FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22975

FusionGeneSummary for MYH11_MYLK

check button Fusion gene summary
Fusion gene informationFusion gene name: MYH11_MYLK
Fusion gene ID: 22975
HgeneTgene
Gene symbol

MYH11

MYLK

Gene ID

4629

4638

Gene namemyosin heavy chain 11myosin light chain kinase
SynonymsAAT4|FAA4|SMHC|SMMHCAAT7|KRP|MLCK|MLCK1|MLCK108|MLCK210|MSTP083|MYLK1|smMLCK
Cytomap

16p13.11

3q21.1

Type of geneprotein-codingprotein-coding
Descriptionmyosin-11myosin heavy chain, smooth muscle isoformmyosin, heavy chain 11, smooth musclemyosin, heavy polypeptide 11, smooth musclemyosin light chain kinase, smooth musclekinase-related proteinmyosin, light polypeptide kinasesmooth muscle myosin light chain kinasetelokin
Modification date2018051920180523
UniProtAcc

P35749

Q15746

Ensembl transtripts involved in fusion geneENST00000396324, ENST00000452625, 
ENST00000576790, ENST00000300036, 
ENST00000573908, 
ENST00000360772, 
ENST00000359169, ENST00000360304, 
ENST00000418370, ENST00000578202, 
ENST00000354792, ENST00000346322, 
ENST00000583087, ENST00000475616, 
ENST00000510775, 
Fusion gene scores* DoF score7 X 6 X 4=1689 X 10 X 3=270
# samples 712
** MAII scorelog2(7/168*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/270*10)=-1.16992500144231
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MYH11 [Title/Abstract] AND MYLK [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneMYLK

GO:0030335

positive regulation of cell migration

19826488

TgeneMYLK

GO:0051928

positive regulation of calcium ion transport

16284075

TgeneMYLK

GO:0071476

cellular hypotonic response

11976941

TgeneMYLK

GO:0090303

positive regulation of wound healing

15825080


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-3B-A9HR-01AMYH11chr16

15809021

-MYLKchr3

123383105

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000396324ENST00000360772MYH11chr16

15809021

-MYLKchr3

123383105

-
Frame-shitENST00000396324ENST00000359169MYH11chr16

15809021

-MYLKchr3

123383105

-
Frame-shitENST00000396324ENST00000360304MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000396324ENST00000418370MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000396324ENST00000578202MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000396324ENST00000354792MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000396324ENST00000346322MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000396324ENST00000583087MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000396324ENST00000475616MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000396324ENST00000510775MYH11chr16

15809021

-MYLKchr3

123383105

-
In-frameENST00000452625ENST00000360772MYH11chr16

15809021

-MYLKchr3

123383105

-
In-frameENST00000452625ENST00000359169MYH11chr16

15809021

-MYLKchr3

123383105

-
In-frameENST00000452625ENST00000360304MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000452625ENST00000418370MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000452625ENST00000578202MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000452625ENST00000354792MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000452625ENST00000346322MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000452625ENST00000583087MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000452625ENST00000475616MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000452625ENST00000510775MYH11chr16

15809021

-MYLKchr3

123383105

-
In-frameENST00000576790ENST00000360772MYH11chr16

15809021

-MYLKchr3

123383105

-
In-frameENST00000576790ENST00000359169MYH11chr16

15809021

-MYLKchr3

123383105

-
In-frameENST00000576790ENST00000360304MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000576790ENST00000418370MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000576790ENST00000578202MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000576790ENST00000354792MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000576790ENST00000346322MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000576790ENST00000583087MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000576790ENST00000475616MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000576790ENST00000510775MYH11chr16

15809021

-MYLKchr3

123383105

-
Frame-shitENST00000300036ENST00000360772MYH11chr16

15809021

-MYLKchr3

123383105

-
Frame-shitENST00000300036ENST00000359169MYH11chr16

15809021

-MYLKchr3

123383105

-
Frame-shitENST00000300036ENST00000360304MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000300036ENST00000418370MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000300036ENST00000578202MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000300036ENST00000354792MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000300036ENST00000346322MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000300036ENST00000583087MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000300036ENST00000475616MYH11chr16

15809021

-MYLKchr3

123383105

-
5CDS-intronENST00000300036ENST00000510775MYH11chr16

15809021

-MYLKchr3

123383105

-
intron-3CDSENST00000573908ENST00000360772MYH11chr16

15809021

-MYLKchr3

123383105

-
intron-3CDSENST00000573908ENST00000359169MYH11chr16

15809021

-MYLKchr3

123383105

-
intron-3CDSENST00000573908ENST00000360304MYH11chr16

15809021

-MYLKchr3

123383105

-
intron-intronENST00000573908ENST00000418370MYH11chr16

15809021

-MYLKchr3

123383105

-
intron-intronENST00000573908ENST00000578202MYH11chr16

15809021

-MYLKchr3

123383105

-
intron-intronENST00000573908ENST00000354792MYH11chr16

15809021

-MYLKchr3

123383105

-
intron-intronENST00000573908ENST00000346322MYH11chr16

15809021

-MYLKchr3

123383105

-
intron-intronENST00000573908ENST00000583087MYH11chr16

15809021

-MYLKchr3

123383105

-
intron-intronENST00000573908ENST00000475616MYH11chr16

15809021

-MYLKchr3

123383105

-
intron-intronENST00000573908ENST00000510775MYH11chr16

15809021

-MYLKchr3

123383105

-

Top

FusionProtFeatures for MYH11_MYLK


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MYH11

P35749

MYLK

Q15746

Muscle contraction.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for MYH11_MYLK


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MYH11_ENST00000452625_chr16_15809021_-_MYLK_ENST00000360772_chr3_123383105_-_2465aa
MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVTVGKDDIQKMNPPKFSKVEDM
AELTCLNEASVLHNLRERYFSGLITTYSGLFCVVVNPTKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGES
GAGKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFAYGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIET
TLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVSSV
LQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKEQADFAVEALAKATTERLFRWILTRVNKA
LDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLA
LLDEECWFPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHTAGKVDTNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVD
RIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQ
GFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDVIMAFQAMCRGYLAR
KAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQ
EQLQAETELTAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKL
EDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIAD
LQAQIAELKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTA
TQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHK
KKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEE
ERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEKAAATDKLEKTKNRLQQELDDLV
VDLDNQRQLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDV
GKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHETETELEDERKQRA
LAAAAKKKLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAERAR
KQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQ
NKELRSKLHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQVEDERKMAEQYKEQIQESEHMKVENS
ENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWTGSSTDGGSAVQSYSIEIWDSANKTWK
ELATCRSTSFNVQDLLPDHETKFRVRAINVTGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEER
LGSGKFGQVFRLVEKKTRKVWAGKFFKATSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTE
RECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINTEPIGYATDMWSIGV
ICYILNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEE
DVSQAFLEAVAEEKPHVKPTFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKY

>In-frame_MYH11_ENST00000452625_chr16_15809021_-_MYLK_ENST00000359169_chr3_123383105_-_2465aa
MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVTVGKDDIQKMNPPKFSKVEDM
AELTCLNEASVLHNLRERYFSGLITTYSGLFCVVVNPTKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGES
GAGKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFAYGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIET
TLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVSSV
LQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKEQADFAVEALAKATTERLFRWILTRVNKA
LDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLA
LLDEECWFPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHTAGKVDTNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVD
RIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQ
GFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDVIMAFQAMCRGYLAR
KAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQ
EQLQAETELTAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKL
EDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIAD
LQAQIAELKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTA
TQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHK
KKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEE
ERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEKAAATDKLEKTKNRLQQELDDLV
VDLDNQRQLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDV
GKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHETETELEDERKQRA
LAAAAKKKLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAERAR
KQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQ
NKELRSKLHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQVEDERKMAEQYKEQIQESEHMKVENS
ENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWTGSSTDGGSAVQSYSIEIWDSANKTWK
ELATCRSTSFNVQDLLPDHETKFRVRAINVTGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEER
LGSGKFGQVFRLVEKKTRKVWAGKFFKATSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTE
RECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINTEPIGYATDMWSIGV
ICYILNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEE
DVSQAFLEAVAEEKPHVKPTFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKY

>In-frame_MYH11_ENST00000452625_chr16_15809021_-_MYLK_ENST00000360304_chr3_123383105_-_2516aa
MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVTVGKDDIQKMNPPKFSKVEDM
AELTCLNEASVLHNLRERYFSGLITTYSGLFCVVVNPTKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGES
GAGKTENTKKVIQYLAVVASSHKGKKDTSITQGPSFAYGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIET
TLLEKSRAIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVSSV
LQLGNIVFKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKEQADFAVEALAKATTERLFRWILTRVNKA
LDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLA
LLDEECWFPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHTAGKVDTNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVD
RIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQ
GFPNRIVFQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDVIMAFQAMCRGYLAR
KAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQ
EQLQAETELTAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKL
EDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIAD
LQAQIAELKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTA
TQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHK
KKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEE
ERNSLQDQLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEKAAATDKLEKTKNRLQQELDDLV
VDLDNQRQLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDV
GKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHETETELEDERKQRA
LAAAAKKKLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAERAR
KQADLEKEELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQ
NKELRSKLHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQVEDERKMAEQYKEQIQESEHMKVENS
ENGSKLTILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWTGSSTDGGSAVQSYSIEIWDSANKTWK
ELATCRSTSFNVQDLLPDHETKFRVRAINVTGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEER
LGSGKFGQVFRLVEKKTRKVWAGKFFKATSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTE
RECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINTEPIGYATDMWSIGV
ICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKY
MARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPTFSKTIRDLEVVEGSAARFD

>In-frame_MYH11_ENST00000576790_chr16_15809021_-_MYLK_ENST00000360772_chr3_123383105_-_2458aa
MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVTVGKDDIQKMNPPKFSKVEDM
AELTCLNEASVLHNLRERYFSGLITTYSGLFCVVVNPTKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGES
GAGKTENTKKVIQYLAVVASSHKGKKDTSITGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETTLLEKSR
AIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVSSVLQLGNIV
FKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKEQADFAVEALAKATTERLFRWILTRVNKALDKTHRQ
GASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECW
FPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHTAGKVDTNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQ
MAKMTESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDVIMAFQAMCRGYLARKAFAKRQ
QQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAET
ELTAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDEILVM
DDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAE
LKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRA
KREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQ
VQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEERNSLQD
QLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEKAAATDKLEKTKNRLQQELDDLVVDLDNQR
QLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHEL
EKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHETETELEDERKQRALAAAAKK
KLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAERARKQADLEK
EELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSK
LHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQVEDERKMAEQYKEQIQESEHMKVENSENGSKLT
ILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWTGSSTDGGSAVQSYSIEIWDSANKTWKELATCRS
TSFNVQDLLPDHETKFRVRAINVTGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFG
QVFRLVEKKTRKVWAGKFFKATSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYM
RQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINTEPIGYATDMWSIGVICYILNR
LDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFL
EAVAEEKPHVKPTFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNS

