIPKSAAIGGKSNAGRKTSLDGSQNQDDVVLHVSSKTTLQTRSLPRPSKSSTSGI
PGRGGHRSSTSSIDSNVSSKSAGATTSKLREPTKIGSGRSSPVTVNQTDKEKEKVAVSDSESVSLSGSPKSSPTSASACGAQGLRQPGSK
TPDIASPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSDLTTDVISLSHSL
ASSPASVHSFTSGGLVWAANMSSSSAGSKDTPSYQSMTSLHTSSESIDLPLSHHGSLSGLTTGTHEVQSLLMRTGSVRSTLSESMQLDRN
TLPKKGLRTTPSSRQANQEEGKEWLRSHSTGGLQDTGNQSPLVSPSAMSSSAAGKYHFSNLVSPTNLSQFNLPGPSMMRSNSIPAQDSSF
DLTDDSQLCGSATSLEERPRAISHSGSFRDSMEEVHGSSLSLVSSTSSLYSTAEEKAHSEQIHKLRRELVASQEKVATLTSQLSANAHLV
AAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKAQNSAAQAAIQGALNGPDHPPKDLRIRRQHSSESVSSINSATSHSSIGSGN
DADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGDCGSASMKPSQSASASPLVWPPKKRQNG
PVIYKHRSRICECTEAEAEIILQLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPTRPPSES
SSSTSSSSSRQSLGLSLNNLNITEAVSSDILLDDAGDATGHKDGRSVKIIVSISKGTGRAKDQKSQATLIGSIGVSGKTKWDVLDGVIRR
LFKETVFRIDTSTSLGLSSDCIASYCIGDLIRSHNLEVPELLPCGYLVGDNNIITVNLKGVEENSLDSFVFDTLIPKPITQRYFNLLMEH
HRIILSGPSGTGKTTLANKLAETVITKSGRKKTEDAIATFNVDHKSSKELQQTLANLAEQCSADNNGVELPVVIILDNLHHVGSLSDIFN
GFLNCKYNKCPTIIGTMNQGVSSSPNLELHHNFRWVLCANHTEPVKGFLGRTLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLE
THSSSDVTIGPRLFLPCPMDVEGSRVWFMDLWNTSLVPTILEAVREGLQMTGKRTPWEDPSKWVLDTTPWSSATLPQESPALLQLRPEDV

>In-frame_N4BP1_ENST00000262384_chr16_48594665_-_NAV3_ENST00000228327_chr12_78510552_+_2115aa
MAARAVLDEFTAPAEKAELLEQSRGRIEGLFGVSLAVLGALGAEEPLPARIWLQLCGAQEAVHSAKETIKGICEPELEERECYPKDMHCI
FVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKLFENKENLPSSQKESEVKREFKQFVEAHADNYTMDLLILPT
SLKKELLTLTQGEENLFETGDDEVIEMRDSQQTEFTQNAATGLNISRDETVLQEEARNKAGTPVSELTKQMDTVLSSSPDVLFDPINGLT
PDEEALSNERICQKRRFSDSEERHTKKQFSLENVQEGEILHDAKTLAGNVIADLSDSSADSENLSPDIKETTEEMEYNILVNFFKTMGYS
QEIVEKVIKVTGPSTEPLLLLEEIEKENKRFQEDREFSAGTVTPETNKTKNKGVTSSTNELTTDSTPKKTQAHTQQNMVEKFSQLPFKVE
AKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPRVPLFPENGLHQQPEPLLPNNMKS
ACEKRLGCCSSPHSKPNCSTLSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTLKIPYKLELKNEPGRTDLKHIVIDGSNVAIT
WDDSSSVSSGLSDTLDNISTDDLNTTSSVSSYSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLP
EDPEKAGQKASLSVSQTGSWRRGMSAQGGAPSRQKAGTSALKTPGKTDDAKASEKGKAPLKGSSLQRSPSDAGKSSGDEGKKPPSGIGRS
TATSSFGFKKPSGVGSSAMITSSGATITSGSATLGKIPKSAAIGGKSNAGRKTSLDGSQNQDDVVLHVSSKTTLQTRSLPRPSKSSTSGI
PGRGGHRSSTSSIDSNVSSKSAGATTSKLREPTKIGSGRSSPVTVNQTDKEKEKVAVSDSESVSLSGSPKSSPTSASACGAQGLRQPGSK
TPDIASPTFRRLFGAKAGGKSASAPNTEGVKSSSVMPSPSTTLARQGSLESPSSGTGSMGSAGGLSGSSSPLFNKPSDLTTDVISLSHSL
ASSPASVHSFTSGGLVWAANMSSSSAGSKDTPSYQSMTSLHTSSESIDLPLSHHGSLSGLTTGTHEVQSLLMRTGSVRSTLSESMQLDRN
TLPKKGLRTTPSSRQANQEEGKEWLRSHSTGGLQDTGNQSPLVSPSAMSSSAAGKYHFSNLVSPTNLSQFNLPGPSMMRSNSIPAQDSSF
DLTDDSQLCGSATSLEERPRAISHSGSFRDSMEEVHGSSLSLVSSTSSLYSTAEAGGSLEQIHKLRRELVASQEKVATLTSQLSANAHLV
AAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKAQNSAAQAAIQGALNGPDHPPKDLRIRRQHSSESVSSINSATSHSSIGSGN
DADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGDCGSASMKPSQSASAICECTEAEAEIIL
QLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPTRPPSESSSSTSSSSSRQSLGLSLNNLNI
TEAVSSDILLDDAGDATGHKDGRSVKIIVSISKGTGRAKDQKSQATLIGSIGVSGKTKWDVLDGVIRRLFKETVFRIDTSTSLGLSSDCI
ASYCIGDLIRSHNLEVPELLPCGYLVGDNNIITVNLKGVEENSLDSFVFDTLIPKPITQRYFNLLMEHHRIILSGPSGTGKTTLANKLAE
TVITKSGRKKTEDAIATFNVDHKSSKELQQTLANLAEQCSADNNGVELPVVIILDNLHHVGSLSDIFNGFLNCKYNKCPTIIGTMNQGVS
SSPNLELHHNFRWVLCANHTEPVKGFLGRTLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGPRLFLPCPMDVE
GSRVWFMDLWNTSLVPTILEAVREGLQMTGKRTPWEDPSKWVLDTTPWSSATLPQESPALLQLRPEDVGTESCTSTKEATTSKHIPQTDT

>In-frame_N4BP1_ENST00000262384_chr16_48594665_-_NAV3_ENST00000266692_chr12_78510552_+_1938aa
MAARAVLDEFTAPAEKAELLEQSRGRIEGLFGVSLAVLGALGAEEPLPARIWLQLCGAQEAVHSAKETIKGICEPELEERECYPKDMHCI
FVGAESLFLKSLIQDTCADLCILDIGLLGIRGSAEAVVMARSHIQQFVKLFENKENLPSSQKESEVKREFKQFVEAHADNYTMDLLILPT
SLKKELLTLTQGEENLFETGDDEVIEMRDSQQTEFTQNAATGLNISRDETVLQEEARNKAGTPVSELTKQMDTVLSSSPDVLFDPINGLT
PDEEALSNERICQKRRFSDSEERHTKKQFSLENVQEGEILHDAKTLAGNVIADLSDSSADSENLSPDIKETTEEMEYNILVNFFKTMGYS
QEIVEKVIKVTGPSTEPLLLLEEIEKENKRFQEDREFSAGTVTPETNKTKNKGVTSSTNELTTDSTPKKTQAHTQQNMVEKFSQLPFKVE
AKPCTSNCRINTFRTVPIEQKHEVWGSNQNYICNTDPETDGLSPSVASPSPKEVNFVSRGASSHQPRVPLFPENGLHQQPEPLLPNNMKS
ACEKRLGCCSSPHSKPNCSTLSPPMPLPQLLPSVTDARSAGPSDHIDSSVTGVQRFRDTLKIPYKLELKNEPGRTDLKHIVIDGSNVAIT
WDDSSSVSSGLSDTLDNISTDDLNTTSSVSSYSNITVPSRKNTQLRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLP
EDPEKAGQKASLSVSQTGSWRRGMSAQGGAPSRQKAGTSALKTPGKTDDAKASEKGKAPLKGSSLQRSPSDAGKSSGDEGKKPPSGIGRS
TATSSFGFKKPSGVGSSAMITSSGATITSGSATLGKIPKSAAIGGKSNAGRKTSLDGSQNQDDVVLHVSSKTTLQTRSLPRPSKSSTSGI
PGRGGHRSSTSSIDSNVSSKSAGATTSKLREPTKIGSGRSSPVTVNQTDKEKEKVAVSDSESVSLSGSPKSSPTSASACGAQGLRQPGSK
TPDIASPTFRRTTPSSRQANQEEGKEWLRSHSTGGLQDTGNQSPLVSPSAMSSSAAGKYHFSNLVSPTNLSQFNLPGPSMMRSNSIPAQD
SSFDLTDDSQLCGSATSLEERPRAISHSGSFRDSMEEVHGSSLSLVSSTSSLYSTAEAGGSLEQIHKLRRELVASQEKVATLTSQLSANA
HLVAAFEKSLGNMTGRLQSLTMTAEQKESELIELRETIEMLKAQNSAAQAAIQGALNGPDHPPKDLRIRRQHSSESVSSINSATSHSSIG
SGNDADSKKKKKKNWVNSRGSELRSSFKQAFGKKKSTKPPSSHSDIEELTDSSLPASPKLPHNAGDCGSASMKPSQSASAICECTEAEAE
IILQLKSELREKELKLTDIRLEALSSAHHLDQIREAMNRMQNEIEILKAENDRLKAETGNTAKPTRPPSESSSSTSSSSSRQSLGLSLNN
LNITEAVSSDILLDDAGDATGHKDGRSVKIIVSISKGTGRAKDQKSQATLIGSIGVSGKTKWDVLDGVIRRLFKETVFRIDTSTSLGLSS
DCIASYCIGDLIRSHNLEVPELLPCGYLVGDNNIITVNLKGVEENSLDSFVFDTLIPKPITQRYFNLLMEHHRIILSGPSGTGKTTLANK
LAETVITKSGRKKTEDAIATFNVDHKSSKELQQTLANLAEQCSADNNGVELPVVIILDNLHHVGSLSDIFNGFLNCKYNKCPTIIGTMNQ
GVSSSPNLELHHNFRWVLCANHTEPVKGFLGRTLRRKLIEIEIERNIRNNDLVKIIDWIPKTWHHLNSFLETHSSSDVTIGPRLFLPCPM
DVEGSRVWFMDLWNTSLVPTILEAVREGLQMTGKRTPWEDPSKWVLDTTPWSSATLPQESPALLQLRPEDVGTESCTSTKEATTSKHIPQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_N4BP1_ENST00000262384_chr16_48594665_-_NAV3_ENST00000536525_chr12_78510552_+_6345nt
ATGGCGGCCCGGGCGGTGCTGGACGAGTTCACTGCGCCAGCTGAGAAGGCGGAGCTGCTGGAGCAGAGCCGCGGCCGTATCGAGGGCCTG
TTTGGCGTGAGCCTAGCCGTGCTCGGCGCGCTAGGGGCTGAGGAGCCGCTGCCCGCGCGCATCTGGCTGCAGCTCTGCGGGGCGCAGGAG
GCGGTGCACAGCGCCAAGGAATATATTAAAGGAATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATT
TTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATC
AGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGT
CAGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACT
TCCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCT
CAACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCT
GGGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACC
CCAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCT
TTGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGAT
TCTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCC
CAAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGA
TTCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAG
CTTACAACTGATTCCACTCCAAAGAAAACACAGGCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAA
GCTAAACCATGTACCTCAAATTGTAGAATTAATACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAAC
TACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGA
GCTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCT
GCCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTG
TTACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTA
AAAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACC
TGGGATGACAGCAGTTCAGTGAGCAGTGGTCTCAGTGACACCCTTGATAACATCAGCACTGATGACCTGAACACCACATCCTCTGTCAGC
TCTTACTCCAACATCACCGTCCCCTCTAGGAAGAATACTCAGCTGAGGACAGATTCAGAGAAACGCTCCACCACAGACGAGACCTGGGAT
AGTCCTGAGGAACTGAAAAAACCAGAAGAAGATTTTGACAGCCATGGGGATGCTGGTGGCAAGTGGAAGACTGTGTCCTCTGGACTTCCT
GAAGACCCCGAGAAGGCAGGGCAGAAAGCTTCCCTGTCTGTTTCACAGACAGGTTCCTGGAGAAGAGGCATGTCTGCCCAAGGAGGGGCG
CCATCTAGGCAGAAAGCTGGAACAAGTGCACTCAAAACACCCGGGAAAACCGATGATGCCAAAGCTTCTGAGAAAGGAAAAGCTCCCCTA
AAAGGATCATCTCTACAAAGATCTCCTTCAGATGCAGGAAAAAGCAGTGGAGATGAAGGGAAAAAGCCCCCCTCAGGCATTGGAAGATCG
ACTGCCACCAGCTCCTTTGGCTTTAAGAAACCAAGTGGAGTAGGGTCATCTGCCATGATCACCAGCAGTGGAGCAACCATAACAAGTGGC
TCTGCAACACTGGGTAAAATTCCAAAATCTGCTGCCATTGGCGGGAAGTCAAATGCAGGGAGAAAAACCAGTTTGGACGGTTCACAGAAT
CAGGATGATGTTGTGCTGCATGTTAGCTCAAAGACTACCCTACAATATCGCAGCTTGCCCCGCCCTTCAAAATCCAGCACCAGTGGCATT
CCTGGCCGAGGAGGCCACAGATCCAGTACCAGCAGTATTGATTCCAACGTCAGCAGCAAGTCTGCTGGGGCCACCACCTCGAAACTGAGA
GAACCAACTAAAATTGGGTCAGGGCGCTCGAGTCCTGTCACCGTCAACCAAACAGACAAGGAAAAGGAAAAAGTAGCAGTCTCAGATTCA