>In-frame_MYH11_ENST00000576790_chr16_15809021_-_MYLK_ENST00000359169_chr3_123383105_-_2458aa
MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVTVGKDDIQKMNPPKFSKVEDM
AELTCLNEASVLHNLRERYFSGLITTYSGLFCVVVNPTKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGES
GAGKTENTKKVIQYLAVVASSHKGKKDTSITGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETTLLEKSR
AIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVSSVLQLGNIV
FKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKEQADFAVEALAKATTERLFRWILTRVNKALDKTHRQ
GASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECW
FPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHTAGKVDTNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQ
MAKMTESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDVIMAFQAMCRGYLARKAFAKRQ
QQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAET
ELTAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDEILVM
DDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAE
LKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRA
KREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQ
VQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEERNSLQD
QLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEKAAATDKLEKTKNRLQQELDDLVVDLDNQR
QLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHEL
EKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHETETELEDERKQRALAAAAKK
KLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAERARKQADLEK
EELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSK
LHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQVEDERKMAEQYKEQIQESEHMKVENSENGSKLT
ILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWTGSSTDGGSAVQSYSIEIWDSANKTWKELATCRS
TSFNVQDLLPDHETKFRVRAINVTGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFG
QVFRLVEKKTRKVWAGKFFKATSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYM
RQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINTEPIGYATDMWSIGVICYILNR
LDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFL
EAVAEEKPHVKPTFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISDVCGDDDAKYTCKAVNS

>In-frame_MYH11_ENST00000576790_chr16_15809021_-_MYLK_ENST00000360304_chr3_123383105_-_2509aa
MAQKGQLSDDEKFLFVDKNFINSPVAQADWAAKRLVWVPSEKQGFEAASIKEEKGDEVVVELVENGKKVTVGKDDIQKMNPPKFSKVEDM
AELTCLNEASVLHNLRERYFSGLITTYSGLFCVVVNPTKHLPIYSEKIVDMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGES
GAGKTENTKKVIQYLAVVASSHKGKKDTSITGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETTLLEKSR
AIRQARDERTFHIFYYMIAGAKEKMRSDLLLEGFNNYTFLSNGFVPIPAAQDDEMFQETVEAMAIMGFSEEEQLSILKVVSSVLQLGNIV
FKKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKEQADFAVEALAKATTERLFRWILTRVNKALDKTHRQ
GASFLGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECW
FPKATDKSFVEKLCTEQGSHPKFQKPKQLKDKTEFSIIHTAGKVDTNASAWLTKNMDPLNDNVTSLLNASSDKFVADLWKDVDRIVGLDQ
MAKMTESSLPSASKTKKGMFRTVGQLYKEQLGKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEEERDLKITDVIMAFQAMCRGYLARKAFAKRQ
QQLTAMKVIQRNCAAYLKLRNWQWWRLFTKVKPLLQVTRQEEEMQAKEDELQKTKERQQKAENELKELEQKHSQLTEEKNLLQEQLQAET
ELTAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAERKKMAQQMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLEDEILVM
DDQNNKLSKERKLLEERISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGDASDFHEQIADLQAQIAE
LKMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELRA
KREQEVTVLKKALDEETRSHEAQVQEMRQKHAQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQ
VQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQLQDTQELLQEETRQKLNVSTKLRQLEEERNSLQD
QLDEEMEAKQNLERHISTLNIQLSDSKKKLQDFASTVEALEEGKKRFQKEIENLTQQYEEKAAATDKLEKTKNRLQQELDDLVVDLDNQR
QLVSNLEKKQRKFDQLLAEEKNISSKYADERDRAEAEAREKETKALSLARALEEALEAKEELERTNKMLKAEMEDLVSSKDDVGKNVHEL
EKSKRALETQMEEMKTQLEELEDELQATEDAKLRLEVNMQALKGQFERDLQARDEQNEEKRRQLQRQLHETETELEDERKQRALAAAAKK
KLEGDLKDLELQADSAIKGREEAIKQLRKLQAQMKDFQRELEDARASRDEIFATAKENEKKAKSLEADLMQLQEDLAAAERARKQADLEK
EELAEELASSLSGRNALQDEKRRLEARIAQLEEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSTAQKNESARQQLERQNKELRSK
LHEMEGAVKSKFKSTIAALEAKIAQLEEQVEQEAREKQAATKSLKQKDKKLKEILLQVEDERKMAEQYKEQIQESEHMKVENSENGSKLT
ILAARQEHCGCYTLLVENKLGSRQAQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWTGSSTDGGSAVQSYSIEIWDSANKTWKELATCRS
TSFNVQDLLPDHETKFRVRAINVTGTSEPSQESELTTVGEKPEEPKDEVEVSDDDEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFG
QVFRLVEKKTRKVWAGKFFKATSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYM
RQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINTEPIGYATDMWSIGVICYILVS
GLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQ
KTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPTFSKTIRDLEVVEGSAARFDCKIEGYP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MYH11_ENST00000452625_chr16_15809021_-_MYLK_ENST00000360772_chr3_123383105_-_7395nt
ATGGCGCAGAAGGGCCAACTCAGTGACGATGAGAAGTTCCTCTTTGTGGACAAAAACTTCATCAACAGCCCAGTGGCCCAGGCTGACTGG
GCCGCCAAGAGACTCGTCTGGGTCCCCTCGGAGAAGCAGGGCTTCGAGGCAGCCAGCATTAAGGAGGAGAAGGGGGATGAGGTGGTTGTG
GAGCTGGTGGAGAATGGCAAGAAGGTCACGGTTGGGAAAGATGACATCCAGAAGATGAACCCACCCAAGTTCTCCAAGGTGGAGGACATG
GCGGAGCTGACGTGCCTCAACGAAGCCTCCGTGCTACACAACCTGAGGGAGCGGTACTTCTCAGGGCTAATATATACGTACTCTGGCCTC
TTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGACATGTACAAGGGCAAGAAGAGGCACGAGATG
CCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAGGACCAGTCCATTCTATGCACAGGCGAGTCT
GGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCCTCCCACAAGGGCAAGAAAGACACAAGTATC
ACGCAAGGCCCATCTTTTGCCTACGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCTTTCGGCAACGCCAAAACA
GTGAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTGGGAGCCAACATTGAGACC
TATCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATGATTGCTGGAGCCAAGGAG
AAGATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATCCCAGCAGCCCAGGATGAT
GAGATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTGAAGGTGGTATCATCGGTC
CTGCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCTGCTCAGAAAGTTTGCCAC
CTCATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTGGTACAGAAAGCTCAGACA
AAAGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTCACCCGCGTGAACAAAGCC
CTGGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAGGTGAACTCCTTCGAGCAG
CTGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGC
ATCGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAACCCTCCAGGTGTGCTGGCC
CTGCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAGGGCAGCCACCCCAAGTTC
CAGAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAATGCGAGTGCCTGGCTGACC
AAGAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGACCTGTGGAAGGACGTGGAC
CGCATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAGGGCATGTTCCGCACAGTG
GGGCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGCTGCATCATCCCCAACCAC
GAGAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGCATTCGCATCTGCCGGCAG
GGCTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCCAAAGGCTTCATGGACGGG
AAGCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAAATCTTCTTCCGAACTGGC
GTCCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGTCGTGGCTACTTGGCCAGA
AAGGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTCAAGCTGCGGAACTGGCAG
TGGTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGATGAACTGCAGAAG
ACCAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAGGAGAAGAACCTGCTACAG
GAACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAGCAGGAGCTGGAGGAGATA
CTGCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAGATGGCCCAGCAGATGCTG
GACCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAGGCCAAGATCAAGAAACTG
GAGGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGGATTAGTGACTTAACGACA
AATCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCAGAACTGGAAGTGCGGCTA
AAGAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTCCACGAGCAGATCGCTGAC
CTCCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCCAGGCTTGACGATGAAATC
GCTCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTGGACTCAGAGCGGGCCGCC
AGGAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGACACACTGGACAGCACAGCC
ACTCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACGCGGTCCCATGAGGCTCAG
GTCCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGGGCCAAGGCGAACCTAGAC
AAGAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAGCAGGAGGTGGAACATAAG
AAGAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAGCTCAATGACAAAGTCCAC
AAGCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCCAAGGACGTGGCGTCCCTC
AGTTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAGCTGCGCCAGCTGGAGGAG
GAGCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCCACTCTCAACATCCAGCTC
TCCGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTCCAGAAGGAGATCGAGAAC
CTCACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAGGAGCTGGACGACCTGGTT
GTTGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTAGCCGAGGAGAAAAACATC
TCTTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCCCTGGCTCGGGCCCTTGAA
GAGGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTCAGCTCCAAGGATGACGTG
GGCAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGAC
GAGCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAAAGGGATCTCCAAGCCCGG
GACGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGACGAGCGAAAGCAACGTGCC
CTGGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATCAAGGGGAGGGAGGAAGCC
ATCAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCCAGAGATGAGATCTTTGCC
ACAGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCCGCCGCTGAGAGGGCTCGC
AAACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTCCAGGACGAGAAGCGCCGC
CTGGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGACCGGGTCCGCAAAGCCACA
CAGCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGGCAGCAGCTCGAGCGGCAG
AACAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCGGCGCTGGAGGCCAAGATT
GCACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAAGACAAGAAGCTGAAGGAA
ATCTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGC
GAGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGG
CAGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACC
CTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAG
GAACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTG
TATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGAT
GATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGA
TTAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCA
GCAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAA
GAAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAG
CGTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAG
AACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAG
GTCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTC
ATCTGCTACATCCTAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAA
CTCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCT
ATGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGAA
GATGTGTCCCAAGCTTTCCTTGAGGCTGTTGCTGAGGAAAAGCCTCATGTAAAACCCTATTTCTCTAAGACCATTCGCGATTTAGAAGTT
GTGGAGGGAAGTGCTGCTAGATTTGACTGCAAGATTGAAGGATACCCAGACCCCGAGGTTGTCTGGTTCAAAGATGACCAGTCAATCAGG
GAGTCCCGCCACTTCCAGATAGACTACGATGAGGACGGGAACTGCTCTTTAATTATTAGTGATGTTTGCGGGGATGACGATGCCAAGTAC
ACCTGCAAGGCTGTCAACAGTCTTGGAGAAGCCACCTGCACAGCAGAGCTCATTGTGGAAACGATGGAGGAAGGTGAAGGGGAAGGGGAA

>In-frame_MYH11_ENST00000452625_chr16_15809021_-_MYLK_ENST00000359169_chr3_123383105_-_7395nt
ATGGCGCAGAAGGGCCAACTCAGTGACGATGAGAAGTTCCTCTTTGTGGACAAAAACTTCATCAACAGCCCAGTGGCCCAGGCTGACTGG
GCCGCCAAGAGACTCGTCTGGGTCCCCTCGGAGAAGCAGGGCTTCGAGGCAGCCAGCATTAAGGAGGAGAAGGGGGATGAGGTGGTTGTG
GAGCTGGTGGAGAATGGCAAGAAGGTCACGGTTGGGAAAGATGACATCCAGAAGATGAACCCACCCAAGTTCTCCAAGGTGGAGGACATG
GCGGAGCTGACGTGCCTCAACGAAGCCTCCGTGCTACACAACCTGAGGGAGCGGTACTTCTCAGGGCTAATATATACGTACTCTGGCCTC
TTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGACATGTACAAGGGCAAGAAGAGGCACGAGATG
CCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAGGACCAGTCCATTCTATGCACAGGCGAGTCT
GGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCCTCCCACAAGGGCAAGAAAGACACAAGTATC
ACGCAAGGCCCATCTTTTGCCTACGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCTTTCGGCAACGCCAAAACA
GTGAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTGGGAGCCAACATTGAGACC
TATCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATGATTGCTGGAGCCAAGGAG
AAGATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATCCCAGCAGCCCAGGATGAT
GAGATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTGAAGGTGGTATCATCGGTC
CTGCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCTGCTCAGAAAGTTTGCCAC
CTCATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTGGTACAGAAAGCTCAGACA
AAAGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTCACCCGCGTGAACAAAGCC
CTGGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAGGTGAACTCCTTCGAGCAG
CTGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGC
ATCGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAACCCTCCAGGTGTGCTGGCC
CTGCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAGGGCAGCCACCCCAAGTTC
CAGAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAATGCGAGTGCCTGGCTGACC
AAGAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGACCTGTGGAAGGACGTGGAC
CGCATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAGGGCATGTTCCGCACAGTG
GGGCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGCTGCATCATCCCCAACCAC
GAGAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGCATTCGCATCTGCCGGCAG
GGCTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCCAAAGGCTTCATGGACGGG
AAGCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAAATCTTCTTCCGAACTGGC
GTCCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGTCGTGGCTACTTGGCCAGA
AAGGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTCAAGCTGCGGAACTGGCAG
TGGTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGATGAACTGCAGAAG
ACCAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAGGAGAAGAACCTGCTACAG
GAACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAGCAGGAGCTGGAGGAGATA
CTGCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAGATGGCCCAGCAGATGCTG
GACCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAGGCCAAGATCAAGAAACTG
GAGGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGGATTAGTGACTTAACGACA
AATCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCAGAACTGGAAGTGCGGCTA
AAGAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTCCACGAGCAGATCGCTGAC
CTCCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCCAGGCTTGACGATGAAATC
GCTCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTGGACTCAGAGCGGGCCGCC
AGGAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGACACACTGGACAGCACAGCC
ACTCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACGCGGTCCCATGAGGCTCAG
GTCCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGGGCCAAGGCGAACCTAGAC
AAGAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAGCAGGAGGTGGAACATAAG
AAGAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAGCTCAATGACAAAGTCCAC
AAGCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCCAAGGACGTGGCGTCCCTC
AGTTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAGCTGCGCCAGCTGGAGGAG
GAGCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCCACTCTCAACATCCAGCTC
TCCGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTCCAGAAGGAGATCGAGAAC
CTCACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAGGAGCTGGACGACCTGGTT
GTTGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTAGCCGAGGAGAAAAACATC
TCTTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCCCTGGCTCGGGCCCTTGAA
GAGGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTCAGCTCCAAGGATGACGTG
GGCAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGAC
GAGCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAAAGGGATCTCCAAGCCCGG
GACGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGACGAGCGAAAGCAACGTGCC
CTGGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATCAAGGGGAGGGAGGAAGCC
ATCAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCCAGAGATGAGATCTTTGCC
ACAGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCCGCCGCTGAGAGGGCTCGC
AAACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTCCAGGACGAGAAGCGCCGC
CTGGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGACCGGGTCCGCAAAGCCACA
CAGCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGGCAGCAGCTCGAGCGGCAG
AACAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCGGCGCTGGAGGCCAAGATT
GCACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAAGACAAGAAGCTGAAGGAA
ATCTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGC
GAGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGG
CAGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACC
CTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAG
GAACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTG
TATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGAT
GATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGA
TTAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCA
GCAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAA
GAAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAG
CGTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAG
AACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAG
GTCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTC
ATCTGCTACATCCTAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAA
CTCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCT
ATGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGAA
GATGTGTCCCAAGCTTTCCTTGAGGCTGTTGCTGAGGAAAAGCCTCATGTAAAACCCTATTTCTCTAAGACCATTCGCGATTTAGAAGTT
GTGGAGGGAAGTGCTGCTAGATTTGACTGCAAGATTGAAGGATACCCAGACCCCGAGGTTGTCTGGTTCAAAGATGACCAGTCAATCAGG
GAGTCCCGCCACTTCCAGATAGACTACGATGAGGACGGGAACTGCTCTTTAATTATTAGTGATGTTTGCGGGGATGACGATGCCAAGTAC
ACCTGCAAGGCTGTCAACAGTCTTGGAGAAGCCACCTGCACAGCAGAGCTCATTGTGGAAACGATGGAGGAAGGTGAAGGGGAAGGGGAA

>In-frame_MYH11_ENST00000452625_chr16_15809021_-_MYLK_ENST00000360304_chr3_123383105_-_7548nt
ATGGCGCAGAAGGGCCAACTCAGTGACGATGAGAAGTTCCTCTTTGTGGACAAAAACTTCATCAACAGCCCAGTGGCCCAGGCTGACTGG
GCCGCCAAGAGACTCGTCTGGGTCCCCTCGGAGAAGCAGGGCTTCGAGGCAGCCAGCATTAAGGAGGAGAAGGGGGATGAGGTGGTTGTG
GAGCTGGTGGAGAATGGCAAGAAGGTCACGGTTGGGAAAGATGACATCCAGAAGATGAACCCACCCAAGTTCTCCAAGGTGGAGGACATG
GCGGAGCTGACGTGCCTCAACGAAGCCTCCGTGCTACACAACCTGAGGGAGCGGTACTTCTCAGGGCTAATATATACGTACTCTGGCCTC
TTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGACATGTACAAGGGCAAGAAGAGGCACGAGATG
CCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAGGACCAGTCCATTCTATGCACAGGCGAGTCT
GGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCCTCCCACAAGGGCAAGAAAGACACAAGTATC
ACGCAAGGCCCATCTTTTGCCTACGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCTTTCGGCAACGCCAAAACA
GTGAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTGGGAGCCAACATTGAGACC
TATCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATGATTGCTGGAGCCAAGGAG
AAGATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATCCCAGCAGCCCAGGATGAT
GAGATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTGAAGGTGGTATCATCGGTC
CTGCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCTGCTCAGAAAGTTTGCCAC
CTCATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTGGTACAGAAAGCTCAGACA
AAAGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTCACCCGCGTGAACAAAGCC
CTGGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAGGTGAACTCCTTCGAGCAG
CTGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGC
ATCGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAACCCTCCAGGTGTGCTGGCC
CTGCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAGGGCAGCCACCCCAAGTTC
CAGAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAATGCGAGTGCCTGGCTGACC
AAGAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGACCTGTGGAAGGACGTGGAC
CGCATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAGGGCATGTTCCGCACAGTG
GGGCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGCTGCATCATCCCCAACCAC
GAGAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGCATTCGCATCTGCCGGCAG
GGCTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCCAAAGGCTTCATGGACGGG
AAGCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAAATCTTCTTCCGAACTGGC
GTCCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGTCGTGGCTACTTGGCCAGA
AAGGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTCAAGCTGCGGAACTGGCAG
TGGTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGATGAACTGCAGAAG
ACCAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAGGAGAAGAACCTGCTACAG
GAACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAGCAGGAGCTGGAGGAGATA
CTGCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAGATGGCCCAGCAGATGCTG
GACCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAGGCCAAGATCAAGAAACTG
GAGGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGGATTAGTGACTTAACGACA
AATCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCAGAACTGGAAGTGCGGCTA
AAGAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTCCACGAGCAGATCGCTGAC
CTCCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCCAGGCTTGACGATGAAATC
GCTCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTGGACTCAGAGCGGGCCGCC
AGGAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGACACACTGGACAGCACAGCC
ACTCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACGCGGTCCCATGAGGCTCAG
GTCCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGGGCCAAGGCGAACCTAGAC
AAGAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAGCAGGAGGTGGAACATAAG
AAGAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAGCTCAATGACAAAGTCCAC
AAGCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCCAAGGACGTGGCGTCCCTC
AGTTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAGCTGCGCCAGCTGGAGGAG
GAGCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCCACTCTCAACATCCAGCTC
TCCGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTCCAGAAGGAGATCGAGAAC
CTCACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAGGAGCTGGACGACCTGGTT
GTTGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTAGCCGAGGAGAAAAACATC
TCTTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCCCTGGCTCGGGCCCTTGAA
GAGGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTCAGCTCCAAGGATGACGTG
GGCAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGAC
GAGCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAAAGGGATCTCCAAGCCCGG
GACGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGACGAGCGAAAGCAACGTGCC
CTGGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATCAAGGGGAGGGAGGAAGCC
ATCAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCCAGAGATGAGATCTTTGCC
ACAGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCCGCCGCTGAGAGGGCTCGC
AAACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTCCAGGACGAGAAGCGCCGC
CTGGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGACCGGGTCCGCAAAGCCACA
CAGCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGGCAGCAGCTCGAGCGGCAG
AACAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCGGCGCTGGAGGCCAAGATT
GCACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAAGACAAGAAGCTGAAGGAA
ATCTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGC
GAGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGG
CAGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACC
CTGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAG
GAACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTG
TATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGAT
GATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGA
TTAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCA
GCAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAA
GAAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAG
CGTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAG
AACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAG
GTCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTC
ATCTGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGAC
TTCGACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGAC
TGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTAC
ATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGC
AGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGAAGATGTGTCCCAAGCTTTCCTTGAGGCT
GTTGCTGAGGAAAAGCCTCATGTAAAACCCTATTTCTCTAAGACCATTCGCGATTTAGAAGTTGTGGAGGGAAGTGCTGCTAGATTTGAC
TGCAAGATTGAAGGATACCCAGACCCCGAGGTTGTCTGGTTCAAAGATGACCAGTCAATCAGGGAGTCCCGCCACTTCCAGATAGACTAC
GATGAGGACGGGAACTGCTCTTTAATTATTAGTGATGTTTGCGGGGATGACGATGCCAAGTACACCTGCAAGGCTGTCAACAGTCTTGGA