GAAAGTGTTTCTTTGTCAGGTTCCCCCAAATCCAGCCCCACCTCTGCCAGCGCCTGTGGTGCACAAGGTCTCAGGCAGCCAGGATCCAAG
TATCCAGATATTGCCTCACCCACATTTCGAAGGTTGTTTGGTGCCAAGGCAGGTGGCAAATCTGCCTCTGCACCTAATACTGAGGGTGTG
AAATCTTCCTCAGTAATGCCCAGCCCTAGTACCACATTAGCGCGGCAAGGCAGTCTGGAGTCACCGTCGTCCGGTACGGGCAGCATGGGC
AGTGCTGGTGGGCTAAGCGGCAGCAGCAGCCCTCTCTTCAATAAACCCTCAGACTTAACTACAGATGTTATAAGCTTAAGTCACTCGTTG
GCCTCCAGCCCAGCATCGGTTCACTCTTTCACATCAGGTGGTCTCGTGTGGGCTGCCAATATGAGCAGTTCCTCTGCAGGCAGCAAGGAT
ACTCCGAGCTACCAGTCCATGACTAGCCTCCACACGAGCTCTGAGTCCATTGACCTCCCCCTCAGCCATCATGGCTCCTTGTCTGGACTG
ACCACAGGCACTCACGAGGTCCAGAGCCTGCTCATGAGAACGGGTAGTGTGAGATCTACTCTCTCAGAAAGCATGCAGCTTGACAGAAAT
ACACTACCCAAAAAGGGACTAAGATATACCCCATCATCTCGGCAGGCCAACCAAGAAGAGGGCAAAGAGTGGTTGCGTTCTCATTCTACT
GGAGGGCTTCAGGACACTGGCAACCAGTCACCTCTGGTTTCCCCTTCTGCCATGTCATCTTCTGCAGCTGGAAAATACCACTTTTCTAAC
TTGGTGAGCCCAACAAATTTGTCTCAGTTTAACCTTCCCGGGCCCAGCATGATGCGCTCAAACAGCATCCCAGCCCAAGACTCTTCCTTC
GATCTCTATGATGACTCCCAGCTTTGTGGGAGTGCCACTTCTCTGGAGGAAAGACCTCGTGCCATCAGTCATTCGGGCTCATTCAGAGAC
AGCATGGAAGAAGTTCATGGCTCTTCATTATCACTGGTGTCCAGCACTTCTTCTCTTTACTCTACAGCTGAAGAAAAGGCTCATTCAGAG
CAAATCCATAAACTGCGGAGAGAGCTGGTTGCATCACAAGAAAAAGTTGCTACCCTCACATCTCAGCTTTCAGCAAATGCTCACCTTGTA
GCAGCTTTTGAAAAGAGCTTAGGGAATATGACTGGCCGATTGCAAAGTCTAACTATGACAGCGGAACAAAAGGAATCTGAACTTATAGAA
CTAAGAGAAACCATTGAAATGCTGAAGGCTCAGAATTCTGCTGCCCAGGCGGCTATTCAGGGAGCACTGAATGGTCCAGACCATCCTCCC
AAAGATCTTCGCATCAGAAGACAGCATTCCTCTGAAAGTGTTTCTAGTATCAACAGTGCCACAAGCCATTCCAGTATTGGCAGTGGTAAT
GATGCCGACTCCAAGAAGAAGAAAAAGAAAAACTGGGTGAACTCTAGAGGAAGTGAGCTGAGAAGTTCTTTCAAACAAGCCTTTGGGAAG
AAAAAGTCCACCAAGCCTCCTTCATCACATTCTGACATTGAAGAGCTTACTGATTCATCCCTTCCGGCATCCCCCAAGTTACCCCATAAT
GCTGGTGACTGTGGCTCAGCATCCATGAAGCCCTCACAATCTGCTTCAGCGATCTGTGAATGCACAGAAGCTGAGGCAGAGATAATTCTG
CAGCTGAAGAGCGAGCTCAGAGAAAAGGAATTAAAATTAACGGATATTCGGCTGGAGGCCCTCAGCTCTGCTCATCATCTTGATCAGATC
CGGGAAGCCATGAACCGGATGCAGAATGAAATTGAAATACTGAAAGCTGAAAATGACCGGTTGAAGGCAGAAACTGGTAACACAGCTAAG
CCTACTCGGCCACCGTCAGAATCCTCAAGCAGCACCTCCTCTTCATCTTCCAGGCAGTCATTAGGACTTTCTCTAAACAATTTGAACATC
ACAGAGGCTGTTAGCTCAGATATTTTGCTAGATGATGCTGGTGATGCAACTGGACATAAAGATGGCCGCAGTGTGAAAATTATAGTCTCC
ATAAGCAAGGGCTATGGTCGAGCAAAGGACCAAAAATCTCAGGCATATTTGATAGGATCCATTGGTGTTAGTGGAAAAACCAAGTGGGAT
GTCTTAGATGGTGTAATAAGACGTCTCTTTAAGGAATATGTATTCCGAATTGATACATCCACTAGCCTTGGTCTGAGCTCTGACTGCATT
GCTAGCTACTGTATAGGAGACTTAATTAGATCCCATAACCTAGAAGTGCCTGAATTGCTGCCTTGTGGATACCTTGTTGGAGATAATAAC
ATCATCACTGTGAACCTCAAAGGGGTAGAAGAAAATAGTTTGGACAGTTTTGTTTTTGATACGCTGATTCCTAAACCAATTACCCAAAGG
TACTTTAACTTGTTGATGGAGCATCACAGAATTATACTCTCAGGACCGAGTGGTACTGGAAAGACCTATTTGGCAAACAAACTTGCTGAA
TATGTAATAACCAAATCTGGAAGGAAAAAAACAGAGGATGCAATTGCCACTTTTAATGTGGACCACAAGTCAAGTAAGGAATTGCAACAA
TATCTAGCTAACCTGGCTGAACAGTGCAGTGCTGATAATAATGGAGTGGAGCTCCCAGTTGTAATAATTCTTGATAATCTTCATCATGTG
GGCTCTCTGAGTGATATCTTCAATGGTTTTCTCAATTGTAAATACAACAAATGTCCATATATTATTGGAACAATGAATCAGGGAGTTTCT
TCATCACCAAATCTAGAGCTGCATCACAATTTCAGGTGGGTATTATGTGCAAATCATACAGAACCAGTGAAAGGCTTTTTAGGCAGATAT
CTTCGAAGAAAACTCATAGAGATAGAAATTGAAAGGAACATTCGCAATAATGACCTAGTCAAAATTATAGATTGGATTCCGAAGACGTGG
CATCATCTCAACAGTTTTTTGGAAACACACAGTTCTTCTGACGTTACCATTGGTCCCCGACTATTCCTTCCTTGCCCCATGGATGTAGAA
GGTTCTAGAGTATGGTTCATGGATCTCTGGAACTATTCTTTAGTACCTTATATTCTGGAGGCAGTGAGAGAGGGTCTTCAGATGTATGGG
AAACGCACACCATGGGAAGATCCTTCAAAGTGGGTGCTTGACACATATCCATGGAGCTCAGCAACTCTGCCTCAGGAGAGCCCAGCCTTA
CTTCAGCTGCGACCAGAAGATGTTGGGTATGAAAGCTGCACATCCACTAAGGAAGCCACAACCTCAAAGCACATTCCGCAAACTGACACA
GAAGGAGATCCCCTGATGAATATGCTAATGAAACTCCAAGAAGCAGCCAATTACTCGAGCACACAAAGCTGCGACAGCGAAAGCACCAGC

>In-frame_N4BP1_ENST00000262384_chr16_48594665_-_NAV3_ENST00000397909_chr12_78510552_+_6411nt
ATGGCGGCCCGGGCGGTGCTGGACGAGTTCACTGCGCCAGCTGAGAAGGCGGAGCTGCTGGAGCAGAGCCGCGGCCGTATCGAGGGCCTG
TTTGGCGTGAGCCTAGCCGTGCTCGGCGCGCTAGGGGCTGAGGAGCCGCTGCCCGCGCGCATCTGGCTGCAGCTCTGCGGGGCGCAGGAG
GCGGTGCACAGCGCCAAGGAATATATTAAAGGAATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATT
TTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATC
AGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGT
CAGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACT
TCCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCT
CAACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCT
GGGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACC
CCAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCT
TTGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGAT
TCTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCC
CAAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGA
TTCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAG
CTTACAACTGATTCCACTCCAAAGAAAACACAGGCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAA
GCTAAACCATGTACCTCAAATTGTAGAATTAATACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAAC
TACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGA
GCTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCT
GCCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTG
TTACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTA
AAAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACC
TGGGATGACAGCAGTTCAGTGAGCAGTGGTCTCAGTGACACCCTTGATAACATCAGCACTGATGACCTGAACACCACATCCTCTGTCAGC
TCTTACTCCAACATCACCGTCCCCTCTAGGAAGAATACTCAGCTGAGGACAGATTCAGAGAAACGCTCCACCACAGACGAGACCTGGGAT
AGTCCTGAGGAACTGAAAAAACCAGAAGAAGATTTTGACAGCCATGGGGATGCTGGTGGCAAGTGGAAGACTGTGTCCTCTGGACTTCCT
GAAGACCCCGAGAAGGCAGGGCAGAAAGCTTCCCTGTCTGTTTCACAGACAGGTTCCTGGAGAAGAGGCATGTCTGCCCAAGGAGGGGCG
CCATCTAGGCAGAAAGCTGGAACAAGTGCACTCAAAACACCCGGGAAAACCGATGATGCCAAAGCTTCTGAGAAAGGAAAAGCTCCCCTA
AAAGGATCATCTCTACAAAGATCTCCTTCAGATGCAGGAAAAAGCAGTGGAGATGAAGGGAAAAAGCCCCCCTCAGGCATTGGAAGATCG
ACTGCCACCAGCTCCTTTGGCTTTAAGAAACCAAGTGGAGTAGGGTCATCTGCCATGATCACCAGCAGTGGAGCAACCATAACAAGTGGC
TCTGCAACACTGGGTAAAATTCCAAAATCTGCTGCCATTGGCGGGAAGTCAAATGCAGGGAGAAAAACCAGTTTGGACGGTTCACAGAAT
CAGGATGATGTTGTGCTGCATGTTAGCTCAAAGACTACCCTACAATATCGCAGCTTGCCCCGCCCTTCAAAATCCAGCACCAGTGGCATT
CCTGGCCGAGGAGGCCACAGATCCAGTACCAGCAGTATTGATTCCAACGTCAGCAGCAAGTCTGCTGGGGCCACCACCTCGAAACTGAGA
GAACCAACTAAAATTGGGTCAGGGCGCTCGAGTCCTGTCACCGTCAACCAAACAGACAAGGAAAAGGAAAAAGTAGCAGTCTCAGATTCA
GAAAGTGTTTCTTTGTCAGGTTCCCCCAAATCCAGCCCCACCTCTGCCAGCGCCTGTGGTGCACAAGGTCTCAGGCAGCCAGGATCCAAG
TATCCAGATATTGCCTCACCCACATTTCGAAGGTTGTTTGGTGCCAAGGCAGGTGGCAAATCTGCCTCTGCACCTAATACTGAGGGTGTG
AAATCTTCCTCAGTAATGCCCAGCCCTAGTACCACATTAGCGCGGCAAGGCAGTCTGGAGTCACCGTCGTCCGGTACGGGCAGCATGGGC
AGTGCTGGTGGGCTAAGCGGCAGCAGCAGCCCTCTCTTCAATAAACCCTCAGACTTAACTACAGATGTTATAAGCTTAAGTCACTCGTTG
GCCTCCAGCCCAGCATCGGTTCACTCTTTCACATCAGGTGGTCTCGTGTGGGCTGCCAATATGAGCAGTTCCTCTGCAGGCAGCAAGGAT
ACTCCGAGCTACCAGTCCATGACTAGCCTCCACACGAGCTCTGAGTCCATTGACCTCCCCCTCAGCCATCATGGCTCCTTGTCTGGACTG
ACCACAGGCACTCACGAGGTCCAGAGCCTGCTCATGAGAACGGGTAGTGTGAGATCTACTCTCTCAGAAAGCATGCAGCTTGACAGAAAT
ACACTACCCAAAAAGGGACTAAGATATACCCCATCATCTCGGCAGGCCAACCAAGAAGAGGGCAAAGAGTGGTTGCGTTCTCATTCTACT
GGAGGGCTTCAGGACACTGGCAACCAGTCACCTCTGGTTTCCCCTTCTGCCATGTCATCTTCTGCAGCTGGAAAATACCACTTTTCTAAC
TTGGTGAGCCCAACAAATTTGTCTCAGTTTAACCTTCCCGGGCCCAGCATGATGCGCTCAAACAGCATCCCAGCCCAAGACTCTTCCTTC
GATCTCTATGATGACTCCCAGCTTTGTGGGAGTGCCACTTCTCTGGAGGAAAGACCTCGTGCCATCAGTCATTCGGGCTCATTCAGAGAC
AGCATGGAAGAAGTTCATGGCTCTTCATTATCACTGGTGTCCAGCACTTCTTCTCTTTACTCTACAGCTGAAGAAAAGGCTCATTCAGAG
CAAATCCATAAACTGCGGAGAGAGCTGGTTGCATCACAAGAAAAAGTTGCTACCCTCACATCTCAGCTTTCAGCAAATGCTCACCTTGTA
GCAGCTTTTGAAAAGAGCTTAGGGAATATGACTGGCCGATTGCAAAGTCTAACTATGACAGCGGAACAAAAGGAATCTGAACTTATAGAA
CTAAGAGAAACCATTGAAATGCTGAAGGCTCAGAATTCTGCTGCCCAGGCGGCTATTCAGGGAGCACTGAATGGTCCAGACCATCCTCCC
AAAGATCTTCGCATCAGAAGACAGCATTCCTCTGAAAGTGTTTCTAGTATCAACAGTGCCACAAGCCATTCCAGTATTGGCAGTGGTAAT
GATGCCGACTCCAAGAAGAAGAAAAAGAAAAACTGGGTGAACTCTAGAGGAAGTGAGCTGAGAAGTTCTTTCAAACAAGCCTTTGGGAAG
AAAAAGTCCACCAAGCCTCCTTCATCACATTCTGACATTGAAGAGCTTACTGATTCATCCCTTCCGGCATCCCCCAAGTTACCCCATAAT
GCTGGTGACTGTGGCTCAGCATCCATGAAGCCCTCACAATCTGCTTCAGCGTCACCCCTTGTCTGGCCACCAAAGAAACGACAAAATGGC
CCTGTGATCTACAAGCATAGATCTCGGATCTGTGAATGCACAGAAGCTGAGGCAGAGATAATTCTGCAGCTGAAGAGCGAGCTCAGAGAA
AAGGAATTAAAATTAACGGATATTCGGCTGGAGGCCCTCAGCTCTGCTCATCATCTTGATCAGATCCGGGAAGCCATGAACCGGATGCAG
AATGAAATTGAAATACTGAAAGCTGAAAATGACCGGTTGAAGGCAGAAACTGGTAACACAGCTAAGCCTACTCGGCCACCGTCAGAATCC