>In-frame_MYH11_ENST00000576790_chr16_15809021_-_MYLK_ENST00000360772_chr3_123383105_-_7374nt
ATGGCGCAGAAGGGCCAACTCAGTGACGATGAGAAGTTCCTCTTTGTGGACAAAAACTTCATCAACAGCCCAGTGGCCCAGGCTGACTGG
GCCGCCAAGAGACTCGTCTGGGTCCCCTCGGAGAAGCAGGGCTTCGAGGCAGCCAGCATTAAGGAGGAGAAGGGGGATGAGGTGGTTGTG
GAGCTGGTGGAGAATGGCAAGAAGGTCACGGTTGGGAAAGATGACATCCAGAAGATGAACCCACCCAAGTTCTCCAAGGTGGAGGACATG
GCGGAGCTGACGTGCCTCAACGAAGCCTCCGTGCTACACAACCTGAGGGAGCGGTACTTCTCAGGGCTAATATATACGTACTCTGGCCTC
TTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGACATGTACAAGGGCAAGAAGAGGCACGAGATG
CCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAGGACCAGTCCATTCTATGCACAGGCGAGTCT
GGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCCTCCCACAAGGGCAAGAAAGACACAAGTATC
ACGGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCTTTCGGCAACGCCAAAACAGTGAAGAACGACAACTCCTCA
CGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTGGGAGCCAACATTGAGACCTATCTGCTAGAAAAATCACGG
GCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATGATTGCTGGAGCCAAGGAGAAGATGAGAAGTGACTTGCTT
TTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATCCCAGCAGCCCAGGATGATGAGATGTTCCAGGAAACCGTG
GAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTGAAGGTGGTATCATCGGTCCTGCAGCTTGGAAATATCGTC
TTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCTGCTCAGAAAGTTTGCCACCTCATGGGAATTAATGTGACA
GATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTGGTACAGAAAGCTCAGACAAAAGAACAGGCTGACTTTGCT
GTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTCACCCGCGTGAACAAAGCCCTGGACAAGACCCATCGGCAA
GGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAGGTGAACTCCTTCGAGCAGCTGTGCATCAACTACACCAAC
GAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGCATCGAGTGGAACTTCATCGAC
TTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAACCCTCCAGGTGTGCTGGCCCTGCTGGACGAGGAATGCTGG
TTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAGGGCAGCCACCCCAAGTTCCAGAAGCCCAAGCAGCTCAAG
GACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAATGCGAGTGCCTGGCTGACCAAGAATATGGACCCGCTGAAT
GACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGACCTGTGGAAGGACGTGGACCGCATCGTGGGCCTGGACCAG
ATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAGGGCATGTTCCGCACAGTGGGGCAGCTGTACAAGGAGCAG
CTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGCTGCATCATCCCCAACCACGAGAAGAGGTCCGGCAAGCTG
GATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGCATTCGCATCTGCCGGCAGGGCTTCCCCAACCGGATCGTC
TTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCCAAAGGCTTCATGGACGGGAAGCAGGCCTGCATTCTCATG
ATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAAATCTTCTTCCGAACTGGCGTCCTGGCCCACCTAGAGGAG
GAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGTCGTGGCTACTTGGCCAGAAAGGCTTTTGCCAAGAGGCAG
CAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTCAAGCTGCGGAACTGGCAGTGGTGGAGGCTTTTCACCAAA
GTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGATGAACTGCAGAAGACCAAGGAGCGGCAGCAGAAG
GCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAGGAGAAGAACCTGCTACAGGAACAGCTGCAGGCAGAGACA
GAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAGCAGGAGCTGGAGGAGATACTGCATGAGATGGAGGCCCGC
CTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAGATGGCCCAGCAGATGCTGGACCTTGAAGAACAGCTGGAG
GAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAGGCCAAGATCAAGAAACTGGAGGATGAGATCCTGGTCATG
GATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGGATTAGTGACTTAACGACAAATCTTGCAGAAGAGGAAGAA
AAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCAGAACTGGAAGTGCGGCTAAAGAAGGAAGAGAAGAGCCGA
CAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTCCACGAGCAGATCGCTGACCTCCAGGCGCAGATCGCAGAG
CTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCCAGGCTTGACGATGAAATCGCTCAGAAGAACAATGCCCTG
AAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTGGACTCAGAGCGGGCCGCCAGGAACAAGGCTGAAAAGCAG
AAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGACACACTGGACAGCACAGCCACTCAGCAGGAGCTCAGGGCC
AAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACGCGGTCCCATGAGGCTCAGGTCCAGGAGATGAGGCAGAAA
CACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGGGCCAAGGCGAACCTAGACAAGAATAAGCAGACGCTGGAG
AAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAGCAGGAGGTGGAACATAAGAAGAAGAAGCTGGAGGCGCAG
GTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAGCTCAATGACAAAGTCCACAAGCTGCAGAATGAAGTTGAG
AGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCCAAGGACGTGGCGTCCCTCAGTTCCCAGCTCCAGGACACC
CAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAGCTGCGCCAGCTGGAGGAGGAGCGGAACAGCCTGCAAGAC
CAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCCACTCTCAACATCCAGCTCTCCGACTCGAAGAAGAAGCTG
CAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTCCAGAAGGAGATCGAGAACCTCACCCAGCAGTACGAGGAG
AAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAGGAGCTGGACGACCTGGTTGTTGATTTGGACAACCAGCGG
CAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTAGCCGAGGAGAAAAACATCTCTTCCAAATACGCGGATGAG
AGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCCCTGGCTCGGGCCCTTGAAGAGGCCTTGGAAGCCAAAGAG
GAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTCAGCTCCAAGGATGACGTGGGCAAGAACGTCCATGAGCTG
GAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGACGAGCTGCAAGCCACGGAGGAC
GCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAAAGGGATCTCCAAGCCCGGGACGAGCAGAATGAGGAGAAG
AGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGACGAGCGAAAGCAACGTGCCCTGGCAGCTGCAGCAAAGAAG
AAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATCAAGGGGAGGGAGGAAGCCATCAAGCAGCTACGCAAACTG
CAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCCAGAGATGAGATCTTTGCCACAGCCAAAGAGAATGAGAAG
AAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCCGCCGCTGAGAGGGCTCGCAAACAAGCGGACCTCGAGAAG
GAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTCCAGGACGAGAAGCGCCGCCTGGAGGCCCGGATCGCCCAG
CTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGACCGGGTCCGCAAAGCCACACAGCAGGCCGAGCAGCTCAGC
AACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGGCAGCAGCTCGAGCGGCAGAACAAGGAGCTCCGGAGCAAG
CTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCGGCGCTGGAGGCCAAGATTGCACAGCTGGAGGAGCAGGTC
GAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAAGACAAGAAGCTGAAGGAAATCTTGCTGCAGGTGGAGGAC
GAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAGAATGGCAGCAAGCTCACC
ATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAGGCCCAGGTCAACCTCACT
GTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTGTCCTGGTATGGCTCCTCA
TATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAACTAGCCACATGCCGCAGC
ACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTATGGAACCAGTGAGCCAAGC
CAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGATGATGAGAAGGAGCCCGAG
GTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTAGGATCTGGGAAATTTGGA
CAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCAAAAGAGAAAGAGAATATC
CGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAAAAGGCCAACATCGTCATG
GTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGTGAGTGCATCAAGTACATG
CGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAACATCATGTGTGTCAACAAG
ACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTCCTCTTTGGCACCCCAGAA
TTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATCTGCTACATCCTAAACCGC
CTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAG
AAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTC
AGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGAAGATGTGTCCCAAGCTTTCCTT
GAGGCTGTTGCTGAGGAAAAGCCTCATGTAAAACCCTATTTCTCTAAGACCATTCGCGATTTAGAAGTTGTGGAGGGAAGTGCTGCTAGA
TTTGACTGCAAGATTGAAGGATACCCAGACCCCGAGGTTGTCTGGTTCAAAGATGACCAGTCAATCAGGGAGTCCCGCCACTTCCAGATA
GACTACGATGAGGACGGGAACTGCTCTTTAATTATTAGTGATGTTTGCGGGGATGACGATGCCAAGTACACCTGCAAGGCTGTCAACAGT

>In-frame_MYH11_ENST00000576790_chr16_15809021_-_MYLK_ENST00000359169_chr3_123383105_-_7374nt
ATGGCGCAGAAGGGCCAACTCAGTGACGATGAGAAGTTCCTCTTTGTGGACAAAAACTTCATCAACAGCCCAGTGGCCCAGGCTGACTGG
GCCGCCAAGAGACTCGTCTGGGTCCCCTCGGAGAAGCAGGGCTTCGAGGCAGCCAGCATTAAGGAGGAGAAGGGGGATGAGGTGGTTGTG
GAGCTGGTGGAGAATGGCAAGAAGGTCACGGTTGGGAAAGATGACATCCAGAAGATGAACCCACCCAAGTTCTCCAAGGTGGAGGACATG
GCGGAGCTGACGTGCCTCAACGAAGCCTCCGTGCTACACAACCTGAGGGAGCGGTACTTCTCAGGGCTAATATATACGTACTCTGGCCTC
TTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGACATGTACAAGGGCAAGAAGAGGCACGAGATG
CCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAGGACCAGTCCATTCTATGCACAGGCGAGTCT
GGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCCTCCCACAAGGGCAAGAAAGACACAAGTATC
ACGGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCTTTCGGCAACGCCAAAACAGTGAAGAACGACAACTCCTCA
CGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTGGGAGCCAACATTGAGACCTATCTGCTAGAAAAATCACGG
GCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATGATTGCTGGAGCCAAGGAGAAGATGAGAAGTGACTTGCTT
TTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATCCCAGCAGCCCAGGATGATGAGATGTTCCAGGAAACCGTG
GAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTGAAGGTGGTATCATCGGTCCTGCAGCTTGGAAATATCGTC
TTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCTGCTCAGAAAGTTTGCCACCTCATGGGAATTAATGTGACA
GATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTGGTACAGAAAGCTCAGACAAAAGAACAGGCTGACTTTGCT
GTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTCACCCGCGTGAACAAAGCCCTGGACAAGACCCATCGGCAA
GGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAGGTGAACTCCTTCGAGCAGCTGTGCATCAACTACACCAAC
GAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGCATCGAGTGGAACTTCATCGAC
TTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAACCCTCCAGGTGTGCTGGCCCTGCTGGACGAGGAATGCTGG
TTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAGGGCAGCCACCCCAAGTTCCAGAAGCCCAAGCAGCTCAAG
GACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAATGCGAGTGCCTGGCTGACCAAGAATATGGACCCGCTGAAT
GACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGACCTGTGGAAGGACGTGGACCGCATCGTGGGCCTGGACCAG
ATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAGGGCATGTTCCGCACAGTGGGGCAGCTGTACAAGGAGCAG
CTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGCTGCATCATCCCCAACCACGAGAAGAGGTCCGGCAAGCTG
GATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGCATTCGCATCTGCCGGCAGGGCTTCCCCAACCGGATCGTC
TTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCCAAAGGCTTCATGGACGGGAAGCAGGCCTGCATTCTCATG
ATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAAATCTTCTTCCGAACTGGCGTCCTGGCCCACCTAGAGGAG
GAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGTCGTGGCTACTTGGCCAGAAAGGCTTTTGCCAAGAGGCAG
CAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTCAAGCTGCGGAACTGGCAGTGGTGGAGGCTTTTCACCAAA
GTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGATGAACTGCAGAAGACCAAGGAGCGGCAGCAGAAG
GCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAGGAGAAGAACCTGCTACAGGAACAGCTGCAGGCAGAGACA
GAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAGCAGGAGCTGGAGGAGATACTGCATGAGATGGAGGCCCGC
CTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAGATGGCCCAGCAGATGCTGGACCTTGAAGAACAGCTGGAG
GAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAGGCCAAGATCAAGAAACTGGAGGATGAGATCCTGGTCATG
GATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGGATTAGTGACTTAACGACAAATCTTGCAGAAGAGGAAGAA
AAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCAGAACTGGAAGTGCGGCTAAAGAAGGAAGAGAAGAGCCGA
CAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTCCACGAGCAGATCGCTGACCTCCAGGCGCAGATCGCAGAG
CTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCCAGGCTTGACGATGAAATCGCTCAGAAGAACAATGCCCTG
AAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTGGACTCAGAGCGGGCCGCCAGGAACAAGGCTGAAAAGCAG
AAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGACACACTGGACAGCACAGCCACTCAGCAGGAGCTCAGGGCC
AAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACGCGGTCCCATGAGGCTCAGGTCCAGGAGATGAGGCAGAAA
CACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGGGCCAAGGCGAACCTAGACAAGAATAAGCAGACGCTGGAG
AAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAGCAGGAGGTGGAACATAAGAAGAAGAAGCTGGAGGCGCAG
GTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAGCTCAATGACAAAGTCCACAAGCTGCAGAATGAAGTTGAG
AGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCCAAGGACGTGGCGTCCCTCAGTTCCCAGCTCCAGGACACC
CAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAGCTGCGCCAGCTGGAGGAGGAGCGGAACAGCCTGCAAGAC
CAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCCACTCTCAACATCCAGCTCTCCGACTCGAAGAAGAAGCTG
CAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTCCAGAAGGAGATCGAGAACCTCACCCAGCAGTACGAGGAG
AAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAGGAGCTGGACGACCTGGTTGTTGATTTGGACAACCAGCGG
CAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTAGCCGAGGAGAAAAACATCTCTTCCAAATACGCGGATGAG
AGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCCCTGGCTCGGGCCCTTGAAGAGGCCTTGGAAGCCAAAGAG
GAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTCAGCTCCAAGGATGACGTGGGCAAGAACGTCCATGAGCTG
GAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGACGAGCTGCAAGCCACGGAGGAC
GCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAAAGGGATCTCCAAGCCCGGGACGAGCAGAATGAGGAGAAG
AGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGACGAGCGAAAGCAACGTGCCCTGGCAGCTGCAGCAAAGAAG
AAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATCAAGGGGAGGGAGGAAGCCATCAAGCAGCTACGCAAACTG
CAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCCAGAGATGAGATCTTTGCCACAGCCAAAGAGAATGAGAAG
AAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCCGCCGCTGAGAGGGCTCGCAAACAAGCGGACCTCGAGAAG
GAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTCCAGGACGAGAAGCGCCGCCTGGAGGCCCGGATCGCCCAG
CTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGACCGGGTCCGCAAAGCCACACAGCAGGCCGAGCAGCTCAGC
AACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGGCAGCAGCTCGAGCGGCAGAACAAGGAGCTCCGGAGCAAG
CTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCGGCGCTGGAGGCCAAGATTGCACAGCTGGAGGAGCAGGTC
GAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAAGACAAGAAGCTGAAGGAAATCTTGCTGCAGGTGGAGGAC
GAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAGAATGGCAGCAAGCTCACC
ATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAGGCCCAGGTCAACCTCACT
GTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTGTCCTGGTATGGCTCCTCA
TATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAACTAGCCACATGCCGCAGC
ACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTATGGAACCAGTGAGCCAAGC
CAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGATGATGAGAAGGAGCCCGAG
GTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTAGGATCTGGGAAATTTGGA
CAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCAAAAGAGAAAGAGAATATC
CGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAAAAGGCCAACATCGTCATG
GTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGTGAGTGCATCAAGTACATG
CGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAACATCATGTGTGTCAACAAG
ACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTCCTCTTTGGCACCCCAGAA
TTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATCTGCTACATCCTAAACCGC
CTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAG
AAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTC
AGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGAAGATGTGTCCCAAGCTTTCCTT
GAGGCTGTTGCTGAGGAAAAGCCTCATGTAAAACCCTATTTCTCTAAGACCATTCGCGATTTAGAAGTTGTGGAGGGAAGTGCTGCTAGA
TTTGACTGCAAGATTGAAGGATACCCAGACCCCGAGGTTGTCTGGTTCAAAGATGACCAGTCAATCAGGGAGTCCCGCCACTTCCAGATA
GACTACGATGAGGACGGGAACTGCTCTTTAATTATTAGTGATGTTTGCGGGGATGACGATGCCAAGTACACCTGCAAGGCTGTCAACAGT

>In-frame_MYH11_ENST00000576790_chr16_15809021_-_MYLK_ENST00000360304_chr3_123383105_-_7527nt
ATGGCGCAGAAGGGCCAACTCAGTGACGATGAGAAGTTCCTCTTTGTGGACAAAAACTTCATCAACAGCCCAGTGGCCCAGGCTGACTGG
GCCGCCAAGAGACTCGTCTGGGTCCCCTCGGAGAAGCAGGGCTTCGAGGCAGCCAGCATTAAGGAGGAGAAGGGGGATGAGGTGGTTGTG
GAGCTGGTGGAGAATGGCAAGAAGGTCACGGTTGGGAAAGATGACATCCAGAAGATGAACCCACCCAAGTTCTCCAAGGTGGAGGACATG
GCGGAGCTGACGTGCCTCAACGAAGCCTCCGTGCTACACAACCTGAGGGAGCGGTACTTCTCAGGGCTAATATATACGTACTCTGGCCTC
TTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGACATGTACAAGGGCAAGAAGAGGCACGAGATG
CCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAGGACCAGTCCATTCTATGCACAGGCGAGTCT
GGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCCTCCCACAAGGGCAAGAAAGACACAAGTATC
ACGGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCTTTCGGCAACGCCAAAACAGTGAAGAACGACAACTCCTCA
CGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTGGGAGCCAACATTGAGACCTATCTGCTAGAAAAATCACGG
GCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATGATTGCTGGAGCCAAGGAGAAGATGAGAAGTGACTTGCTT
TTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATCCCAGCAGCCCAGGATGATGAGATGTTCCAGGAAACCGTG
GAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTGAAGGTGGTATCATCGGTCCTGCAGCTTGGAAATATCGTC
TTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCTGCTCAGAAAGTTTGCCACCTCATGGGAATTAATGTGACA
GATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTGGTACAGAAAGCTCAGACAAAAGAACAGGCTGACTTTGCT
GTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTCACCCGCGTGAACAAAGCCCTGGACAAGACCCATCGGCAA
GGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAGGTGAACTCCTTCGAGCAGCTGTGCATCAACTACACCAAC
GAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGCATCGAGTGGAACTTCATCGAC
TTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAACCCTCCAGGTGTGCTGGCCCTGCTGGACGAGGAATGCTGG
TTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAGGGCAGCCACCCCAAGTTCCAGAAGCCCAAGCAGCTCAAG
GACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAATGCGAGTGCCTGGCTGACCAAGAATATGGACCCGCTGAAT
GACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGACCTGTGGAAGGACGTGGACCGCATCGTGGGCCTGGACCAG
ATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAGGGCATGTTCCGCACAGTGGGGCAGCTGTACAAGGAGCAG
CTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGCTGCATCATCCCCAACCACGAGAAGAGGTCCGGCAAGCTG
GATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGCATTCGCATCTGCCGGCAGGGCTTCCCCAACCGGATCGTC
TTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCCAAAGGCTTCATGGACGGGAAGCAGGCCTGCATTCTCATG
ATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAAATCTTCTTCCGAACTGGCGTCCTGGCCCACCTAGAGGAG
GAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGTCGTGGCTACTTGGCCAGAAAGGCTTTTGCCAAGAGGCAG
CAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTCAAGCTGCGGAACTGGCAGTGGTGGAGGCTTTTCACCAAA
GTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGATGAACTGCAGAAGACCAAGGAGCGGCAGCAGAAG
GCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAGGAGAAGAACCTGCTACAGGAACAGCTGCAGGCAGAGACA
GAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAGCAGGAGCTGGAGGAGATACTGCATGAGATGGAGGCCCGC
CTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAGATGGCCCAGCAGATGCTGGACCTTGAAGAACAGCTGGAG
GAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAGGCCAAGATCAAGAAACTGGAGGATGAGATCCTGGTCATG
GATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGGATTAGTGACTTAACGACAAATCTTGCAGAAGAGGAAGAA
AAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCAGAACTGGAAGTGCGGCTAAAGAAGGAAGAGAAGAGCCGA
CAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTCCACGAGCAGATCGCTGACCTCCAGGCGCAGATCGCAGAG
CTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCCAGGCTTGACGATGAAATCGCTCAGAAGAACAATGCCCTG
AAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTGGACTCAGAGCGGGCCGCCAGGAACAAGGCTGAAAAGCAG
AAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGACACACTGGACAGCACAGCCACTCAGCAGGAGCTCAGGGCC
AAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACGCGGTCCCATGAGGCTCAGGTCCAGGAGATGAGGCAGAAA
CACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGGGCCAAGGCGAACCTAGACAAGAATAAGCAGACGCTGGAG
AAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAGCAGGAGGTGGAACATAAGAAGAAGAAGCTGGAGGCGCAG
GTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAGCTCAATGACAAAGTCCACAAGCTGCAGAATGAAGTTGAG
AGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCCAAGGACGTGGCGTCCCTCAGTTCCCAGCTCCAGGACACC
CAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAGCTGCGCCAGCTGGAGGAGGAGCGGAACAGCCTGCAAGAC
CAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCCACTCTCAACATCCAGCTCTCCGACTCGAAGAAGAAGCTG
CAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTCCAGAAGGAGATCGAGAACCTCACCCAGCAGTACGAGGAG
AAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAGGAGCTGGACGACCTGGTTGTTGATTTGGACAACCAGCGG
CAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTAGCCGAGGAGAAAAACATCTCTTCCAAATACGCGGATGAG
AGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCCCTGGCTCGGGCCCTTGAAGAGGCCTTGGAAGCCAAAGAG
GAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTCAGCTCCAAGGATGACGTGGGCAAGAACGTCCATGAGCTG
GAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGACGAGCTGCAAGCCACGGAGGAC
GCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAAAGGGATCTCCAAGCCCGGGACGAGCAGAATGAGGAGAAG
AGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGACGAGCGAAAGCAACGTGCCCTGGCAGCTGCAGCAAAGAAG
AAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATCAAGGGGAGGGAGGAAGCCATCAAGCAGCTACGCAAACTG
CAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCCAGAGATGAGATCTTTGCCACAGCCAAAGAGAATGAGAAG
AAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCCGCCGCTGAGAGGGCTCGCAAACAAGCGGACCTCGAGAAG
GAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTCCAGGACGAGAAGCGCCGCCTGGAGGCCCGGATCGCCCAG
CTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGACCGGGTCCGCAAAGCCACACAGCAGGCCGAGCAGCTCAGC
AACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGGCAGCAGCTCGAGCGGCAGAACAAGGAGCTCCGGAGCAAG
CTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCGGCGCTGGAGGCCAAGATTGCACAGCTGGAGGAGCAGGTC
GAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAAGACAAGAAGCTGAAGGAAATCTTGCTGCAGGTGGAGGAC
GAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGAGAATGGCAGCAAGCTCACC
ATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCAGGCCCAGGTCAACCTCACT
GTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCTGTCCTGGTATGGCTCCTCA
TATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGAACTAGCCACATGCCGCAGC
ACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTATGGAACCAGTGAGCCAAGC
CAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGATGATGAGAAGGAGCCCGAG
GTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATTAGGATCTGGGAAATTTGGA
CAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGCAAAAGAGAAAGAGAATATC
CGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGAAAAGGCCAACATCGTCATG
GTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCGTGAGTGCATCAAGTACATG
CGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAACATCATGTGTGTCAACAAG
ACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGTCCTCTTTGGCACCCCAGAA
TTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCATCTGCTACATCCTAGTCAGT
GGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTTCGACGACGAGGCATTCGAT
GAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTGCACGCAGTGCCTTCAGCAT
CCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAG
AAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCA
CCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGAAGATGTGTCCCAAGCTTTCCTTGAGGCTGTTGCTGAGGAAAAGCCTCAT
GTAAAACCCTATTTCTCTAAGACCATTCGCGATTTAGAAGTTGTGGAGGGAAGTGCTGCTAGATTTGACTGCAAGATTGAAGGATACCCA
GACCCCGAGGTTGTCTGGTTCAAAGATGACCAGTCAATCAGGGAGTCCCGCCACTTCCAGATAGACTACGATGAGGACGGGAACTGCTCT
TTAATTATTAGTGATGTTTGCGGGGATGACGATGCCAAGTACACCTGCAAGGCTGTCAACAGTCTTGGAGAAGCCACCTGCACAGCAGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MYH11_ENST00000452625_chr16_15809021_-_MYLK_ENST00000360772_chr3_123383105_-_11539nt
GCCTGGGAGGTGCGTCAGATCCGAGCTCGCCATCCAGTTTCCTCTCCACTAGTCCCCCCAGTTGGAGATCTGGGACCAACAAGGCACCAT
GGCGCAGAAGGGCCAACTCAGTGACGATGAGAAGTTCCTCTTTGTGGACAAAAACTTCATCAACAGCCCAGTGGCCCAGGCTGACTGGGC
CGCCAAGAGACTCGTCTGGGTCCCCTCGGAGAAGCAGGGCTTCGAGGCAGCCAGCATTAAGGAGGAGAAGGGGGATGAGGTGGTTGTGGA
GCTGGTGGAGAATGGCAAGAAGGTCACGGTTGGGAAAGATGACATCCAGAAGATGAACCCACCCAAGTTCTCCAAGGTGGAGGACATGGC
GGAGCTGACGTGCCTCAACGAAGCCTCCGTGCTACACAACCTGAGGGAGCGGTACTTCTCAGGGCTAATATATACGTACTCTGGCCTCTT
CTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGACATGTACAAGGGCAAGAAGAGGCACGAGATGCC
GCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAGGACCAGTCCATTCTATGCACAGGCGAGTCTGG
AGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCCTCCCACAAGGGCAAGAAAGACACAAGTATCAC
GCAAGGCCCATCTTTTGCCTACGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCTTTCGGCAACGCCAAAACAGT
GAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTGGGAGCCAACATTGAGACCTA
TCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATGATTGCTGGAGCCAAGGAGAA
GATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATCCCAGCAGCCCAGGATGATGA
GATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTGAAGGTGGTATCATCGGTCCT
GCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCTGCTCAGAAAGTTTGCCACCT
CATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTGGTACAGAAAGCTCAGACAAA
AGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTCACCCGCGTGAACAAAGCCCT
GGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAGGTGAACTCCTTCGAGCAGCT
GTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGCAT
CGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAACCCTCCAGGTGTGCTGGCCCT
GCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAGGGCAGCCACCCCAAGTTCCA
GAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAATGCGAGTGCCTGGCTGACCAA
GAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGACCTGTGGAAGGACGTGGACCG
CATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAGGGCATGTTCCGCACAGTGGG
GCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGCTGCATCATCCCCAACCACGA
GAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGCATTCGCATCTGCCGGCAGGG
CTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCCAAAGGCTTCATGGACGGGAA
GCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAAATCTTCTTCCGAACTGGCGT
CCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGTCGTGGCTACTTGGCCAGAAA
GGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTCAAGCTGCGGAACTGGCAGTG
GTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGATGAACTGCAGAAGAC
CAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAGGAGAAGAACCTGCTACAGGA
ACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAGCAGGAGCTGGAGGAGATACT
GCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAGATGGCCCAGCAGATGCTGGA
CCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAGGCCAAGATCAAGAAACTGGA
GGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGGATTAGTGACTTAACGACAAA
TCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCAGAACTGGAAGTGCGGCTAAA
GAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTCCACGAGCAGATCGCTGACCT
CCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCCAGGCTTGACGATGAAATCGC
TCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTGGACTCAGAGCGGGCCGCCAG
GAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGACACACTGGACAGCACAGCCAC
TCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACGCGGTCCCATGAGGCTCAGGT
CCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGGGCCAAGGCGAACCTAGACAA
GAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAGCAGGAGGTGGAACATAAGAA
GAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAGCTCAATGACAAAGTCCACAA
GCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCCAAGGACGTGGCGTCCCTCAG
TTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAGCTGCGCCAGCTGGAGGAGGA
GCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCCACTCTCAACATCCAGCTCTC
CGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTCCAGAAGGAGATCGAGAACCT
CACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAGGAGCTGGACGACCTGGTTGT
TGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTAGCCGAGGAGAAAAACATCTC
TTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCCCTGGCTCGGGCCCTTGAAGA
GGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTCAGCTCCAAGGATGACGTGGG
CAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGACGA
GCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAAAGGGATCTCCAAGCCCGGGA
CGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGACGAGCGAAAGCAACGTGCCCT
GGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATCAAGGGGAGGGAGGAAGCCAT
CAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCCAGAGATGAGATCTTTGCCAC
AGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCCGCCGCTGAGAGGGCTCGCAA
ACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTCCAGGACGAGAAGCGCCGCCT
GGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGACCGGGTCCGCAAAGCCACACA
GCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGGCAGCAGCTCGAGCGGCAGAA
CAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCGGCGCTGGAGGCCAAGATTGC
ACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAAGACAAGAAGCTGAAGGAAAT
CTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGA
GAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCA
GGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCT
GTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGA
ACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTA
TGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGA
TGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATT
AGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGC
AAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGA
AAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCG
TGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAA
CATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGT
CCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCAT
CTGCTACATCCTAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACT
CTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTAT
GGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGAAGA
TGTGTCCCAAGCTTTCCTTGAGGCTGTTGCTGAGGAAAAGCCTCATGTAAAACCCTATTTCTCTAAGACCATTCGCGATTTAGAAGTTGT
GGAGGGAAGTGCTGCTAGATTTGACTGCAAGATTGAAGGATACCCAGACCCCGAGGTTGTCTGGTTCAAAGATGACCAGTCAATCAGGGA
GTCCCGCCACTTCCAGATAGACTACGATGAGGACGGGAACTGCTCTTTAATTATTAGTGATGTTTGCGGGGATGACGATGCCAAGTACAC
CTGCAAGGCTGTCAACAGTCTTGGAGAAGCCACCTGCACAGCAGAGCTCATTGTGGAAACGATGGAGGAAGGTGAAGGGGAAGGGGAAGA
GGAAGAAGAGTGAAACAAAGCCAGAGAAAAGCAGTTTCTAAGTCATATTAAAAGGACTATTTCTCTAAAACTCAAAAAAAAAAAAAAAAC
TCAAGATAGTAAAAGCACCTAGTGTGATAGATTATCGGTTAGGTCATTTGTGGGTTGATTCTTCAGAAACAGCAGTTGATACCTAGCAGC
GTTATTGATGGGCATTAATCTATGTTAGTTGGCACCTTAAGATACTAGTGCAGCTAGATTTCATTTAGGGAAATCACCAGTAACTTGACT
GACCAATTGATTTTAGAGAGAAAGTAACCAAACCAAATATTTATCTGGGCAAAGTCATAAATTCTCCACTTGAATGCGCTCATGAAAAAT
AAGGCCAAAACAAGAGTTCTGGGCCACAGCTCAGCCCAGAGGGTTCCTGGGGATGGGAGGCCTCTCTCTCCCCACCCCCTGACTCTAGAG
AACTGGGTTTTCTCCCAGTACTCCAGCAATTCATTTCTGAAAGCAGTTGAGCCACTTTATTCCAAAGTACACTGCAGATGTTCAAACTCT
CCATTTCTCTTTCCCCTTCCACCTGCCAGTTTTGCTGACTCTCAACTTGTCATGAGTGTAAGCATTAAGGACATTATGCTTCTTCGATTC
TGAAGACAGGTCCCTGCTCATGGATGACTCTGGCTTCCTTAGGAAAATATTTTTCTTCCAAAATCAGTAGGAAATCTAAACTTATCCCCT
CTTTGCAGATGTCTAGCAGCTTCAGACATTTGGTTAAGAACCCATGGGAAAAAAAAAATCCTTGCTAATGTGGTTTCCTTTGTAAACCAG
GATTCTTATTTGTGCTGTTATAGAATATCAGCTCTGAACGTGTGGTAAAGATTTTTGTGTTTGAATATAGGAGAAATCAGTTTGCTGAAA
AGTTAGTCTTAATTATCTATTGGCCACGATGAAACAGATTTCAACTGATAAAGAGCTGGAGAACTCCATGTACTTTGGAATCTCCTCCAA
GATAGCCAGAGTTTAATACATCTTCATTCTCAACACTCTCCAAAGAACTTGACCTACCTTATGGGTTCCATATTTTTCTTCTTAAATGTG
CATCAATCATGCCTTGCCCCCAACCTTTAAATATATTCTTAGACCTGGTAAATGCACTCAGACTTGCGTCTTTAGGAATTTTTAACTTTC
TTTCACTACATTGGCACTTAAATTTTTTCTTTATAAAGCTTTTTGAAGGTCATAAACAAAGACCATAATTGATGATAGACCTAATACATT
TCCTCTGTGTGTGTGTGTAACATTCCAAATACTTTTTTTTTCTTTTCCACTGTTTGTAAGGTGCAACAATTTAATATTTTTAAGGGACTT
TTTAAGAGTTCCTTAAGAACCAATTTAAAATTACTTCAGTGCAATCCTACACAGTATCAACATTAGAATTTTGATATTAGTCTTATGTTA
TCTTCCATTCTATTTTTATCTGCTTTTTGCTGCTAGTTTCAAACTGCCAGTATTTTTCCTTTTGCTTTTAAAATAGTTACAATATTTTTC
ATGATAGCCACAGTATTGCCACAGTTTATTATAATAAAGGGTTTTTATTTGATTTAGCGCATTCAAAGCTTTTTTCTATCACTTTTGTGT
TCAGAATATAACCTTTGTGTGCGTGTATGTTGTGTGTGTGCATGTGTGGCGTATATGTGTGTTACAGGTTAATGCCTTCTTGGAATTGTG
TTAATGTTCTCTTGGTTTATTATGCCATCAGAATGGTAAATGAGAACACTACAACTGTAGTCAGCTCACAATTTTTAAATAAAGGATACC
ACAGTGCATGCTGTTTGTTCAATCTTTGCAGACTTCTCTTTCTTTCCATGCTACCAGTTGTAAAGGACACAGCTATATCCTGGAAATGAA
AAACAAACACTGTGGTGCCTAGATGTGAAGAACTGGCTTATGTGGTTGTGTTTTGCTATGGAACAGAATGATTTAGGAAGTTCTTGTTTA
TATAGGTAGCCGAATTTACACATTTAGTTCAAAATTTCTCTTGAGCATCAGCTTAGTACTATATCAATCATTCTAGAAGGATATCTTATA
GAGCAGGTGTCCCCAACCCCCGGTAAGTAGCCTGTTAGGAACCAGGTCACACATAAGGAGGTTAGCAGTGGGCAAGTGAGCAAAGCATCA
TCTATATTTACAGCCGATCCCCATTGCTCGCATTACCGCCTGAGCTCTGCCTCCTGTCAGATCAGCGGCAGCATCAGGTTCTCTCAGGAA
CGAACTCTATTGTGAACTGCTCATGTGAGGGATCTAGGTTTCACGCTCCTTATGAGAATCTAACACCTGATGATCTGTCACTGTCTCCCA
TCACCCCTAGATGGGACAGTCTAGTTGCAGGAAAACAAGCTCAGGGCTTCCACTGATTCTACATTATGATGAGTTGTATACTTATTTTAT
ATTATAATAAAATATATTATTACAATGTAATAATAATAGAAATAAAATGCACAATACATGTAATGTGCTTGAATAATCCCAAAACCACCC
CCTCTCCTGGTCCATGGAAAAACTGTCTTCCATGAAAGTGGTCCCTGGTGCCAAAAAGGTTAGGGACCACTGTTACAGAGTATCAGGTCC
TCAAGATGCTAAAATCTATATGACATTTTTAACATGTGACATTATCATCATCATCATCATCATCATCACTGATGATACTATTTACCAGGG
CATGGTTTGAATTGGTGACTTTGGTGCAGTTCATTATTGGCAGCCAAATGCTTTATCCATACCTTCATATTGAAGAATTTGTTATCAGGA
AACTACCAGTCCTGCTTTACAGGAAGTCTGTTATCAGATATCAGATGGCAAGTTCCCCATGTCTTCAGATGTTCAAACAATATTGTGGAT
GGTCTAGAAAGAGTTTAAGACATGCTGTTAAATGTAGGGCTAGATAATTCTCTGATTCTTTGATGTAGTCTGGAAAGAAACAATCCATTG
TCCAGTTAATAAATATTTAGTGTTTTCATTTTTAAGACACTCACAATCCACAAATGTCCCTAACAATTTATTATTTTTAAAGAAAATGAC
TTTTTATTCCTTGCTAGTGAAAAATGTACAATTTATATGCTGCACTGAGAAAAATAACAGATATACTTTCTTCCATTCATTTTCATCCCA
AACATATAAAAAATAATCCATTGATTGTTCCTTGCATTGCATATCTTATTAAAAGATATTTCCTACATGCAACTAATAAGACATGCTGAC
TGTTGTCAGCTCTAAATTTATGTAAAGATTTTTTATTTTTGTTAAAATGTTTGAAATTTGCTTTTTGCTCCACACCTCACCTGTTTTTGA
TAAATCTGTGCTAATAAGTACATAGGAGGTAATAAATAATTGAGTTGTGAGAAACCCAATTCTCCATTTTTCAAGAAAACACAAGTAGCA
CTACTCTCTTTATCCCTTGGGACTCCTTCCTGTAATTTGAAAGGGGGGGCTAATGTTGGTGGCAGTTGTTGCTAAGGATCTCTGCACAGA
GTTAGGGCTTCACTCTCGGCTTCCTGGTTAGATGGGGCCATGTGACTAGTCCTAGTCAGTGAGCTGTGACCAGAAGTGATGTATGTACCC
TCGGGACCAGAGCATTTATGTGCTGGTACAAGCCTCTCCATAATGACGGGCAACACATGAGATGGTGGCTGCTGCAGCCATCTGGGTCTC
TAGCCAACCCAAAATGGGGACATAACACAAGCAAGAAATAAACATTTGTTCTTATAAATCACCAAGATTTTGGGGTTCTCAGTGGCTGCA
ACATAACCTAGACTATCCTGATACAGGCTTATCACCATGTTCTGGATGTGTGGTGACCAGGATGGTAGCCACTACTCACAAGTGGCTATT
TAAATTTAAGTTACTTTAAAAAATAAAATAAAAAATTCAGTTCCTCAGTTGTATGAGTTACATTTCAAATGCTCGACAGTCACATGTACA
TCACTTTTCAAATTATGTGAAATTAAAACTGAAAAGCTTGTGTGAAAGTCTAGAGAGTATGGTCTATAGTTTCATCAATTGTATTGGATA