TCAAGCAGCACCTCCTCTTCATCTTCCAGGCAGTCATTAGGACTTTCTCTAAACAATTTGAACATCACAGAGGCTGTTAGCTCAGATATT
TTGCTAGATGATGCTGGTGATGCAACTGGACATAAAGATGGCCGCAGTGTGAAAATTATAGTCTCCATAAGCAAGGGCTATGGTCGAGCA
AAGGACCAAAAATCTCAGGCATATTTGATAGGATCCATTGGTGTTAGTGGAAAAACCAAGTGGGATGTCTTAGATGGTGTAATAAGACGT
CTCTTTAAGGAATATGTATTCCGAATTGATACATCCACTAGCCTTGGTCTGAGCTCTGACTGCATTGCTAGCTACTGTATAGGAGACTTA
ATTAGATCCCATAACCTAGAAGTGCCTGAATTGCTGCCTTGTGGATACCTTGTTGGAGATAATAACATCATCACTGTGAACCTCAAAGGG
GTAGAAGAAAATAGTTTGGACAGTTTTGTTTTTGATACGCTGATTCCTAAACCAATTACCCAAAGGTACTTTAACTTGTTGATGGAGCAT
CACAGAATTATACTCTCAGGACCGAGTGGTACTGGAAAGACCTATTTGGCAAACAAACTTGCTGAATATGTAATAACCAAATCTGGAAGG
AAAAAAACAGAGGATGCAATTGCCACTTTTAATGTGGACCACAAGTCAAGTAAGGAATTGCAACAATATCTAGCTAACCTGGCTGAACAG
TGCAGTGCTGATAATAATGGAGTGGAGCTCCCAGTTGTAATAATTCTTGATAATCTTCATCATGTGGGCTCTCTGAGTGATATCTTCAAT
GGTTTTCTCAATTGTAAATACAACAAATGTCCATATATTATTGGAACAATGAATCAGGGAGTTTCTTCATCACCAAATCTAGAGCTGCAT
CACAATTTCAGGTGGGTATTATGTGCAAATCATACAGAACCAGTGAAAGGCTTTTTAGGCAGATATCTTCGAAGAAAACTCATAGAGATA
GAAATTGAAAGGAACATTCGCAATAATGACCTAGTCAAAATTATAGATTGGATTCCGAAGACGTGGCATCATCTCAACAGTTTTTTGGAA
ACACACAGTTCTTCTGACGTTACCATTGGTCCCCGACTATTCCTTCCTTGCCCCATGGATGTAGAAGGTTCTAGAGTATGGTTCATGGAT
CTCTGGAACTATTCTTTAGTACCTTATATTCTGGAGGCAGTGAGAGAGGGTCTTCAGATGTATGGGAAACGCACACCATGGGAAGATCCT
TCAAAGTGGGTGCTTGACACATATCCATGGAGCTCAGCAACTCTGCCTCAGGAGAGCCCAGCCTTACTTCAGCTGCGACCAGAAGATGTT
GGGTATGAAAGCTGCACATCCACTAAGGAAGCCACAACCTCAAAGCACATTCCGCAAACTGACACAGAAGGAGATCCCCTGATGAATATG
CTAATGAAACTCCAAGAAGCAGCCAATTACTCGAGCACACAAAGCTGCGACAGCGAAAGCACCAGCCACCATGAAGACATTTTGGATTCA

>In-frame_N4BP1_ENST00000262384_chr16_48594665_-_NAV3_ENST00000228327_chr12_78510552_+_6345nt
ATGGCGGCCCGGGCGGTGCTGGACGAGTTCACTGCGCCAGCTGAGAAGGCGGAGCTGCTGGAGCAGAGCCGCGGCCGTATCGAGGGCCTG
TTTGGCGTGAGCCTAGCCGTGCTCGGCGCGCTAGGGGCTGAGGAGCCGCTGCCCGCGCGCATCTGGCTGCAGCTCTGCGGGGCGCAGGAG
GCGGTGCACAGCGCCAAGGAATATATTAAAGGAATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATT
TTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATC
AGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGT
CAGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACT
TCCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCT
CAACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCT
GGGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACC
CCAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCT
TTGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGAT
TCTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCC
CAAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGA
TTCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAG
CTTACAACTGATTCCACTCCAAAGAAAACACAGGCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAA
GCTAAACCATGTACCTCAAATTGTAGAATTAATACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAAC
TACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGA
GCTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCT
GCCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTG
TTACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTA
AAAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACC
TGGGATGACAGCAGTTCAGTGAGCAGTGGTCTCAGTGACACCCTTGATAACATCAGCACTGATGACCTGAACACCACATCCTCTGTCAGC
TCTTACTCCAACATCACCGTCCCCTCTAGGAAGAATACTCAGCTGAGGACAGATTCAGAGAAACGCTCCACCACAGACGAGACCTGGGAT
AGTCCTGAGGAACTGAAAAAACCAGAAGAAGATTTTGACAGCCATGGGGATGCTGGTGGCAAGTGGAAGACTGTGTCCTCTGGACTTCCT
GAAGACCCCGAGAAGGCAGGGCAGAAAGCTTCCCTGTCTGTTTCACAGACAGGTTCCTGGAGAAGAGGCATGTCTGCCCAAGGAGGGGCG
CCATCTAGGCAGAAAGCTGGAACAAGTGCACTCAAAACACCCGGGAAAACCGATGATGCCAAAGCTTCTGAGAAAGGAAAAGCTCCCCTA
AAAGGATCATCTCTACAAAGATCTCCTTCAGATGCAGGAAAAAGCAGTGGAGATGAAGGGAAAAAGCCCCCCTCAGGCATTGGAAGATCG
ACTGCCACCAGCTCCTTTGGCTTTAAGAAACCAAGTGGAGTAGGGTCATCTGCCATGATCACCAGCAGTGGAGCAACCATAACAAGTGGC
TCTGCAACACTGGGTAAAATTCCAAAATCTGCTGCCATTGGCGGGAAGTCAAATGCAGGGAGAAAAACCAGTTTGGACGGTTCACAGAAT
CAGGATGATGTTGTGCTGCATGTTAGCTCAAAGACTACCCTACAATATCGCAGCTTGCCCCGCCCTTCAAAATCCAGCACCAGTGGCATT
CCTGGCCGAGGAGGCCACAGATCCAGTACCAGCAGTATTGATTCCAACGTCAGCAGCAAGTCTGCTGGGGCCACCACCTCGAAACTGAGA
GAACCAACTAAAATTGGGTCAGGGCGCTCGAGTCCTGTCACCGTCAACCAAACAGACAAGGAAAAGGAAAAAGTAGCAGTCTCAGATTCA
GAAAGTGTTTCTTTGTCAGGTTCCCCCAAATCCAGCCCCACCTCTGCCAGCGCCTGTGGTGCACAAGGTCTCAGGCAGCCAGGATCCAAG
TATCCAGATATTGCCTCACCCACATTTCGAAGGTTGTTTGGTGCCAAGGCAGGTGGCAAATCTGCCTCTGCACCTAATACTGAGGGTGTG
AAATCTTCCTCAGTAATGCCCAGCCCTAGTACCACATTAGCGCGGCAAGGCAGTCTGGAGTCACCGTCGTCCGGTACGGGCAGCATGGGC
AGTGCTGGTGGGCTAAGCGGCAGCAGCAGCCCTCTCTTCAATAAACCCTCAGACTTAACTACAGATGTTATAAGCTTAAGTCACTCGTTG
GCCTCCAGCCCAGCATCGGTTCACTCTTTCACATCAGGTGGTCTCGTGTGGGCTGCCAATATGAGCAGTTCCTCTGCAGGCAGCAAGGAT
ACTCCGAGCTACCAGTCCATGACTAGCCTCCACACGAGCTCTGAGTCCATTGACCTCCCCCTCAGCCATCATGGCTCCTTGTCTGGACTG
ACCACAGGCACTCACGAGGTCCAGAGCCTGCTCATGAGAACGGGTAGTGTGAGATCTACTCTCTCAGAAAGCATGCAGCTTGACAGAAAT
ACACTACCCAAAAAGGGACTAAGATATACCCCATCATCTCGGCAGGCCAACCAAGAAGAGGGCAAAGAGTGGTTGCGTTCTCATTCTACT
GGAGGGCTTCAGGACACTGGCAACCAGTCACCTCTGGTTTCCCCTTCTGCCATGTCATCTTCTGCAGCTGGAAAATACCACTTTTCTAAC
TTGGTGAGCCCAACAAATTTGTCTCAGTTTAACCTTCCCGGGCCCAGCATGATGCGCTCAAACAGCATCCCAGCCCAAGACTCTTCCTTC
GATCTCTATGATGACTCCCAGCTTTGTGGGAGTGCCACTTCTCTGGAGGAAAGACCTCGTGCCATCAGTCATTCGGGCTCATTCAGAGAC
AGCATGGAAGAAGTTCATGGCTCTTCATTATCACTGGTGTCCAGCACTTCTTCTCTTTACTCTACAGCTGAGGCGGGTGGATCACTTGAG
CAAATCCATAAACTGCGGAGAGAGCTGGTTGCATCACAAGAAAAAGTTGCTACCCTCACATCTCAGCTTTCAGCAAATGCTCACCTTGTA
GCAGCTTTTGAAAAGAGCTTAGGGAATATGACTGGCCGATTGCAAAGTCTAACTATGACAGCGGAACAAAAGGAATCTGAACTTATAGAA
CTAAGAGAAACCATTGAAATGCTGAAGGCTCAGAATTCTGCTGCCCAGGCGGCTATTCAGGGAGCACTGAATGGTCCAGACCATCCTCCC
AAAGATCTTCGCATCAGAAGACAGCATTCCTCTGAAAGTGTTTCTAGTATCAACAGTGCCACAAGCCATTCCAGTATTGGCAGTGGTAAT
GATGCCGACTCCAAGAAGAAGAAAAAGAAAAACTGGGTGAACTCTAGAGGAAGTGAGCTGAGAAGTTCTTTCAAACAAGCCTTTGGGAAG
AAAAAGTCCACCAAGCCTCCTTCATCACATTCTGACATTGAAGAGCTTACTGATTCATCCCTTCCGGCATCCCCCAAGTTACCCCATAAT
GCTGGTGACTGTGGCTCAGCATCCATGAAGCCCTCACAATCTGCTTCAGCGATCTGTGAATGCACAGAAGCTGAGGCAGAGATAATTCTG
CAGCTGAAGAGCGAGCTCAGAGAAAAGGAATTAAAATTAACGGATATTCGGCTGGAGGCCCTCAGCTCTGCTCATCATCTTGATCAGATC
CGGGAAGCCATGAACCGGATGCAGAATGAAATTGAAATACTGAAAGCTGAAAATGACCGGTTGAAGGCAGAAACTGGTAACACAGCTAAG
CCTACTCGGCCACCGTCAGAATCCTCAAGCAGCACCTCCTCTTCATCTTCCAGGCAGTCATTAGGACTTTCTCTAAACAATTTGAACATC
ACAGAGGCTGTTAGCTCAGATATTTTGCTAGATGATGCTGGTGATGCAACTGGACATAAAGATGGCCGCAGTGTGAAAATTATAGTCTCC
ATAAGCAAGGGCTATGGTCGAGCAAAGGACCAAAAATCTCAGGCATATTTGATAGGATCCATTGGTGTTAGTGGAAAAACCAAGTGGGAT
GTCTTAGATGGTGTAATAAGACGTCTCTTTAAGGAATATGTATTCCGAATTGATACATCCACTAGCCTTGGTCTGAGCTCTGACTGCATT
GCTAGCTACTGTATAGGAGACTTAATTAGATCCCATAACCTAGAAGTGCCTGAATTGCTGCCTTGTGGATACCTTGTTGGAGATAATAAC
ATCATCACTGTGAACCTCAAAGGGGTAGAAGAAAATAGTTTGGACAGTTTTGTTTTTGATACGCTGATTCCTAAACCAATTACCCAAAGG
TACTTTAACTTGTTGATGGAGCATCACAGAATTATACTCTCAGGACCGAGTGGTACTGGAAAGACCTATTTGGCAAACAAACTTGCTGAA
TATGTAATAACCAAATCTGGAAGGAAAAAAACAGAGGATGCAATTGCCACTTTTAATGTGGACCACAAGTCAAGTAAGGAATTGCAACAA
TATCTAGCTAACCTGGCTGAACAGTGCAGTGCTGATAATAATGGAGTGGAGCTCCCAGTTGTAATAATTCTTGATAATCTTCATCATGTG
GGCTCTCTGAGTGATATCTTCAATGGTTTTCTCAATTGTAAATACAACAAATGTCCATATATTATTGGAACAATGAATCAGGGAGTTTCT
TCATCACCAAATCTAGAGCTGCATCACAATTTCAGGTGGGTATTATGTGCAAATCATACAGAACCAGTGAAAGGCTTTTTAGGCAGATAT
CTTCGAAGAAAACTCATAGAGATAGAAATTGAAAGGAACATTCGCAATAATGACCTAGTCAAAATTATAGATTGGATTCCGAAGACGTGG
CATCATCTCAACAGTTTTTTGGAAACACACAGTTCTTCTGACGTTACCATTGGTCCCCGACTATTCCTTCCTTGCCCCATGGATGTAGAA
GGTTCTAGAGTATGGTTCATGGATCTCTGGAACTATTCTTTAGTACCTTATATTCTGGAGGCAGTGAGAGAGGGTCTTCAGATGTATGGG
AAACGCACACCATGGGAAGATCCTTCAAAGTGGGTGCTTGACACATATCCATGGAGCTCAGCAACTCTGCCTCAGGAGAGCCCAGCCTTA
CTTCAGCTGCGACCAGAAGATGTTGGGTATGAAAGCTGCACATCCACTAAGGAAGCCACAACCTCAAAGCACATTCCGCAAACTGACACA
GAAGGAGATCCCCTGATGAATATGCTAATGAAACTCCAAGAAGCAGCCAATTACTCGAGCACACAAAGCTGCGACAGCGAAAGCACCAGC

>In-frame_N4BP1_ENST00000262384_chr16_48594665_-_NAV3_ENST00000266692_chr12_78510552_+_5814nt
ATGGCGGCCCGGGCGGTGCTGGACGAGTTCACTGCGCCAGCTGAGAAGGCGGAGCTGCTGGAGCAGAGCCGCGGCCGTATCGAGGGCCTG
TTTGGCGTGAGCCTAGCCGTGCTCGGCGCGCTAGGGGCTGAGGAGCCGCTGCCCGCGCGCATCTGGCTGCAGCTCTGCGGGGCGCAGGAG
GCGGTGCACAGCGCCAAGGAATATATTAAAGGAATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATT
TTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGCTTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATC
AGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGGAGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGT
CAGAAAGAATCAGAGGTGAAAAGGGAATTCAAACAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACT
TCCTTGAAAAAAGAACTTTTGACACTCACACAAGGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCT
CAACAAACAGAGTTTACACAGAATGCTGCCACAGGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCT
GGGACTCCTGTTTCTGAGCTTACAAAACAAATGGACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACC
CCAGATGAAGAGGCACTTTCCAATGAGAGAATTTGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCT
TTGGAAAATGTTCAGGAGGGGGAGATTTTACACGATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGAT
TCTGAAAATTTAAGTCCAGATATAAAAGAAACTACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCC
CAAGAAATTGTTGAAAAGGTCATTAAGGTGTATGGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGA
TTCCAAGAAGACAGAGAATTTTCAGCTGGTACAGTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAG
CTTACAACTGATTCCACTCCAAAGAAAACACAGGCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAA
GCTAAACCATGTACCTCAAATTGTAGAATTAATACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAAC
TACATTTGTAACACAGACCCTGAAACTGATGGCCTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGA
GCTTCAAGTCACCAGCCCAGAGTTCCACTTTTTCCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCT
GCCTGTGAAAAACGTTTAGGATGTTGTAGTTCTCCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTG
TTACCTTCGGTTACTGATGCAAGGTCGGCAGGACCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTA
AAAATACCCTACAAGCTGGAATTAAAAAATGAACCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACC
TGGGATGACAGCAGTTCAGTGAGCAGTGGTCTCAGTGACACCCTTGATAACATCAGCACTGATGACCTGAACACCACATCCTCTGTCAGC
TCTTACTCCAACATCACCGTCCCCTCTAGGAAGAATACTCAGCTGAGGACAGATTCAGAGAAACGCTCCACCACAGACGAGACCTGGGAT
AGTCCTGAGGAACTGAAAAAACCAGAAGAAGATTTTGACAGCCATGGGGATGCTGGTGGCAAGTGGAAGACTGTGTCCTCTGGACTTCCT
GAAGACCCCGAGAAGGCAGGGCAGAAAGCTTCCCTGTCTGTTTCACAGACAGGTTCCTGGAGAAGAGGCATGTCTGCCCAAGGAGGGGCG
CCATCTAGGCAGAAAGCTGGAACAAGTGCACTCAAAACACCCGGGAAAACCGATGATGCCAAAGCTTCTGAGAAAGGAAAAGCTCCCCTA
AAAGGATCATCTCTACAAAGATCTCCTTCAGATGCAGGAAAAAGCAGTGGAGATGAAGGGAAAAAGCCCCCCTCAGGCATTGGAAGATCG
ACTGCCACCAGCTCCTTTGGCTTTAAGAAACCAAGTGGAGTAGGGTCATCTGCCATGATCACCAGCAGTGGAGCAACCATAACAAGTGGC
TCTGCAACACTGGGTAAAATTCCAAAATCTGCTGCCATTGGCGGGAAGTCAAATGCAGGGAGAAAAACCAGTTTGGACGGTTCACAGAAT
CAGGATGATGTTGTGCTGCATGTTAGCTCAAAGACTACCCTACAATATCGCAGCTTGCCCCGCCCTTCAAAATCCAGCACCAGTGGCATT
CCTGGCCGAGGAGGCCACAGATCCAGTACCAGCAGTATTGATTCCAACGTCAGCAGCAAGTCTGCTGGGGCCACCACCTCGAAACTGAGA
GAACCAACTAAAATTGGGTCAGGGCGCTCGAGTCCTGTCACCGTCAACCAAACAGACAAGGAAAAGGAAAAAGTAGCAGTCTCAGATTCA
GAAAGTGTTTCTTTGTCAGGTTCCCCCAAATCCAGCCCCACCTCTGCCAGCGCCTGTGGTGCACAAGGTCTCAGGCAGCCAGGATCCAAG
TATCCAGATATTGCCTCACCCACATTTCGAAGATATACCCCATCATCTCGGCAGGCCAACCAAGAAGAGGGCAAAGAGTGGTTGCGTTCT
CATTCTACTGGAGGGCTTCAGGACACTGGCAACCAGTCACCTCTGGTTTCCCCTTCTGCCATGTCATCTTCTGCAGCTGGAAAATACCAC
TTTTCTAACTTGGTGAGCCCAACAAATTTGTCTCAGTTTAACCTTCCCGGGCCCAGCATGATGCGCTCAAACAGCATCCCAGCCCAAGAC
TCTTCCTTCGATCTCTATGATGACTCCCAGCTTTGTGGGAGTGCCACTTCTCTGGAGGAAAGACCTCGTGCCATCAGTCATTCGGGCTCA
TTCAGAGACAGCATGGAAGAAGTTCATGGCTCTTCATTATCACTGGTGTCCAGCACTTCTTCTCTTTACTCTACAGCTGAGGCGGGTGGA
TCACTTGAGCAAATCCATAAACTGCGGAGAGAGCTGGTTGCATCACAAGAAAAAGTTGCTACCCTCACATCTCAGCTTTCAGCAAATGCT
CACCTTGTAGCAGCTTTTGAAAAGAGCTTAGGGAATATGACTGGCCGATTGCAAAGTCTAACTATGACAGCGGAACAAAAGGAATCTGAA
CTTATAGAACTAAGAGAAACCATTGAAATGCTGAAGGCTCAGAATTCTGCTGCCCAGGCGGCTATTCAGGGAGCACTGAATGGTCCAGAC
CATCCTCCCAAAGATCTTCGCATCAGAAGACAGCATTCCTCTGAAAGTGTTTCTAGTATCAACAGTGCCACAAGCCATTCCAGTATTGGC
AGTGGTAATGATGCCGACTCCAAGAAGAAGAAAAAGAAAAACTGGGTGAACTCTAGAGGAAGTGAGCTGAGAAGTTCTTTCAAACAAGCC
TTTGGGAAGAAAAAGTCCACCAAGCCTCCTTCATCACATTCTGACATTGAAGAGCTTACTGATTCATCCCTTCCGGCATCCCCCAAGTTA
CCCCATAATGCTGGTGACTGTGGCTCAGCATCCATGAAGCCCTCACAATCTGCTTCAGCGATCTGTGAATGCACAGAAGCTGAGGCAGAG
ATAATTCTGCAGCTGAAGAGCGAGCTCAGAGAAAAGGAATTAAAATTAACGGATATTCGGCTGGAGGCCCTCAGCTCTGCTCATCATCTT
GATCAGATCCGGGAAGCCATGAACCGGATGCAGAATGAAATTGAAATACTGAAAGCTGAAAATGACCGGTTGAAGGCAGAAACTGGTAAC
ACAGCTAAGCCTACTCGGCCACCGTCAGAATCCTCAAGCAGCACCTCCTCTTCATCTTCCAGGCAGTCATTAGGACTTTCTCTAAACAAT
TTGAACATCACAGAGGCTGTTAGCTCAGATATTTTGCTAGATGATGCTGGTGATGCAACTGGACATAAAGATGGCCGCAGTGTGAAAATT
ATAGTCTCCATAAGCAAGGGCTATGGTCGAGCAAAGGACCAAAAATCTCAGGCATATTTGATAGGATCCATTGGTGTTAGTGGAAAAACC
AAGTGGGATGTCTTAGATGGTGTAATAAGACGTCTCTTTAAGGAATATGTATTCCGAATTGATACATCCACTAGCCTTGGTCTGAGCTCT
GACTGCATTGCTAGCTACTGTATAGGAGACTTAATTAGATCCCATAACCTAGAAGTGCCTGAATTGCTGCCTTGTGGATACCTTGTTGGA
GATAATAACATCATCACTGTGAACCTCAAAGGGGTAGAAGAAAATAGTTTGGACAGTTTTGTTTTTGATACGCTGATTCCTAAACCAATT
ACCCAAAGGTACTTTAACTTGTTGATGGAGCATCACAGAATTATACTCTCAGGACCGAGTGGTACTGGAAAGACCTATTTGGCAAACAAA
CTTGCTGAATATGTAATAACCAAATCTGGAAGGAAAAAAACAGAGGATGCAATTGCCACTTTTAATGTGGACCACAAGTCAAGTAAGGAA
TTGCAACAATATCTAGCTAACCTGGCTGAACAGTGCAGTGCTGATAATAATGGAGTGGAGCTCCCAGTTGTAATAATTCTTGATAATCTT
CATCATGTGGGCTCTCTGAGTGATATCTTCAATGGTTTTCTCAATTGTAAATACAACAAATGTCCATATATTATTGGAACAATGAATCAG
GGAGTTTCTTCATCACCAAATCTAGAGCTGCATCACAATTTCAGGTGGGTATTATGTGCAAATCATACAGAACCAGTGAAAGGCTTTTTA
GGCAGATATCTTCGAAGAAAACTCATAGAGATAGAAATTGAAAGGAACATTCGCAATAATGACCTAGTCAAAATTATAGATTGGATTCCG
AAGACGTGGCATCATCTCAACAGTTTTTTGGAAACACACAGTTCTTCTGACGTTACCATTGGTCCCCGACTATTCCTTCCTTGCCCCATG
GATGTAGAAGGTTCTAGAGTATGGTTCATGGATCTCTGGAACTATTCTTTAGTACCTTATATTCTGGAGGCAGTGAGAGAGGGTCTTCAG
ATGTATGGGAAACGCACACCATGGGAAGATCCTTCAAAGTGGGTGCTTGACACATATCCATGGAGCTCAGCAACTCTGCCTCAGGAGAGC
CCAGCCTTACTTCAGCTGCGACCAGAAGATGTTGGGTATGAAAGCTGCACATCCACTAAGGAAGCCACAACCTCAAAGCACATTCCGCAA
ACTGACACAGAAGGAGATCCCCTGATGAATATGCTAATGAAACTCCAAGAAGCAGCCAATTACTCGAGCACACAAAGCTGCGACAGCGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_N4BP1_ENST00000262384_chr16_48594665_-_NAV3_ENST00000536525_chr12_78510552_+_6703nt
GGCCCGGCCCGCGGCGGCGGCAAAGGGGCGGAGGGGTTCGCTGCCAGCAATTGCCAAGCTGCTGCGGTCGTGGCGGGATGGTATAGCCGG
GCCTGAGGGCGGGCGGCGGGGCGCGGGCGGGGGCGAGGCGGCCGGGAAGGGCCGACGCCGCCTGACTGGCTTGGGAGCAGCGGCAGCAAG
CTGAGGGGGCGTCGCCGCCGCCGGCCCCCGGCGCCGCCGCGGGAGGCCGCGCCCGCCATGGCGGCCCGGGCGGTGCTGGACGAGTTCACT
GCGCCAGCTGAGAAGGCGGAGCTGCTGGAGCAGAGCCGCGGCCGTATCGAGGGCCTGTTTGGCGTGAGCCTAGCCGTGCTCGGCGCGCTA
GGGGCTGAGGAGCCGCTGCCCGCGCGCATCTGGCTGCAGCTCTGCGGGGCGCAGGAGGCGGTGCACAGCGCCAAGGAATATATTAAAGGA
ATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATTTTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGC
TTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATCAGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGG
AGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGTCAGAAAGAATCAGAGGTGAAAAGGGAATTCAAA
CAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACTTCCTTGAAAAAAGAACTTTTGACACTCACACAA
GGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCTCAACAAACAGAGTTTACACAGAATGCTGCCACA
GGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTGGGACTCCTGTTTCTGAGCTTACAAAACAAATG
GACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACCCCAGATGAAGAGGCACTTTCCAATGAGAGAATT
TGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCTTTGGAAAATGTTCAGGAGGGGGAGATTTTACAC
GATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGATTCTGAAAATTTAAGTCCAGATATAAAAGAAACT
ACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCCCAAGAAATTGTTGAAAAGGTCATTAAGGTGTAT
GGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGATTCCAAGAAGACAGAGAATTTTCAGCTGGTACA
GTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAGCTTACAACTGATTCCACTCCAAAGAAAACACAG
GCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAAGCTAAACCATGTACCTCAAATTGTAGAATTAAT
ACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAACTACATTTGTAACACAGACCCTGAAACTGATGGC
CTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAGCTTCAAGTCACCAGCCCAGAGTTCCACTTTTT
CCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCTGCCTGTGAAAAACGTTTAGGATGTTGTAGTTCT
CCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTGTTACCTTCGGTTACTGATGCAAGGTCGGCAGGA
CCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTAAAAATACCCTACAAGCTGGAATTAAAAAATGAA
CCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACCTGGGATGACAGCAGTTCAGTGAGCAGTGGTCTC
AGTGACACCCTTGATAACATCAGCACTGATGACCTGAACACCACATCCTCTGTCAGCTCTTACTCCAACATCACCGTCCCCTCTAGGAAG
AATACTCAGCTGAGGACAGATTCAGAGAAACGCTCCACCACAGACGAGACCTGGGATAGTCCTGAGGAACTGAAAAAACCAGAAGAAGAT