>In-frame_MYH11_ENST00000452625_chr16_15809021_-_MYLK_ENST00000359169_chr3_123383105_-_9290nt
GCCTGGGAGGTGCGTCAGATCCGAGCTCGCCATCCAGTTTCCTCTCCACTAGTCCCCCCAGTTGGAGATCTGGGACCAACAAGGCACCAT
GGCGCAGAAGGGCCAACTCAGTGACGATGAGAAGTTCCTCTTTGTGGACAAAAACTTCATCAACAGCCCAGTGGCCCAGGCTGACTGGGC
CGCCAAGAGACTCGTCTGGGTCCCCTCGGAGAAGCAGGGCTTCGAGGCAGCCAGCATTAAGGAGGAGAAGGGGGATGAGGTGGTTGTGGA
GCTGGTGGAGAATGGCAAGAAGGTCACGGTTGGGAAAGATGACATCCAGAAGATGAACCCACCCAAGTTCTCCAAGGTGGAGGACATGGC
GGAGCTGACGTGCCTCAACGAAGCCTCCGTGCTACACAACCTGAGGGAGCGGTACTTCTCAGGGCTAATATATACGTACTCTGGCCTCTT
CTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGACATGTACAAGGGCAAGAAGAGGCACGAGATGCC
GCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAGGACCAGTCCATTCTATGCACAGGCGAGTCTGG
AGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCCTCCCACAAGGGCAAGAAAGACACAAGTATCAC
GCAAGGCCCATCTTTTGCCTACGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCTTTCGGCAACGCCAAAACAGT
GAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTGGGAGCCAACATTGAGACCTA
TCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATGATTGCTGGAGCCAAGGAGAA
GATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATCCCAGCAGCCCAGGATGATGA
GATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTGAAGGTGGTATCATCGGTCCT
GCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCTGCTCAGAAAGTTTGCCACCT
CATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTGGTACAGAAAGCTCAGACAAA
AGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTCACCCGCGTGAACAAAGCCCT
GGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAGGTGAACTCCTTCGAGCAGCT
GTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGCAT
CGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAACCCTCCAGGTGTGCTGGCCCT
GCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAGGGCAGCCACCCCAAGTTCCA
GAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAATGCGAGTGCCTGGCTGACCAA
GAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGACCTGTGGAAGGACGTGGACCG
CATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAGGGCATGTTCCGCACAGTGGG
GCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGCTGCATCATCCCCAACCACGA
GAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGCATTCGCATCTGCCGGCAGGG
CTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCCAAAGGCTTCATGGACGGGAA
GCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAAATCTTCTTCCGAACTGGCGT
CCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGTCGTGGCTACTTGGCCAGAAA
GGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTCAAGCTGCGGAACTGGCAGTG
GTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGATGAACTGCAGAAGAC
CAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAGGAGAAGAACCTGCTACAGGA
ACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAGCAGGAGCTGGAGGAGATACT
GCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAGATGGCCCAGCAGATGCTGGA
CCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAGGCCAAGATCAAGAAACTGGA
GGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGGATTAGTGACTTAACGACAAA
TCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCAGAACTGGAAGTGCGGCTAAA
GAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTCCACGAGCAGATCGCTGACCT
CCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCCAGGCTTGACGATGAAATCGC
TCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTGGACTCAGAGCGGGCCGCCAG
GAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGACACACTGGACAGCACAGCCAC
TCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACGCGGTCCCATGAGGCTCAGGT
CCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGGGCCAAGGCGAACCTAGACAA
GAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAGCAGGAGGTGGAACATAAGAA
GAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAGCTCAATGACAAAGTCCACAA
GCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCCAAGGACGTGGCGTCCCTCAG
TTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAGCTGCGCCAGCTGGAGGAGGA
GCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCCACTCTCAACATCCAGCTCTC
CGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTCCAGAAGGAGATCGAGAACCT
CACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAGGAGCTGGACGACCTGGTTGT
TGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTAGCCGAGGAGAAAAACATCTC
TTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCCCTGGCTCGGGCCCTTGAAGA
GGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTCAGCTCCAAGGATGACGTGGG
CAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGACGA
GCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAAAGGGATCTCCAAGCCCGGGA
CGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGACGAGCGAAAGCAACGTGCCCT
GGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATCAAGGGGAGGGAGGAAGCCAT
CAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCCAGAGATGAGATCTTTGCCAC
AGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCCGCCGCTGAGAGGGCTCGCAA
ACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTCCAGGACGAGAAGCGCCGCCT
GGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGACCGGGTCCGCAAAGCCACACA
GCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGGCAGCAGCTCGAGCGGCAGAA
CAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCGGCGCTGGAGGCCAAGATTGC
ACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAAGACAAGAAGCTGAAGGAAAT
CTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGA
GAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCA
GGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCT
GTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGA
ACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTA
TGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGA
TGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATT
AGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGC
AAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGA
AAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCG
TGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAA
CATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGT
CCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCAT
CTGCTACATCCTAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACT
CTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTAT
GGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGAAGA
TGTGTCCCAAGCTTTCCTTGAGGCTGTTGCTGAGGAAAAGCCTCATGTAAAACCCTATTTCTCTAAGACCATTCGCGATTTAGAAGTTGT
GGAGGGAAGTGCTGCTAGATTTGACTGCAAGATTGAAGGATACCCAGACCCCGAGGTTGTCTGGTTCAAAGATGACCAGTCAATCAGGGA
GTCCCGCCACTTCCAGATAGACTACGATGAGGACGGGAACTGCTCTTTAATTATTAGTGATGTTTGCGGGGATGACGATGCCAAGTACAC
CTGCAAGGCTGTCAACAGTCTTGGAGAAGCCACCTGCACAGCAGAGCTCATTGTGGAAACGATGGAGGAAGGTGAAGGGGAAGGGGAAGA
GGAAGAAGAGTGAAACAAAGCCAGAGAAAAGCAGTTTCTAAGTCATATTAAAAGGACTATTTCTCTAAAACTCAAAAAAAAAAAAAAAAC
TCAAGATAGTAAAAGCACCTAGTGTGATAGATTATCGGTTAGGTCATTTGTGGGTTGATTCTTCAGAAACAGCAGTTGATACCTAGCAGC
GTTATTGATGGGCATTAATCTATGTTAGTTGGCACCTTAAGATACTAGTGCAGCTAGATTTCATTTAGGGAAATCACCAGTAACTTGACT
GACCAATTGATTTTAGAGAGAAAGTAACCAAACCAAATATTTATCTGGGCAAAGTCATAAATTCTCCACTTGAATGCGCTCATGAAAAAT
AAGGCCAAAACAAGAGTTCTGGGCCACAGCTCAGCCCAGAGGGTTCCTGGGGATGGGAGGCCTCTCTCTCCCCACCCCCTGACTCTAGAG
AACTGGGTTTTCTCCCAGTACTCCAGCAATTCATTTCTGAAAGCAGTTGAGCCACTTTATTCCAAAGTACACTGCAGATGTTCAAACTCT
CCATTTCTCTTTCCCCTTCCACCTGCCAGTTTTGCTGACTCTCAACTTGTCATGAGTGTAAGCATTAAGGACATTATGCTTCTTCGATTC
TGAAGACAGGTCCCTGCTCATGGATGACTCTGGCTTCCTTAGGAAAATATTTTTCTTCCAAAATCAGTAGGAAATCTAAACTTATCCCCT
CTTTGCAGATGTCTAGCAGCTTCAGACATTTGGTTAAGAACCCATGGGAAAAAAAAAATCCTTGCTAATGTGGTTTCCTTTGTAAACCAG
GATTCTTATTTGTGCTGTTATAGAATATCAGCTCTGAACGTGTGGTAAAGATTTTTGTGTTTGAATATAGGAGAAATCAGTTTGCTGAAA
AGTTAGTCTTAATTATCTATTGGCCACGATGAAACAGATTTCAACTGATAAAGAGCTGGAGAACTCCATGTACTTTGGAATCTCCTCCAA
GATAGCCAGAGTTTAATACATCTTCATTCTCAACACTCTCCAAAGAACTTGACCTACCTTATGGGTTCCATATTTTTCTTCTTAAATGTG
CATCAATCATGCCTTGCCCCCAACCTTTAAATATATTCTTAGACCTGGTAAATGCACTCAGACTTGCGTCTTTAGGAATTTTTAACTTTC
TTTCACTACATTGGCACTTAAATTTTTTCTTTATAAAGCTTTTTGAAGGTCATAAACAAAGACCATAATTGATGATAGACCTAATACATT
TCCTCTGTGTGTGTGTGTAACATTCCAAATACTTTTTTTTTCTTTTCCACTGTTTGTAAGGTGCAACAATTTAATATTTTTAAGGGACTT
TTTAAGAGTTCCTTAAGAACCAATTTAAAATTACTTCAGTGCAATCCTACACAGTATCAACATTAGAATTTTGATATTAGTCTTATGTTA
TCTTCCATTCTATTTTTATCTGCTTTTTGCTGCTAGTTTCAAACTGCCAGTATTTTTCCTTTTGCTTTTAAAATAGTTACAATATTTTTC
ATGATAGCCACAGTATTGCCACAGTTTATTATAATAAAGGGTTTTTATTTGATTTAGCGCATTCAAAGCTTTTTTCTATCACTTTTGTGT
TCAGAATATAACCTTTGTGTGCGTGTATGTTGTGTGTGTGCATGTGTGGCGTATATGTGTGTTACAGGTTAATGCCTTCTTGGAATTGTG
TTAATGTTCTCTTGGTTTATTATGCCATCAGAATGGTAAATGAGAACACTACAACTGTAGTCAGCTCACAATTTTTAAATAAAGGATACC