TTTGACAGCCATGGGGATGCTGGTGGCAAGTGGAAGACTGTGTCCTCTGGACTTCCTGAAGACCCCGAGAAGGCAGGGCAGAAAGCTTCC
CTGTCTGTTTCACAGACAGGTTCCTGGAGAAGAGGCATGTCTGCCCAAGGAGGGGCGCCATCTAGGCAGAAAGCTGGAACAAGTGCACTC
AAAACACCCGGGAAAACCGATGATGCCAAAGCTTCTGAGAAAGGAAAAGCTCCCCTAAAAGGATCATCTCTACAAAGATCTCCTTCAGAT
GCAGGAAAAAGCAGTGGAGATGAAGGGAAAAAGCCCCCCTCAGGCATTGGAAGATCGACTGCCACCAGCTCCTTTGGCTTTAAGAAACCA
AGTGGAGTAGGGTCATCTGCCATGATCACCAGCAGTGGAGCAACCATAACAAGTGGCTCTGCAACACTGGGTAAAATTCCAAAATCTGCT
GCCATTGGCGGGAAGTCAAATGCAGGGAGAAAAACCAGTTTGGACGGTTCACAGAATCAGGATGATGTTGTGCTGCATGTTAGCTCAAAG
ACTACCCTACAATATCGCAGCTTGCCCCGCCCTTCAAAATCCAGCACCAGTGGCATTCCTGGCCGAGGAGGCCACAGATCCAGTACCAGC
AGTATTGATTCCAACGTCAGCAGCAAGTCTGCTGGGGCCACCACCTCGAAACTGAGAGAACCAACTAAAATTGGGTCAGGGCGCTCGAGT
CCTGTCACCGTCAACCAAACAGACAAGGAAAAGGAAAAAGTAGCAGTCTCAGATTCAGAAAGTGTTTCTTTGTCAGGTTCCCCCAAATCC
AGCCCCACCTCTGCCAGCGCCTGTGGTGCACAAGGTCTCAGGCAGCCAGGATCCAAGTATCCAGATATTGCCTCACCCACATTTCGAAGG
TTGTTTGGTGCCAAGGCAGGTGGCAAATCTGCCTCTGCACCTAATACTGAGGGTGTGAAATCTTCCTCAGTAATGCCCAGCCCTAGTACC
ACATTAGCGCGGCAAGGCAGTCTGGAGTCACCGTCGTCCGGTACGGGCAGCATGGGCAGTGCTGGTGGGCTAAGCGGCAGCAGCAGCCCT
CTCTTCAATAAACCCTCAGACTTAACTACAGATGTTATAAGCTTAAGTCACTCGTTGGCCTCCAGCCCAGCATCGGTTCACTCTTTCACA
TCAGGTGGTCTCGTGTGGGCTGCCAATATGAGCAGTTCCTCTGCAGGCAGCAAGGATACTCCGAGCTACCAGTCCATGACTAGCCTCCAC
ACGAGCTCTGAGTCCATTGACCTCCCCCTCAGCCATCATGGCTCCTTGTCTGGACTGACCACAGGCACTCACGAGGTCCAGAGCCTGCTC
ATGAGAACGGGTAGTGTGAGATCTACTCTCTCAGAAAGCATGCAGCTTGACAGAAATACACTACCCAAAAAGGGACTAAGATATACCCCA
TCATCTCGGCAGGCCAACCAAGAAGAGGGCAAAGAGTGGTTGCGTTCTCATTCTACTGGAGGGCTTCAGGACACTGGCAACCAGTCACCT
CTGGTTTCCCCTTCTGCCATGTCATCTTCTGCAGCTGGAAAATACCACTTTTCTAACTTGGTGAGCCCAACAAATTTGTCTCAGTTTAAC
CTTCCCGGGCCCAGCATGATGCGCTCAAACAGCATCCCAGCCCAAGACTCTTCCTTCGATCTCTATGATGACTCCCAGCTTTGTGGGAGT
GCCACTTCTCTGGAGGAAAGACCTCGTGCCATCAGTCATTCGGGCTCATTCAGAGACAGCATGGAAGAAGTTCATGGCTCTTCATTATCA
CTGGTGTCCAGCACTTCTTCTCTTTACTCTACAGCTGAAGAAAAGGCTCATTCAGAGCAAATCCATAAACTGCGGAGAGAGCTGGTTGCA
TCACAAGAAAAAGTTGCTACCCTCACATCTCAGCTTTCAGCAAATGCTCACCTTGTAGCAGCTTTTGAAAAGAGCTTAGGGAATATGACT
GGCCGATTGCAAAGTCTAACTATGACAGCGGAACAAAAGGAATCTGAACTTATAGAACTAAGAGAAACCATTGAAATGCTGAAGGCTCAG
AATTCTGCTGCCCAGGCGGCTATTCAGGGAGCACTGAATGGTCCAGACCATCCTCCCAAAGATCTTCGCATCAGAAGACAGCATTCCTCT
GAAAGTGTTTCTAGTATCAACAGTGCCACAAGCCATTCCAGTATTGGCAGTGGTAATGATGCCGACTCCAAGAAGAAGAAAAAGAAAAAC
TGGGTGAACTCTAGAGGAAGTGAGCTGAGAAGTTCTTTCAAACAAGCCTTTGGGAAGAAAAAGTCCACCAAGCCTCCTTCATCACATTCT
GACATTGAAGAGCTTACTGATTCATCCCTTCCGGCATCCCCCAAGTTACCCCATAATGCTGGTGACTGTGGCTCAGCATCCATGAAGCCC
TCACAATCTGCTTCAGCGATCTGTGAATGCACAGAAGCTGAGGCAGAGATAATTCTGCAGCTGAAGAGCGAGCTCAGAGAAAAGGAATTA
AAATTAACGGATATTCGGCTGGAGGCCCTCAGCTCTGCTCATCATCTTGATCAGATCCGGGAAGCCATGAACCGGATGCAGAATGAAATT
GAAATACTGAAAGCTGAAAATGACCGGTTGAAGGCAGAAACTGGTAACACAGCTAAGCCTACTCGGCCACCGTCAGAATCCTCAAGCAGC
ACCTCCTCTTCATCTTCCAGGCAGTCATTAGGACTTTCTCTAAACAATTTGAACATCACAGAGGCTGTTAGCTCAGATATTTTGCTAGAT
GATGCTGGTGATGCAACTGGACATAAAGATGGCCGCAGTGTGAAAATTATAGTCTCCATAAGCAAGGGCTATGGTCGAGCAAAGGACCAA
AAATCTCAGGCATATTTGATAGGATCCATTGGTGTTAGTGGAAAAACCAAGTGGGATGTCTTAGATGGTGTAATAAGACGTCTCTTTAAG
GAATATGTATTCCGAATTGATACATCCACTAGCCTTGGTCTGAGCTCTGACTGCATTGCTAGCTACTGTATAGGAGACTTAATTAGATCC
CATAACCTAGAAGTGCCTGAATTGCTGCCTTGTGGATACCTTGTTGGAGATAATAACATCATCACTGTGAACCTCAAAGGGGTAGAAGAA
AATAGTTTGGACAGTTTTGTTTTTGATACGCTGATTCCTAAACCAATTACCCAAAGGTACTTTAACTTGTTGATGGAGCATCACAGAATT
ATACTCTCAGGACCGAGTGGTACTGGAAAGACCTATTTGGCAAACAAACTTGCTGAATATGTAATAACCAAATCTGGAAGGAAAAAAACA
GAGGATGCAATTGCCACTTTTAATGTGGACCACAAGTCAAGTAAGGAATTGCAACAATATCTAGCTAACCTGGCTGAACAGTGCAGTGCT
GATAATAATGGAGTGGAGCTCCCAGTTGTAATAATTCTTGATAATCTTCATCATGTGGGCTCTCTGAGTGATATCTTCAATGGTTTTCTC
AATTGTAAATACAACAAATGTCCATATATTATTGGAACAATGAATCAGGGAGTTTCTTCATCACCAAATCTAGAGCTGCATCACAATTTC
AGGTGGGTATTATGTGCAAATCATACAGAACCAGTGAAAGGCTTTTTAGGCAGATATCTTCGAAGAAAACTCATAGAGATAGAAATTGAA
AGGAACATTCGCAATAATGACCTAGTCAAAATTATAGATTGGATTCCGAAGACGTGGCATCATCTCAACAGTTTTTTGGAAACACACAGT
TCTTCTGACGTTACCATTGGTCCCCGACTATTCCTTCCTTGCCCCATGGATGTAGAAGGTTCTAGAGTATGGTTCATGGATCTCTGGAAC
TATTCTTTAGTACCTTATATTCTGGAGGCAGTGAGAGAGGGTCTTCAGATGTATGGGAAACGCACACCATGGGAAGATCCTTCAAAGTGG
GTGCTTGACACATATCCATGGAGCTCAGCAACTCTGCCTCAGGAGAGCCCAGCCTTACTTCAGCTGCGACCAGAAGATGTTGGGTATGAA
AGCTGCACATCCACTAAGGAAGCCACAACCTCAAAGCACATTCCGCAAACTGACACAGAAGGAGATCCCCTGATGAATATGCTAATGAAA
CTCCAAGAAGCAGCCAATTACTCGAGCACACAAAGCTGCGACAGCGAAAGCACCAGCCACCATGAAGACATTTTGGATTCATCTCTTGAA
TCTACCCTCTAGAGGGTGAAAAAAGTTAAGGGAAAAGACTTTGCTTTTAAAAAAATGTTTCAAAAGAAAGGTATTTTCACTAAACCACTG

>In-frame_N4BP1_ENST00000262384_chr16_48594665_-_NAV3_ENST00000397909_chr12_78510552_+_9138nt
GGCCCGGCCCGCGGCGGCGGCAAAGGGGCGGAGGGGTTCGCTGCCAGCAATTGCCAAGCTGCTGCGGTCGTGGCGGGATGGTATAGCCGG
GCCTGAGGGCGGGCGGCGGGGCGCGGGCGGGGGCGAGGCGGCCGGGAAGGGCCGACGCCGCCTGACTGGCTTGGGAGCAGCGGCAGCAAG
CTGAGGGGGCGTCGCCGCCGCCGGCCCCCGGCGCCGCCGCGGGAGGCCGCGCCCGCCATGGCGGCCCGGGCGGTGCTGGACGAGTTCACT
GCGCCAGCTGAGAAGGCGGAGCTGCTGGAGCAGAGCCGCGGCCGTATCGAGGGCCTGTTTGGCGTGAGCCTAGCCGTGCTCGGCGCGCTA
GGGGCTGAGGAGCCGCTGCCCGCGCGCATCTGGCTGCAGCTCTGCGGGGCGCAGGAGGCGGTGCACAGCGCCAAGGAATATATTAAAGGA
ATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATTTTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGC
TTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATCAGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGG
AGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGTCAGAAAGAATCAGAGGTGAAAAGGGAATTCAAA
CAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACTTCCTTGAAAAAAGAACTTTTGACACTCACACAA
GGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCTCAACAAACAGAGTTTACACAGAATGCTGCCACA
GGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTGGGACTCCTGTTTCTGAGCTTACAAAACAAATG
GACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACCCCAGATGAAGAGGCACTTTCCAATGAGAGAATT
TGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCTTTGGAAAATGTTCAGGAGGGGGAGATTTTACAC
GATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGATTCTGAAAATTTAAGTCCAGATATAAAAGAAACT
ACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCCCAAGAAATTGTTGAAAAGGTCATTAAGGTGTAT
GGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGATTCCAAGAAGACAGAGAATTTTCAGCTGGTACA
GTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAGCTTACAACTGATTCCACTCCAAAGAAAACACAG
GCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAAGCTAAACCATGTACCTCAAATTGTAGAATTAAT
ACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAACTACATTTGTAACACAGACCCTGAAACTGATGGC
CTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAGCTTCAAGTCACCAGCCCAGAGTTCCACTTTTT
CCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCTGCCTGTGAAAAACGTTTAGGATGTTGTAGTTCT
CCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTGTTACCTTCGGTTACTGATGCAAGGTCGGCAGGA
CCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTAAAAATACCCTACAAGCTGGAATTAAAAAATGAA
CCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACCTGGGATGACAGCAGTTCAGTGAGCAGTGGTCTC
AGTGACACCCTTGATAACATCAGCACTGATGACCTGAACACCACATCCTCTGTCAGCTCTTACTCCAACATCACCGTCCCCTCTAGGAAG
AATACTCAGCTGAGGACAGATTCAGAGAAACGCTCCACCACAGACGAGACCTGGGATAGTCCTGAGGAACTGAAAAAACCAGAAGAAGAT
TTTGACAGCCATGGGGATGCTGGTGGCAAGTGGAAGACTGTGTCCTCTGGACTTCCTGAAGACCCCGAGAAGGCAGGGCAGAAAGCTTCC
CTGTCTGTTTCACAGACAGGTTCCTGGAGAAGAGGCATGTCTGCCCAAGGAGGGGCGCCATCTAGGCAGAAAGCTGGAACAAGTGCACTC
AAAACACCCGGGAAAACCGATGATGCCAAAGCTTCTGAGAAAGGAAAAGCTCCCCTAAAAGGATCATCTCTACAAAGATCTCCTTCAGAT
GCAGGAAAAAGCAGTGGAGATGAAGGGAAAAAGCCCCCCTCAGGCATTGGAAGATCGACTGCCACCAGCTCCTTTGGCTTTAAGAAACCA
AGTGGAGTAGGGTCATCTGCCATGATCACCAGCAGTGGAGCAACCATAACAAGTGGCTCTGCAACACTGGGTAAAATTCCAAAATCTGCT
GCCATTGGCGGGAAGTCAAATGCAGGGAGAAAAACCAGTTTGGACGGTTCACAGAATCAGGATGATGTTGTGCTGCATGTTAGCTCAAAG
ACTACCCTACAATATCGCAGCTTGCCCCGCCCTTCAAAATCCAGCACCAGTGGCATTCCTGGCCGAGGAGGCCACAGATCCAGTACCAGC
AGTATTGATTCCAACGTCAGCAGCAAGTCTGCTGGGGCCACCACCTCGAAACTGAGAGAACCAACTAAAATTGGGTCAGGGCGCTCGAGT
CCTGTCACCGTCAACCAAACAGACAAGGAAAAGGAAAAAGTAGCAGTCTCAGATTCAGAAAGTGTTTCTTTGTCAGGTTCCCCCAAATCC
AGCCCCACCTCTGCCAGCGCCTGTGGTGCACAAGGTCTCAGGCAGCCAGGATCCAAGTATCCAGATATTGCCTCACCCACATTTCGAAGG
TTGTTTGGTGCCAAGGCAGGTGGCAAATCTGCCTCTGCACCTAATACTGAGGGTGTGAAATCTTCCTCAGTAATGCCCAGCCCTAGTACC
ACATTAGCGCGGCAAGGCAGTCTGGAGTCACCGTCGTCCGGTACGGGCAGCATGGGCAGTGCTGGTGGGCTAAGCGGCAGCAGCAGCCCT
CTCTTCAATAAACCCTCAGACTTAACTACAGATGTTATAAGCTTAAGTCACTCGTTGGCCTCCAGCCCAGCATCGGTTCACTCTTTCACA
TCAGGTGGTCTCGTGTGGGCTGCCAATATGAGCAGTTCCTCTGCAGGCAGCAAGGATACTCCGAGCTACCAGTCCATGACTAGCCTCCAC
ACGAGCTCTGAGTCCATTGACCTCCCCCTCAGCCATCATGGCTCCTTGTCTGGACTGACCACAGGCACTCACGAGGTCCAGAGCCTGCTC
ATGAGAACGGGTAGTGTGAGATCTACTCTCTCAGAAAGCATGCAGCTTGACAGAAATACACTACCCAAAAAGGGACTAAGATATACCCCA
TCATCTCGGCAGGCCAACCAAGAAGAGGGCAAAGAGTGGTTGCGTTCTCATTCTACTGGAGGGCTTCAGGACACTGGCAACCAGTCACCT
CTGGTTTCCCCTTCTGCCATGTCATCTTCTGCAGCTGGAAAATACCACTTTTCTAACTTGGTGAGCCCAACAAATTTGTCTCAGTTTAAC
CTTCCCGGGCCCAGCATGATGCGCTCAAACAGCATCCCAGCCCAAGACTCTTCCTTCGATCTCTATGATGACTCCCAGCTTTGTGGGAGT
GCCACTTCTCTGGAGGAAAGACCTCGTGCCATCAGTCATTCGGGCTCATTCAGAGACAGCATGGAAGAAGTTCATGGCTCTTCATTATCA
CTGGTGTCCAGCACTTCTTCTCTTTACTCTACAGCTGAAGAAAAGGCTCATTCAGAGCAAATCCATAAACTGCGGAGAGAGCTGGTTGCA
TCACAAGAAAAAGTTGCTACCCTCACATCTCAGCTTTCAGCAAATGCTCACCTTGTAGCAGCTTTTGAAAAGAGCTTAGGGAATATGACT
GGCCGATTGCAAAGTCTAACTATGACAGCGGAACAAAAGGAATCTGAACTTATAGAACTAAGAGAAACCATTGAAATGCTGAAGGCTCAG
AATTCTGCTGCCCAGGCGGCTATTCAGGGAGCACTGAATGGTCCAGACCATCCTCCCAAAGATCTTCGCATCAGAAGACAGCATTCCTCT
GAAAGTGTTTCTAGTATCAACAGTGCCACAAGCCATTCCAGTATTGGCAGTGGTAATGATGCCGACTCCAAGAAGAAGAAAAAGAAAAAC
TGGGTGAACTCTAGAGGAAGTGAGCTGAGAAGTTCTTTCAAACAAGCCTTTGGGAAGAAAAAGTCCACCAAGCCTCCTTCATCACATTCT
GACATTGAAGAGCTTACTGATTCATCCCTTCCGGCATCCCCCAAGTTACCCCATAATGCTGGTGACTGTGGCTCAGCATCCATGAAGCCC
TCACAATCTGCTTCAGCGTCACCCCTTGTCTGGCCACCAAAGAAACGACAAAATGGCCCTGTGATCTACAAGCATAGATCTCGGATCTGT
GAATGCACAGAAGCTGAGGCAGAGATAATTCTGCAGCTGAAGAGCGAGCTCAGAGAAAAGGAATTAAAATTAACGGATATTCGGCTGGAG
GCCCTCAGCTCTGCTCATCATCTTGATCAGATCCGGGAAGCCATGAACCGGATGCAGAATGAAATTGAAATACTGAAAGCTGAAAATGAC
CGGTTGAAGGCAGAAACTGGTAACACAGCTAAGCCTACTCGGCCACCGTCAGAATCCTCAAGCAGCACCTCCTCTTCATCTTCCAGGCAG
TCATTAGGACTTTCTCTAAACAATTTGAACATCACAGAGGCTGTTAGCTCAGATATTTTGCTAGATGATGCTGGTGATGCAACTGGACAT
AAAGATGGCCGCAGTGTGAAAATTATAGTCTCCATAAGCAAGGGCTATGGTCGAGCAAAGGACCAAAAATCTCAGGCATATTTGATAGGA
TCCATTGGTGTTAGTGGAAAAACCAAGTGGGATGTCTTAGATGGTGTAATAAGACGTCTCTTTAAGGAATATGTATTCCGAATTGATACA
TCCACTAGCCTTGGTCTGAGCTCTGACTGCATTGCTAGCTACTGTATAGGAGACTTAATTAGATCCCATAACCTAGAAGTGCCTGAATTG
CTGCCTTGTGGATACCTTGTTGGAGATAATAACATCATCACTGTGAACCTCAAAGGGGTAGAAGAAAATAGTTTGGACAGTTTTGTTTTT
GATACGCTGATTCCTAAACCAATTACCCAAAGGTACTTTAACTTGTTGATGGAGCATCACAGAATTATACTCTCAGGACCGAGTGGTACT
GGAAAGACCTATTTGGCAAACAAACTTGCTGAATATGTAATAACCAAATCTGGAAGGAAAAAAACAGAGGATGCAATTGCCACTTTTAAT
GTGGACCACAAGTCAAGTAAGGAATTGCAACAATATCTAGCTAACCTGGCTGAACAGTGCAGTGCTGATAATAATGGAGTGGAGCTCCCA
GTTGTAATAATTCTTGATAATCTTCATCATGTGGGCTCTCTGAGTGATATCTTCAATGGTTTTCTCAATTGTAAATACAACAAATGTCCA
TATATTATTGGAACAATGAATCAGGGAGTTTCTTCATCACCAAATCTAGAGCTGCATCACAATTTCAGGTGGGTATTATGTGCAAATCAT
ACAGAACCAGTGAAAGGCTTTTTAGGCAGATATCTTCGAAGAAAACTCATAGAGATAGAAATTGAAAGGAACATTCGCAATAATGACCTA
GTCAAAATTATAGATTGGATTCCGAAGACGTGGCATCATCTCAACAGTTTTTTGGAAACACACAGTTCTTCTGACGTTACCATTGGTCCC
CGACTATTCCTTCCTTGCCCCATGGATGTAGAAGGTTCTAGAGTATGGTTCATGGATCTCTGGAACTATTCTTTAGTACCTTATATTCTG
GAGGCAGTGAGAGAGGGTCTTCAGATGTATGGGAAACGCACACCATGGGAAGATCCTTCAAAGTGGGTGCTTGACACATATCCATGGAGC
TCAGCAACTCTGCCTCAGGAGAGCCCAGCCTTACTTCAGCTGCGACCAGAAGATGTTGGGTATGAAAGCTGCACATCCACTAAGGAAGCC
ACAACCTCAAAGCACATTCCGCAAACTGACACAGAAGGAGATCCCCTGATGAATATGCTAATGAAACTCCAAGAAGCAGCCAATTACTCG
AGCACACAAAGCTGCGACAGCGAAAGCACCAGCCACCATGAAGACATTTTGGATTCATCTCTTGAATCTACCCTCTAGAGGGTGAAAAAA
GTTAAGGGAAAAGACTTTGCTTTTAAAAAAATGTTTCAAAAGAAAGGTATTTTCACTAAACCACTGCCAGTATAAAAGCACCCTGTCAAG
GGCCCTGACCCAGAGTTGTGGTCTCCAAGGAGGCAGCAGAACTAAGTCTGAACCGCCAAGATGCTAAATTGCAATGGAAGCTTAACTTTA
GTTTATTTCTAAGCATTTTTTATATCTGTGGAGTAATAGAAAGCTCCATTACTCAACTGGAAAGGACCCTAATGACAGGGCAACTGAACA
GATTGCACATGGGATAGCCAAACTGGACTTTCTTTGTTTCCTCTTTAAAAGTTTACAATGCAGACCATTTTTTGTCCCTTCCTTTTGTTT
CCTCTGAGGGGCTGTTCGCCCCAGGCAGGGTCCATCTTTCTGATCTGTCCAACCTCCTTTGTGCCACACGGTGCTGGTCACAGGGCTTCA
GTAGTGTTTGTGTTGTGCGCTCACCCCATTCCAGAACAAATCCAAGAGGCCAGTCCTCCATAAGCACAAATGGAATTGTGCAACCACCAG
AAAAACACTACTGTGGCAAACTGGAGAAGTGCCAATTTAATTCTAACTGCCACGTTCTCATGATGTGCTCCACCAACTTTTTAGTATATG
AGTCACTGGTTTTATAAGGTTGTTTTTACCACAGTGGTCTTTTTAAACCACCTGCCCACTCCCTTAACAAGAGTTTTATACCAATTATTA
GTCAACACTGATAAAAGGCTTTTTTAGGGCTTTATTTGTTTGAGCCTTTTCAGTGAAAGAAGGAACATTTCCTATGGTGCTGTCTCACTG
CCTTAAAACAGATTTCTATGACAGTTTAACAGTTGGTTTAAATCCTAAACCATTGGTAATTTCCACTGTCTTTTCATTTACAACCAAGCA
ACACCAGTTAACATAGTAGCCTCATCTCTATATATCTTTCTCTTTTTTTTTTTTTTGAAGAAATGGATAGGAGAAAGATCAGTATTTTTA
GCCTTGTGAATAGATCGCTTTGCCTATCCTCCAAAATATTAAAATAACCCAGAAATGCTCTTTGACCGTCACTTAAAACCTAAGACATGT
GGCGAAATTCCATCCAGTTCTAAGTGAAAGAGTTTCAGAAGGCAGAAGATTTTGAATTATTATCCAGCAGGGCTGGAAGCACTAGATGCA
GCATGAGCACAACTATTCGGCTTTCCTTCCCTATTGTTTTTGTTTTTTTAATGAGTTTTGACGCATGTTGTTTTGATTGCTATTGTTGTA
CATGAGAAATTCAGCATTAAAGAACACTGAAGCGGTAAGGTCACTGTGGAAGAGGAAGCGTTTATACTGTAAAAGAAGGTTAGATTTGCA
CAGTCTACTGGGTAGGTATTGTAAATAATAATTTTTAAAACTTGCACAAATCAAAACAAACACAAACAAAATTGTATTTTATCCTGTTGG
TGTTAAGAGGTGTTTCACTTGCTGAGATTTCCTGTACATTGCAAACAAATACAGAATGCAAACCCTCAAAGCTGTATTATCTGGTGTGTT
TGTCCTGTATTTACAGTTGTTTTTGACTATGCAGGAGCTATCAGTGCTAGAGTGAGCATGCTTCAAAACTGTACATGAAGCCAATATATT
TTTGGATAAGTAAAACTGTCTGAAAGTACATCTGTCATGGCAGGCTTTAAAGAGAGTGCATGAAAACTGATCAGTCATTGGAGAAGTTAC
CACCACACACAAAGGACAGGTTTTAAGTTTATGAAACCCAAGGGCTAGGCCATGGTATAGACTTCTTCTATGAGTGTGTGAAAATGTGTT
ACTTTTAGGACGTGTATTTGGTGCTACTCTCTGTGACCACCAATGGGTCAGTTGCTATAGAACAACAACACCACGAAACATCTGTGCAGT
TTTCAGAGTGTCACAAAGTCAATAGGTCCTTACACGGTGCTATTGCCCTAAGGGAAATCCGAACTGAATTTATGCACATAGAATTGTCAC
CCTGACTTTGAAGCCTCAAACATGGATCAAATCTGTTGTGAAACATCAATATATGTAGCTGGATGAGTGACTAGTTTCCCTTGTATAATA
TGTGATCTAAGAAAATTGCTAATCTTTCCCTGCCATTTTGAGAAACACAGTCCAAACATGAGCATAAACAGAATTTCCTGCAATACATCC
CAGTAGGTCCACCTAGTTTACAACTTAAACTAGTTTGTGAAACATTTGTCTGTATACATTTTATATTTTGTACATTTTGATGTAACATAT
CATGTAAATAGGCAGAAACAGTGAAATAAATCATCTGAAAAGTTTTGTAGTCTTTGTAAAGCCCCAACAATAAGTACTTGGTGTCAATGG
ACTTAACTGGATGATGTATTTTCTATTGGTTTATTGTTCCTCTAGCTTGTAAACCAGCTTGCATATATTTTTTTGCAAATGTGCACCCTG

>In-frame_N4BP1_ENST00000262384_chr16_48594665_-_NAV3_ENST00000228327_chr12_78510552_+_9075nt
GGCCCGGCCCGCGGCGGCGGCAAAGGGGCGGAGGGGTTCGCTGCCAGCAATTGCCAAGCTGCTGCGGTCGTGGCGGGATGGTATAGCCGG
GCCTGAGGGCGGGCGGCGGGGCGCGGGCGGGGGCGAGGCGGCCGGGAAGGGCCGACGCCGCCTGACTGGCTTGGGAGCAGCGGCAGCAAG
CTGAGGGGGCGTCGCCGCCGCCGGCCCCCGGCGCCGCCGCGGGAGGCCGCGCCCGCCATGGCGGCCCGGGCGGTGCTGGACGAGTTCACT
GCGCCAGCTGAGAAGGCGGAGCTGCTGGAGCAGAGCCGCGGCCGTATCGAGGGCCTGTTTGGCGTGAGCCTAGCCGTGCTCGGCGCGCTA
GGGGCTGAGGAGCCGCTGCCCGCGCGCATCTGGCTGCAGCTCTGCGGGGCGCAGGAGGCGGTGCACAGCGCCAAGGAATATATTAAAGGA
ATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATTTTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGC
TTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATCAGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGG
AGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGTCAGAAAGAATCAGAGGTGAAAAGGGAATTCAAA
CAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACTTCCTTGAAAAAAGAACTTTTGACACTCACACAA
GGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCTCAACAAACAGAGTTTACACAGAATGCTGCCACA
GGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTGGGACTCCTGTTTCTGAGCTTACAAAACAAATG
GACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACCCCAGATGAAGAGGCACTTTCCAATGAGAGAATT
TGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCTTTGGAAAATGTTCAGGAGGGGGAGATTTTACAC
GATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGATTCTGAAAATTTAAGTCCAGATATAAAAGAAACT
ACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCCCAAGAAATTGTTGAAAAGGTCATTAAGGTGTAT
GGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGATTCCAAGAAGACAGAGAATTTTCAGCTGGTACA
GTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAGCTTACAACTGATTCCACTCCAAAGAAAACACAG
GCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAAGCTAAACCATGTACCTCAAATTGTAGAATTAAT
ACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAACTACATTTGTAACACAGACCCTGAAACTGATGGC
CTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAGCTTCAAGTCACCAGCCCAGAGTTCCACTTTTT
CCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCTGCCTGTGAAAAACGTTTAGGATGTTGTAGTTCT
CCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTGTTACCTTCGGTTACTGATGCAAGGTCGGCAGGA
CCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTAAAAATACCCTACAAGCTGGAATTAAAAAATGAA
CCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACCTGGGATGACAGCAGTTCAGTGAGCAGTGGTCTC