>In-frame_MYH11_ENST00000452625_chr16_15809021_-_MYLK_ENST00000360304_chr3_123383105_-_9443nt
GCCTGGGAGGTGCGTCAGATCCGAGCTCGCCATCCAGTTTCCTCTCCACTAGTCCCCCCAGTTGGAGATCTGGGACCAACAAGGCACCAT
GGCGCAGAAGGGCCAACTCAGTGACGATGAGAAGTTCCTCTTTGTGGACAAAAACTTCATCAACAGCCCAGTGGCCCAGGCTGACTGGGC
CGCCAAGAGACTCGTCTGGGTCCCCTCGGAGAAGCAGGGCTTCGAGGCAGCCAGCATTAAGGAGGAGAAGGGGGATGAGGTGGTTGTGGA
GCTGGTGGAGAATGGCAAGAAGGTCACGGTTGGGAAAGATGACATCCAGAAGATGAACCCACCCAAGTTCTCCAAGGTGGAGGACATGGC
GGAGCTGACGTGCCTCAACGAAGCCTCCGTGCTACACAACCTGAGGGAGCGGTACTTCTCAGGGCTAATATATACGTACTCTGGCCTCTT
CTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGACATGTACAAGGGCAAGAAGAGGCACGAGATGCC
GCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAGGACCAGTCCATTCTATGCACAGGCGAGTCTGG
AGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCCTCCCACAAGGGCAAGAAAGACACAAGTATCAC
GCAAGGCCCATCTTTTGCCTACGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCTTTCGGCAACGCCAAAACAGT
GAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTGGGAGCCAACATTGAGACCTA
TCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATGATTGCTGGAGCCAAGGAGAA
GATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATCCCAGCAGCCCAGGATGATGA
GATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTGAAGGTGGTATCATCGGTCCT
GCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCTGCTCAGAAAGTTTGCCACCT
CATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTGGTACAGAAAGCTCAGACAAA
AGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTCACCCGCGTGAACAAAGCCCT
GGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAGGTGAACTCCTTCGAGCAGCT
GTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGCAT
CGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAACCCTCCAGGTGTGCTGGCCCT
GCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAGGGCAGCCACCCCAAGTTCCA
GAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAATGCGAGTGCCTGGCTGACCAA
GAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGACCTGTGGAAGGACGTGGACCG
CATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAGGGCATGTTCCGCACAGTGGG
GCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGCTGCATCATCCCCAACCACGA
GAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGCATTCGCATCTGCCGGCAGGG
CTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCCAAAGGCTTCATGGACGGGAA
GCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAAATCTTCTTCCGAACTGGCGT
CCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGTCGTGGCTACTTGGCCAGAAA
GGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTCAAGCTGCGGAACTGGCAGTG
GTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGATGAACTGCAGAAGAC
CAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAGGAGAAGAACCTGCTACAGGA
ACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAGCAGGAGCTGGAGGAGATACT
GCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAGATGGCCCAGCAGATGCTGGA
CCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAGGCCAAGATCAAGAAACTGGA
GGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGGATTAGTGACTTAACGACAAA
TCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCAGAACTGGAAGTGCGGCTAAA
GAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTCCACGAGCAGATCGCTGACCT
CCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCCAGGCTTGACGATGAAATCGC
TCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTGGACTCAGAGCGGGCCGCCAG
GAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGACACACTGGACAGCACAGCCAC
TCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACGCGGTCCCATGAGGCTCAGGT
CCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGGGCCAAGGCGAACCTAGACAA
GAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAGCAGGAGGTGGAACATAAGAA
GAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAGCTCAATGACAAAGTCCACAA
GCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCCAAGGACGTGGCGTCCCTCAG
TTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAGCTGCGCCAGCTGGAGGAGGA
GCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCCACTCTCAACATCCAGCTCTC
CGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTCCAGAAGGAGATCGAGAACCT
CACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAGGAGCTGGACGACCTGGTTGT
TGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTAGCCGAGGAGAAAAACATCTC
TTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCCCTGGCTCGGGCCCTTGAAGA
GGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTCAGCTCCAAGGATGACGTGGG
CAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGACGA
GCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAAAGGGATCTCCAAGCCCGGGA
CGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGACGAGCGAAAGCAACGTGCCCT
GGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATCAAGGGGAGGGAGGAAGCCAT
CAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCCAGAGATGAGATCTTTGCCAC
AGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCCGCCGCTGAGAGGGCTCGCAA
ACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTCCAGGACGAGAAGCGCCGCCT
GGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGACCGGGTCCGCAAAGCCACACA
GCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGGCAGCAGCTCGAGCGGCAGAA
CAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCGGCGCTGGAGGCCAAGATTGC
ACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAAGACAAGAAGCTGAAGGAAAT
CTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCGA
GAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGCA
GGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCCT
GTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGGA
ACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGTA
TGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATGA
TGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGATT
AGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAGC
AAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAGA
AAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGCG
TGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGAA
CATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGGT
CCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCAT
CTGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACTT
CGACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACTG
CACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACAT
GGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCAG
GAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGAAGATGTGTCCCAAGCTTTCCTTGAGGCTGT
TGCTGAGGAAAAGCCTCATGTAAAACCCTATTTCTCTAAGACCATTCGCGATTTAGAAGTTGTGGAGGGAAGTGCTGCTAGATTTGACTG
CAAGATTGAAGGATACCCAGACCCCGAGGTTGTCTGGTTCAAAGATGACCAGTCAATCAGGGAGTCCCGCCACTTCCAGATAGACTACGA
TGAGGACGGGAACTGCTCTTTAATTATTAGTGATGTTTGCGGGGATGACGATGCCAAGTACACCTGCAAGGCTGTCAACAGTCTTGGAGA
AGCCACCTGCACAGCAGAGCTCATTGTGGAAACGATGGAGGAAGGTGAAGGGGAAGGGGAAGAGGAAGAAGAGTGAAACAAAGCCAGAGA
AAAGCAGTTTCTAAGTCATATTAAAAGGACTATTTCTCTAAAACTCAAAAAAAAAAAAAAAACTCAAGATAGTAAAAGCACCTAGTGTGA
TAGATTATCGGTTAGGTCATTTGTGGGTTGATTCTTCAGAAACAGCAGTTGATACCTAGCAGCGTTATTGATGGGCATTAATCTATGTTA
GTTGGCACCTTAAGATACTAGTGCAGCTAGATTTCATTTAGGGAAATCACCAGTAACTTGACTGACCAATTGATTTTAGAGAGAAAGTAA
CCAAACCAAATATTTATCTGGGCAAAGTCATAAATTCTCCACTTGAATGCGCTCATGAAAAATAAGGCCAAAACAAGAGTTCTGGGCCAC
AGCTCAGCCCAGAGGGTTCCTGGGGATGGGAGGCCTCTCTCTCCCCACCCCCTGACTCTAGAGAACTGGGTTTTCTCCCAGTACTCCAGC
AATTCATTTCTGAAAGCAGTTGAGCCACTTTATTCCAAAGTACACTGCAGATGTTCAAACTCTCCATTTCTCTTTCCCCTTCCACCTGCC
AGTTTTGCTGACTCTCAACTTGTCATGAGTGTAAGCATTAAGGACATTATGCTTCTTCGATTCTGAAGACAGGTCCCTGCTCATGGATGA
CTCTGGCTTCCTTAGGAAAATATTTTTCTTCCAAAATCAGTAGGAAATCTAAACTTATCCCCTCTTTGCAGATGTCTAGCAGCTTCAGAC
ATTTGGTTAAGAACCCATGGGAAAAAAAAAATCCTTGCTAATGTGGTTTCCTTTGTAAACCAGGATTCTTATTTGTGCTGTTATAGAATA
TCAGCTCTGAACGTGTGGTAAAGATTTTTGTGTTTGAATATAGGAGAAATCAGTTTGCTGAAAAGTTAGTCTTAATTATCTATTGGCCAC
GATGAAACAGATTTCAACTGATAAAGAGCTGGAGAACTCCATGTACTTTGGAATCTCCTCCAAGATAGCCAGAGTTTAATACATCTTCAT
TCTCAACACTCTCCAAAGAACTTGACCTACCTTATGGGTTCCATATTTTTCTTCTTAAATGTGCATCAATCATGCCTTGCCCCCAACCTT
TAAATATATTCTTAGACCTGGTAAATGCACTCAGACTTGCGTCTTTAGGAATTTTTAACTTTCTTTCACTACATTGGCACTTAAATTTTT
TCTTTATAAAGCTTTTTGAAGGTCATAAACAAAGACCATAATTGATGATAGACCTAATACATTTCCTCTGTGTGTGTGTGTAACATTCCA
AATACTTTTTTTTTCTTTTCCACTGTTTGTAAGGTGCAACAATTTAATATTTTTAAGGGACTTTTTAAGAGTTCCTTAAGAACCAATTTA
AAATTACTTCAGTGCAATCCTACACAGTATCAACATTAGAATTTTGATATTAGTCTTATGTTATCTTCCATTCTATTTTTATCTGCTTTT
TGCTGCTAGTTTCAAACTGCCAGTATTTTTCCTTTTGCTTTTAAAATAGTTACAATATTTTTCATGATAGCCACAGTATTGCCACAGTTT
ATTATAATAAAGGGTTTTTATTTGATTTAGCGCATTCAAAGCTTTTTTCTATCACTTTTGTGTTCAGAATATAACCTTTGTGTGCGTGTA
TGTTGTGTGTGTGCATGTGTGGCGTATATGTGTGTTACAGGTTAATGCCTTCTTGGAATTGTGTTAATGTTCTCTTGGTTTATTATGCCA