AGTGACACCCTTGATAACATCAGCACTGATGACCTGAACACCACATCCTCTGTCAGCTCTTACTCCAACATCACCGTCCCCTCTAGGAAG
AATACTCAGCTGAGGACAGATTCAGAGAAACGCTCCACCACAGACGAGACCTGGGATAGTCCTGAGGAACTGAAAAAACCAGAAGAAGAT
TTTGACAGCCATGGGGATGCTGGTGGCAAGTGGAAGACTGTGTCCTCTGGACTTCCTGAAGACCCCGAGAAGGCAGGGCAGAAAGCTTCC
CTGTCTGTTTCACAGACAGGTTCCTGGAGAAGAGGCATGTCTGCCCAAGGAGGGGCGCCATCTAGGCAGAAAGCTGGAACAAGTGCACTC
AAAACACCCGGGAAAACCGATGATGCCAAAGCTTCTGAGAAAGGAAAAGCTCCCCTAAAAGGATCATCTCTACAAAGATCTCCTTCAGAT
GCAGGAAAAAGCAGTGGAGATGAAGGGAAAAAGCCCCCCTCAGGCATTGGAAGATCGACTGCCACCAGCTCCTTTGGCTTTAAGAAACCA
AGTGGAGTAGGGTCATCTGCCATGATCACCAGCAGTGGAGCAACCATAACAAGTGGCTCTGCAACACTGGGTAAAATTCCAAAATCTGCT
GCCATTGGCGGGAAGTCAAATGCAGGGAGAAAAACCAGTTTGGACGGTTCACAGAATCAGGATGATGTTGTGCTGCATGTTAGCTCAAAG
ACTACCCTACAATATCGCAGCTTGCCCCGCCCTTCAAAATCCAGCACCAGTGGCATTCCTGGCCGAGGAGGCCACAGATCCAGTACCAGC
AGTATTGATTCCAACGTCAGCAGCAAGTCTGCTGGGGCCACCACCTCGAAACTGAGAGAACCAACTAAAATTGGGTCAGGGCGCTCGAGT
CCTGTCACCGTCAACCAAACAGACAAGGAAAAGGAAAAAGTAGCAGTCTCAGATTCAGAAAGTGTTTCTTTGTCAGGTTCCCCCAAATCC
AGCCCCACCTCTGCCAGCGCCTGTGGTGCACAAGGTCTCAGGCAGCCAGGATCCAAGTATCCAGATATTGCCTCACCCACATTTCGAAGG
TTGTTTGGTGCCAAGGCAGGTGGCAAATCTGCCTCTGCACCTAATACTGAGGGTGTGAAATCTTCCTCAGTAATGCCCAGCCCTAGTACC
ACATTAGCGCGGCAAGGCAGTCTGGAGTCACCGTCGTCCGGTACGGGCAGCATGGGCAGTGCTGGTGGGCTAAGCGGCAGCAGCAGCCCT
CTCTTCAATAAACCCTCAGACTTAACTACAGATGTTATAAGCTTAAGTCACTCGTTGGCCTCCAGCCCAGCATCGGTTCACTCTTTCACA
TCAGGTGGTCTCGTGTGGGCTGCCAATATGAGCAGTTCCTCTGCAGGCAGCAAGGATACTCCGAGCTACCAGTCCATGACTAGCCTCCAC
ACGAGCTCTGAGTCCATTGACCTCCCCCTCAGCCATCATGGCTCCTTGTCTGGACTGACCACAGGCACTCACGAGGTCCAGAGCCTGCTC
ATGAGAACGGGTAGTGTGAGATCTACTCTCTCAGAAAGCATGCAGCTTGACAGAAATACACTACCCAAAAAGGGACTAAGATATACCCCA
TCATCTCGGCAGGCCAACCAAGAAGAGGGCAAAGAGTGGTTGCGTTCTCATTCTACTGGAGGGCTTCAGGACACTGGCAACCAGTCACCT
CTGGTTTCCCCTTCTGCCATGTCATCTTCTGCAGCTGGAAAATACCACTTTTCTAACTTGGTGAGCCCAACAAATTTGTCTCAGTTTAAC
CTTCCCGGGCCCAGCATGATGCGCTCAAACAGCATCCCAGCCCAAGACTCTTCCTTCGATCTCTATGATGACTCCCAGCTTTGTGGGAGT
GCCACTTCTCTGGAGGAAAGACCTCGTGCCATCAGTCATTCGGGCTCATTCAGAGACAGCATGGAAGAAGTTCATGGCTCTTCATTATCA
CTGGTGTCCAGCACTTCTTCTCTTTACTCTACAGCTGAGGCGGGTGGATCACTTGAGCAAATCCATAAACTGCGGAGAGAGCTGGTTGCA
TCACAAGAAAAAGTTGCTACCCTCACATCTCAGCTTTCAGCAAATGCTCACCTTGTAGCAGCTTTTGAAAAGAGCTTAGGGAATATGACT
GGCCGATTGCAAAGTCTAACTATGACAGCGGAACAAAAGGAATCTGAACTTATAGAACTAAGAGAAACCATTGAAATGCTGAAGGCTCAG
AATTCTGCTGCCCAGGCGGCTATTCAGGGAGCACTGAATGGTCCAGACCATCCTCCCAAAGATCTTCGCATCAGAAGACAGCATTCCTCT
GAAAGTGTTTCTAGTATCAACAGTGCCACAAGCCATTCCAGTATTGGCAGTGGTAATGATGCCGACTCCAAGAAGAAGAAAAAGAAAAAC
TGGGTGAACTCTAGAGGAAGTGAGCTGAGAAGTTCTTTCAAACAAGCCTTTGGGAAGAAAAAGTCCACCAAGCCTCCTTCATCACATTCT
GACATTGAAGAGCTTACTGATTCATCCCTTCCGGCATCCCCCAAGTTACCCCATAATGCTGGTGACTGTGGCTCAGCATCCATGAAGCCC
TCACAATCTGCTTCAGCGATCTGTGAATGCACAGAAGCTGAGGCAGAGATAATTCTGCAGCTGAAGAGCGAGCTCAGAGAAAAGGAATTA
AAATTAACGGATATTCGGCTGGAGGCCCTCAGCTCTGCTCATCATCTTGATCAGATCCGGGAAGCCATGAACCGGATGCAGAATGAAATT
GAAATACTGAAAGCTGAAAATGACCGGTTGAAGGCAGAAACTGGTAACACAGCTAAGCCTACTCGGCCACCGTCAGAATCCTCAAGCAGC
ACCTCCTCTTCATCTTCCAGGCAGTCATTAGGACTTTCTCTAAACAATTTGAACATCACAGAGGCTGTTAGCTCAGATATTTTGCTAGAT
GATGCTGGTGATGCAACTGGACATAAAGATGGCCGCAGTGTGAAAATTATAGTCTCCATAAGCAAGGGCTATGGTCGAGCAAAGGACCAA
AAATCTCAGGCATATTTGATAGGATCCATTGGTGTTAGTGGAAAAACCAAGTGGGATGTCTTAGATGGTGTAATAAGACGTCTCTTTAAG
GAATATGTATTCCGAATTGATACATCCACTAGCCTTGGTCTGAGCTCTGACTGCATTGCTAGCTACTGTATAGGAGACTTAATTAGATCC
CATAACCTAGAAGTGCCTGAATTGCTGCCTTGTGGATACCTTGTTGGAGATAATAACATCATCACTGTGAACCTCAAAGGGGTAGAAGAA
AATAGTTTGGACAGTTTTGTTTTTGATACGCTGATTCCTAAACCAATTACCCAAAGGTACTTTAACTTGTTGATGGAGCATCACAGAATT
ATACTCTCAGGACCGAGTGGTACTGGAAAGACCTATTTGGCAAACAAACTTGCTGAATATGTAATAACCAAATCTGGAAGGAAAAAAACA
GAGGATGCAATTGCCACTTTTAATGTGGACCACAAGTCAAGTAAGGAATTGCAACAATATCTAGCTAACCTGGCTGAACAGTGCAGTGCT
GATAATAATGGAGTGGAGCTCCCAGTTGTAATAATTCTTGATAATCTTCATCATGTGGGCTCTCTGAGTGATATCTTCAATGGTTTTCTC
AATTGTAAATACAACAAATGTCCATATATTATTGGAACAATGAATCAGGGAGTTTCTTCATCACCAAATCTAGAGCTGCATCACAATTTC
AGGTGGGTATTATGTGCAAATCATACAGAACCAGTGAAAGGCTTTTTAGGCAGATATCTTCGAAGAAAACTCATAGAGATAGAAATTGAA
AGGAACATTCGCAATAATGACCTAGTCAAAATTATAGATTGGATTCCGAAGACGTGGCATCATCTCAACAGTTTTTTGGAAACACACAGT
TCTTCTGACGTTACCATTGGTCCCCGACTATTCCTTCCTTGCCCCATGGATGTAGAAGGTTCTAGAGTATGGTTCATGGATCTCTGGAAC
TATTCTTTAGTACCTTATATTCTGGAGGCAGTGAGAGAGGGTCTTCAGATGTATGGGAAACGCACACCATGGGAAGATCCTTCAAAGTGG
GTGCTTGACACATATCCATGGAGCTCAGCAACTCTGCCTCAGGAGAGCCCAGCCTTACTTCAGCTGCGACCAGAAGATGTTGGGTATGAA
AGCTGCACATCCACTAAGGAAGCCACAACCTCAAAGCACATTCCGCAAACTGACACAGAAGGAGATCCCCTGATGAATATGCTAATGAAA
CTCCAAGAAGCAGCCAATTACTCGAGCACACAAAGCTGCGACAGCGAAAGCACCAGCCACCATGAAGACATTTTGGATTCATCTCTTGAA
TCTACCCTCTAGAGGGTGAAAAAAGTTAAGGGAAAAGACTTTGCTTTTAAAAAAATGTTTCAAAAGAAAGGTATTTTCACTAAACCACTG
CCAGTATAAAAGCACCCTGTCAAGGGCCCTGACCCAGAGTTGTGGTCTCCAAGGAGGCAGCAGAACTAAGTCTGAACCGCCAAGATGCTA
AATTGCAATGGAAGCTTAACTTTAGTTTATTTCTAAGCATTTTTTATATCTGTGGAGTAATAGAAAGCTCCATTACTCAACTGGAAAGGA
CCCTAATGACAGGGCAACTGAACAGATTGCACATGGGATAGCCAAACTGGACTTTCTTTGTTTCCTCTTTAAAAGTTTACAATGCAGACC
ATTTTTTGTCCCTTCCTTTTGTTTCCTCTGAGGGGCTGTTCGCCCCAGGCAGGGTCCATCTTTCTGATCTGTCCAACCTCCTTTGTGCCA
CACGGTGCTGGTCACAGGGCTTCAGTAGTGTTTGTGTTGTGCGCTCACCCCATTCCAGAACAAATCCAAGAGGCCAGTCCTCCATAAGCA
CAAATGGAATTGTGCAACCACCAGAAAAACACTACTGTGGCAAACTGGAGAAGTGCCAATTTAATTCTAACTGCCACGTTCTCATGATGT
GCTCCACCAACTTTTTAGTATATGAGTCACTGGTTTTATAAGGTTGTTTTTACCACAGTGGTCTTTTTAAACCACCTGCCCACTCCCTTA
ACAAGAGTTTTATACCAATTATTAGTCAACACTGATAAAAGGCTTTTTTAGGGCTTTATTTGTTTGAGCCTTTTCAGTGAAAGAAGGAAC
ATTTCCTATGGTGCTGTCTCACTGCCTTAAAACAGATTTCTATGACAGTTTAACAGTTGGTTTAAATCCTAAACCATTGGTAATTTCCAC
TGTCTTTTCATTTACAACCAAGCAACACCAGTTAACATAGTAGCCTCATCTCTATATATCTTTCTCTTTTTTTTTTTTTTGAAGAAATGG
ATAGGAGAAAGATCAGTATTTTTAGCCTTGTGAATAGATCGCTTTGCCTATCCTCCAAAATATTAAAATAACCCAGAAATGCTCTTTGAC
CGTCACTTAAAACCTAAGACATGTGGCGAAATTCCATCCAGTTCTAAGTGAAAGAGTTTCAGAAGGCAGAAGATTTTGAATTATTATCCA
GCAGGGCTGGAAGCACTAGATGCAGCATGAGCACAACTATTCGGCTTTCCTTCCCTATTGTTTTTGTTTTTTTAATGAGTTTTGACGCAT
GTTGTTTTGATTGCTATTGTTGTACATGAGAAATTCAGCATTAAAGAACACTGAAGCGGTAAGGTCACTGTGGAAGAGGAAGCGTTTATA
CTGTAAAAGAAGGTTAGATTTGCACAGTCTACTGGGTAGGTATTGTAAATAATAATTTTTAAAACTTGCACAAATCAAAACAAACACAAA
CAAAATTGTATTTTATCCTGTTGGTGTTAAGAGGTGTTTCACTTGCTGAGATTTCCTGTACATTGCAAACAAATACAGAATGCAAACCCT
CAAAGCTGTATTATCTGGTGTGTTTGTCCTGTATTTACAGTTGTTTTTGACTATGCAGGAGCTATCAGTGCTAGAGTGAGCATGCTTCAA
AACTGTACATGAAGCCAATATATTTTTGGATAAGTAAAACTGTCTGAAAGTACATCTGTCATGGCAGGCTTTAAAGAGAGTGCATGAAAA
CTGATCAGTCATTGGAGAAGTTACCACCACACACAAAGGACAGGTTTTAAGTTTATGAAACCCAAGGGCTAGGCCATGGTATAGACTTCT
TCTATGAGTGTGTGAAAATGTGTTACTTTTAGGACGTGTATTTGGTGCTACTCTCTGTGACCACCAATGGGTCAGTTGCTATAGAACAAC
AACACCACGAAACATCTGTGCAGTTTTCAGAGTGTCACAAAGTCAATAGGTCCTTACACGGTGCTATTGCCCTAAGGGAAATCCGAACTG
AATTTATGCACATAGAATTGTCACCCTGACTTTGAAGCCTCAAACATGGATCAAATCTGTTGTGAAACATCAATATATGTAGCTGGATGA
GTGACTAGTTTCCCTTGTATAATATGTGATCTAAGAAAATTGCTAATCTTTCCCTGCCATTTTGAGAAACACAGTCCAAACATGAGCATA
AACAGAATTTCCTGCAATACATCCCAGTAGGTCCACCTAGTTTACAACTTAAACTAGTTTGTGAAACATTTGTCTGTATACATTTTATAT
TTTGTACATTTTGATGTAACATATCATGTAAATAGGCAGAAACAGTGAAATAAATCATCTGAAAAGTTTTGTAGTCTTTGTAAAGCCCCA
ACAATAAGTACTTGGTGTCAATGGACTTAACTGGATGATGTATTTTCTATTGGTTTATTGTTCCTCTAGCTTGTAAACCAGCTTGCATAT

>In-frame_N4BP1_ENST00000262384_chr16_48594665_-_NAV3_ENST00000266692_chr12_78510552_+_8544nt
GGCCCGGCCCGCGGCGGCGGCAAAGGGGCGGAGGGGTTCGCTGCCAGCAATTGCCAAGCTGCTGCGGTCGTGGCGGGATGGTATAGCCGG
GCCTGAGGGCGGGCGGCGGGGCGCGGGCGGGGGCGAGGCGGCCGGGAAGGGCCGACGCCGCCTGACTGGCTTGGGAGCAGCGGCAGCAAG
CTGAGGGGGCGTCGCCGCCGCCGGCCCCCGGCGCCGCCGCGGGAGGCCGCGCCCGCCATGGCGGCCCGGGCGGTGCTGGACGAGTTCACT
GCGCCAGCTGAGAAGGCGGAGCTGCTGGAGCAGAGCCGCGGCCGTATCGAGGGCCTGTTTGGCGTGAGCCTAGCCGTGCTCGGCGCGCTA
GGGGCTGAGGAGCCGCTGCCCGCGCGCATCTGGCTGCAGCTCTGCGGGGCGCAGGAGGCGGTGCACAGCGCCAAGGAATATATTAAAGGA
ATCTGTGAACCTGAACTAGAAGAAAGAGAATGTTACCCCAAGGACATGCACTGCATTTTTGTTGGGGCAGAGAGCCTGTTTCTGAAAAGC
TTGATTCAGGATACTTGTGCTGACCTCTGCATTCTGGACATTGGCCTTCTTGGCATCAGAGGAAGTGCTGAGGCTGTGGTCATGGCTAGG
AGTCACATTCAACAATTTGTAAAGCTCTTTGAAAATAAAGAGAACCTACCCAGTAGTCAGAAAGAATCAGAGGTGAAAAGGGAATTCAAA
CAATTTGTTGAAGCCCATGCAGACAATTACACAATGGATTTGTTGATTTTGCCCACTTCCTTGAAAAAAGAACTTTTGACACTCACACAA
GGTGAGGAGAATCTCTTTGAAACAGGAGATGATGAGGTTATTGAAATGAGAGATTCTCAACAAACAGAGTTTACACAGAATGCTGCCACA
GGGCTGAATATTTCTAGAGATGAAACTGTTTTGCAGGAAGAGGCAAGAAATAAAGCTGGGACTCCTGTTTCTGAGCTTACAAAACAAATG
GACACAGTCCTTTCTAGCTCACCAGATGTGCTTTTTGATCCAATAAATGGTCTAACCCCAGATGAAGAGGCACTTTCCAATGAGAGAATT
TGTCAGAAAAGGAGATTTTCTGATTCTGAAGAAAGGCATACGAAGAAGCAGTTTTCTTTGGAAAATGTTCAGGAGGGGGAGATTTTACAC
GATGCTAAGACATTGGCTGGAAATGTAATAGCTGACCTATCTGATTCTTCTGCTGATTCTGAAAATTTAAGTCCAGATATAAAAGAAACT
ACTGAGGAAATGGAATACAACATCCTCGTAAACTTTTTTAAAACCATGGGCTACTCCCAAGAAATTGTTGAAAAGGTCATTAAGGTGTAT
GGACCATCTACTGAACCATTATTGCTCTTAGAGGAAATTGAAAAAGAAAATAAAAGATTCCAAGAAGACAGAGAATTTTCAGCTGGTACA
GTGTATCCAGAGACCAACAAAACCAAAAATAAAGGTGTTTATAGCAGCACAAATGAGCTTACAACTGATTCCACTCCAAAGAAAACACAG
GCTCACACACAGCAAAATATGGTAGAAAAATTTTCTCAGTTACCATTCAAAGTGGAAGCTAAACCATGTACCTCAAATTGTAGAATTAAT
ACTTTCAGAACAGTGCCAATAGAACAGAAACATGAAGTCTGGGGTTCAAACCAGAACTACATTTGTAACACAGACCCTGAAACTGATGGC
CTTTCACCTTCTGTTGCCTCTCCAAGTCCCAAAGAAGTCAATTTTGTTTCAAGGGGAGCTTCAAGTCACCAGCCCAGAGTTCCACTTTTT
CCTGAAAATGGTTTACACCAGCAGCCAGAACCCTTGCTTCCAAATAATATGAAATCTGCCTGTGAAAAACGTTTAGGATGTTGTAGTTCT
CCTCATTCTAAGCCAAATTGCTCAACCCTTTCTCCACCAATGCCACTGCCCCAGCTGTTACCTTCGGTTACTGATGCAAGGTCGGCAGGA
CCTTCTGATCATATTGATTCCTCAGTTACTGGGGTTCAAAGGTTTCGAGATACTCTAAAAATACCCTACAAGCTGGAATTAAAAAATGAA
CCAGGGAGAACGGATTTGAAACACATTGTTATAGATGGGAGCAATGTTGCAATTACCTGGGATGACAGCAGTTCAGTGAGCAGTGGTCTC
AGTGACACCCTTGATAACATCAGCACTGATGACCTGAACACCACATCCTCTGTCAGCTCTTACTCCAACATCACCGTCCCCTCTAGGAAG
AATACTCAGCTGAGGACAGATTCAGAGAAACGCTCCACCACAGACGAGACCTGGGATAGTCCTGAGGAACTGAAAAAACCAGAAGAAGAT
TTTGACAGCCATGGGGATGCTGGTGGCAAGTGGAAGACTGTGTCCTCTGGACTTCCTGAAGACCCCGAGAAGGCAGGGCAGAAAGCTTCC
CTGTCTGTTTCACAGACAGGTTCCTGGAGAAGAGGCATGTCTGCCCAAGGAGGGGCGCCATCTAGGCAGAAAGCTGGAACAAGTGCACTC
AAAACACCCGGGAAAACCGATGATGCCAAAGCTTCTGAGAAAGGAAAAGCTCCCCTAAAAGGATCATCTCTACAAAGATCTCCTTCAGAT
GCAGGAAAAAGCAGTGGAGATGAAGGGAAAAAGCCCCCCTCAGGCATTGGAAGATCGACTGCCACCAGCTCCTTTGGCTTTAAGAAACCA
AGTGGAGTAGGGTCATCTGCCATGATCACCAGCAGTGGAGCAACCATAACAAGTGGCTCTGCAACACTGGGTAAAATTCCAAAATCTGCT
GCCATTGGCGGGAAGTCAAATGCAGGGAGAAAAACCAGTTTGGACGGTTCACAGAATCAGGATGATGTTGTGCTGCATGTTAGCTCAAAG
ACTACCCTACAATATCGCAGCTTGCCCCGCCCTTCAAAATCCAGCACCAGTGGCATTCCTGGCCGAGGAGGCCACAGATCCAGTACCAGC
AGTATTGATTCCAACGTCAGCAGCAAGTCTGCTGGGGCCACCACCTCGAAACTGAGAGAACCAACTAAAATTGGGTCAGGGCGCTCGAGT
CCTGTCACCGTCAACCAAACAGACAAGGAAAAGGAAAAAGTAGCAGTCTCAGATTCAGAAAGTGTTTCTTTGTCAGGTTCCCCCAAATCC
AGCCCCACCTCTGCCAGCGCCTGTGGTGCACAAGGTCTCAGGCAGCCAGGATCCAAGTATCCAGATATTGCCTCACCCACATTTCGAAGA
TATACCCCATCATCTCGGCAGGCCAACCAAGAAGAGGGCAAAGAGTGGTTGCGTTCTCATTCTACTGGAGGGCTTCAGGACACTGGCAAC
CAGTCACCTCTGGTTTCCCCTTCTGCCATGTCATCTTCTGCAGCTGGAAAATACCACTTTTCTAACTTGGTGAGCCCAACAAATTTGTCT
CAGTTTAACCTTCCCGGGCCCAGCATGATGCGCTCAAACAGCATCCCAGCCCAAGACTCTTCCTTCGATCTCTATGATGACTCCCAGCTT
TGTGGGAGTGCCACTTCTCTGGAGGAAAGACCTCGTGCCATCAGTCATTCGGGCTCATTCAGAGACAGCATGGAAGAAGTTCATGGCTCT
TCATTATCACTGGTGTCCAGCACTTCTTCTCTTTACTCTACAGCTGAGGCGGGTGGATCACTTGAGCAAATCCATAAACTGCGGAGAGAG
CTGGTTGCATCACAAGAAAAAGTTGCTACCCTCACATCTCAGCTTTCAGCAAATGCTCACCTTGTAGCAGCTTTTGAAAAGAGCTTAGGG
AATATGACTGGCCGATTGCAAAGTCTAACTATGACAGCGGAACAAAAGGAATCTGAACTTATAGAACTAAGAGAAACCATTGAAATGCTG
AAGGCTCAGAATTCTGCTGCCCAGGCGGCTATTCAGGGAGCACTGAATGGTCCAGACCATCCTCCCAAAGATCTTCGCATCAGAAGACAG
CATTCCTCTGAAAGTGTTTCTAGTATCAACAGTGCCACAAGCCATTCCAGTATTGGCAGTGGTAATGATGCCGACTCCAAGAAGAAGAAA
AAGAAAAACTGGGTGAACTCTAGAGGAAGTGAGCTGAGAAGTTCTTTCAAACAAGCCTTTGGGAAGAAAAAGTCCACCAAGCCTCCTTCA
TCACATTCTGACATTGAAGAGCTTACTGATTCATCCCTTCCGGCATCCCCCAAGTTACCCCATAATGCTGGTGACTGTGGCTCAGCATCC
ATGAAGCCCTCACAATCTGCTTCAGCGATCTGTGAATGCACAGAAGCTGAGGCAGAGATAATTCTGCAGCTGAAGAGCGAGCTCAGAGAA
AAGGAATTAAAATTAACGGATATTCGGCTGGAGGCCCTCAGCTCTGCTCATCATCTTGATCAGATCCGGGAAGCCATGAACCGGATGCAG
AATGAAATTGAAATACTGAAAGCTGAAAATGACCGGTTGAAGGCAGAAACTGGTAACACAGCTAAGCCTACTCGGCCACCGTCAGAATCC
TCAAGCAGCACCTCCTCTTCATCTTCCAGGCAGTCATTAGGACTTTCTCTAAACAATTTGAACATCACAGAGGCTGTTAGCTCAGATATT
TTGCTAGATGATGCTGGTGATGCAACTGGACATAAAGATGGCCGCAGTGTGAAAATTATAGTCTCCATAAGCAAGGGCTATGGTCGAGCA
AAGGACCAAAAATCTCAGGCATATTTGATAGGATCCATTGGTGTTAGTGGAAAAACCAAGTGGGATGTCTTAGATGGTGTAATAAGACGT
CTCTTTAAGGAATATGTATTCCGAATTGATACATCCACTAGCCTTGGTCTGAGCTCTGACTGCATTGCTAGCTACTGTATAGGAGACTTA
ATTAGATCCCATAACCTAGAAGTGCCTGAATTGCTGCCTTGTGGATACCTTGTTGGAGATAATAACATCATCACTGTGAACCTCAAAGGG
GTAGAAGAAAATAGTTTGGACAGTTTTGTTTTTGATACGCTGATTCCTAAACCAATTACCCAAAGGTACTTTAACTTGTTGATGGAGCAT
CACAGAATTATACTCTCAGGACCGAGTGGTACTGGAAAGACCTATTTGGCAAACAAACTTGCTGAATATGTAATAACCAAATCTGGAAGG
AAAAAAACAGAGGATGCAATTGCCACTTTTAATGTGGACCACAAGTCAAGTAAGGAATTGCAACAATATCTAGCTAACCTGGCTGAACAG
TGCAGTGCTGATAATAATGGAGTGGAGCTCCCAGTTGTAATAATTCTTGATAATCTTCATCATGTGGGCTCTCTGAGTGATATCTTCAAT
GGTTTTCTCAATTGTAAATACAACAAATGTCCATATATTATTGGAACAATGAATCAGGGAGTTTCTTCATCACCAAATCTAGAGCTGCAT
CACAATTTCAGGTGGGTATTATGTGCAAATCATACAGAACCAGTGAAAGGCTTTTTAGGCAGATATCTTCGAAGAAAACTCATAGAGATA
GAAATTGAAAGGAACATTCGCAATAATGACCTAGTCAAAATTATAGATTGGATTCCGAAGACGTGGCATCATCTCAACAGTTTTTTGGAA
ACACACAGTTCTTCTGACGTTACCATTGGTCCCCGACTATTCCTTCCTTGCCCCATGGATGTAGAAGGTTCTAGAGTATGGTTCATGGAT
CTCTGGAACTATTCTTTAGTACCTTATATTCTGGAGGCAGTGAGAGAGGGTCTTCAGATGTATGGGAAACGCACACCATGGGAAGATCCT
TCAAAGTGGGTGCTTGACACATATCCATGGAGCTCAGCAACTCTGCCTCAGGAGAGCCCAGCCTTACTTCAGCTGCGACCAGAAGATGTT
GGGTATGAAAGCTGCACATCCACTAAGGAAGCCACAACCTCAAAGCACATTCCGCAAACTGACACAGAAGGAGATCCCCTGATGAATATG
CTAATGAAACTCCAAGAAGCAGCCAATTACTCGAGCACACAAAGCTGCGACAGCGAAAGCACCAGCCACCATGAAGACATTTTGGATTCA
TCTCTTGAATCTACCCTCTAGAGGGTGAAAAAAGTTAAGGGAAAAGACTTTGCTTTTAAAAAAATGTTTCAAAAGAAAGGTATTTTCACT
AAACCACTGCCAGTATAAAAGCACCCTGTCAAGGGCCCTGACCCAGAGTTGTGGTCTCCAAGGAGGCAGCAGAACTAAGTCTGAACCGCC
AAGATGCTAAATTGCAATGGAAGCTTAACTTTAGTTTATTTCTAAGCATTTTTTATATCTGTGGAGTAATAGAAAGCTCCATTACTCAAC
TGGAAAGGACCCTAATGACAGGGCAACTGAACAGATTGCACATGGGATAGCCAAACTGGACTTTCTTTGTTTCCTCTTTAAAAGTTTACA
ATGCAGACCATTTTTTGTCCCTTCCTTTTGTTTCCTCTGAGGGGCTGTTCGCCCCAGGCAGGGTCCATCTTTCTGATCTGTCCAACCTCC
TTTGTGCCACACGGTGCTGGTCACAGGGCTTCAGTAGTGTTTGTGTTGTGCGCTCACCCCATTCCAGAACAAATCCAAGAGGCCAGTCCT
CCATAAGCACAAATGGAATTGTGCAACCACCAGAAAAACACTACTGTGGCAAACTGGAGAAGTGCCAATTTAATTCTAACTGCCACGTTC
TCATGATGTGCTCCACCAACTTTTTAGTATATGAGTCACTGGTTTTATAAGGTTGTTTTTACCACAGTGGTCTTTTTAAACCACCTGCCC
ACTCCCTTAACAAGAGTTTTATACCAATTATTAGTCAACACTGATAAAAGGCTTTTTTAGGGCTTTATTTGTTTGAGCCTTTTCAGTGAA
AGAAGGAACATTTCCTATGGTGCTGTCTCACTGCCTTAAAACAGATTTCTATGACAGTTTAACAGTTGGTTTAAATCCTAAACCATTGGT
AATTTCCACTGTCTTTTCATTTACAACCAAGCAACACCAGTTAACATAGTAGCCTCATCTCTATATATCTTTCTCTTTTTTTTTTTTTTG
AAGAAATGGATAGGAGAAAGATCAGTATTTTTAGCCTTGTGAATAGATCGCTTTGCCTATCCTCCAAAATATTAAAATAACCCAGAAATG
CTCTTTGACCGTCACTTAAAACCTAAGACATGTGGCGAAATTCCATCCAGTTCTAAGTGAAAGAGTTTCAGAAGGCAGAAGATTTTGAAT
TATTATCCAGCAGGGCTGGAAGCACTAGATGCAGCATGAGCACAACTATTCGGCTTTCCTTCCCTATTGTTTTTGTTTTTTTAATGAGTT
TTGACGCATGTTGTTTTGATTGCTATTGTTGTACATGAGAAATTCAGCATTAAAGAACACTGAAGCGGTAAGGTCACTGTGGAAGAGGAA
GCGTTTATACTGTAAAAGAAGGTTAGATTTGCACAGTCTACTGGGTAGGTATTGTAAATAATAATTTTTAAAACTTGCACAAATCAAAAC
AAACACAAACAAAATTGTATTTTATCCTGTTGGTGTTAAGAGGTGTTTCACTTGCTGAGATTTCCTGTACATTGCAAACAAATACAGAAT
GCAAACCCTCAAAGCTGTATTATCTGGTGTGTTTGTCCTGTATTTACAGTTGTTTTTGACTATGCAGGAGCTATCAGTGCTAGAGTGAGC
ATGCTTCAAAACTGTACATGAAGCCAATATATTTTTGGATAAGTAAAACTGTCTGAAAGTACATCTGTCATGGCAGGCTTTAAAGAGAGT
GCATGAAAACTGATCAGTCATTGGAGAAGTTACCACCACACACAAAGGACAGGTTTTAAGTTTATGAAACCCAAGGGCTAGGCCATGGTA
TAGACTTCTTCTATGAGTGTGTGAAAATGTGTTACTTTTAGGACGTGTATTTGGTGCTACTCTCTGTGACCACCAATGGGTCAGTTGCTA
TAGAACAACAACACCACGAAACATCTGTGCAGTTTTCAGAGTGTCACAAAGTCAATAGGTCCTTACACGGTGCTATTGCCCTAAGGGAAA
TCCGAACTGAATTTATGCACATAGAATTGTCACCCTGACTTTGAAGCCTCAAACATGGATCAAATCTGTTGTGAAACATCAATATATGTA
GCTGGATGAGTGACTAGTTTCCCTTGTATAATATGTGATCTAAGAAAATTGCTAATCTTTCCCTGCCATTTTGAGAAACACAGTCCAAAC
ATGAGCATAAACAGAATTTCCTGCAATACATCCCAGTAGGTCCACCTAGTTTACAACTTAAACTAGTTTGTGAAACATTTGTCTGTATAC
ATTTTATATTTTGTACATTTTGATGTAACATATCATGTAAATAGGCAGAAACAGTGAAATAAATCATCTGAAAAGTTTTGTAGTCTTTGT
AAAGCCCCAACAATAAGTACTTGGTGTCAATGGACTTAACTGGATGATGTATTTTCTATTGGTTTATTGTTCCTCTAGCTTGTAAACCAG


Top

FusionGenePPI for N4BP1_NAV3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
N4BP1LSM1, ITCH, AZI2, UBC, CUL3, CDK6, FAM114A1, HYPK, CDH1NAV3APC, TFAP4, MAPRE1, TRIO, KRAS


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for N4BP1_NAV3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for N4BP1_NAV3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneNAV3C0007134Renal Cell Carcinoma1CTD_human
TgeneNAV3C0027412Opioid-Related Disorders1CTD_human