>In-frame_MYH11_ENST00000576790_chr16_15809021_-_MYLK_ENST00000360772_chr3_123383105_-_11540nt
GCAGGGAGATTTGGACGCTCCGGCCTGGGAGGTGCGTCAGATCCGAGCTCGCCATCCAGTTTCCTCTCCACTAGTCCCCCCAGTTGGAGA
TCTGGGACCAACAAGGCACCATGGCGCAGAAGGGCCAACTCAGTGACGATGAGAAGTTCCTCTTTGTGGACAAAAACTTCATCAACAGCC
CAGTGGCCCAGGCTGACTGGGCCGCCAAGAGACTCGTCTGGGTCCCCTCGGAGAAGCAGGGCTTCGAGGCAGCCAGCATTAAGGAGGAGA
AGGGGGATGAGGTGGTTGTGGAGCTGGTGGAGAATGGCAAGAAGGTCACGGTTGGGAAAGATGACATCCAGAAGATGAACCCACCCAAGT
TCTCCAAGGTGGAGGACATGGCGGAGCTGACGTGCCTCAACGAAGCCTCCGTGCTACACAACCTGAGGGAGCGGTACTTCTCAGGGCTAA
TATATACGTACTCTGGCCTCTTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGACATGTACAAGG
GCAAGAAGAGGCACGAGATGCCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAGGACCAGTCCA
TTCTATGCACAGGCGAGTCTGGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCCTCCCACAAGG
GCAAGAAAGACACAAGTATCACGGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCTTTCGGCAACGCCAAAACAG
TGAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTGGGAGCCAACATTGAGACCT
ATCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATGATTGCTGGAGCCAAGGAGA
AGATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATCCCAGCAGCCCAGGATGATG
AGATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTGAAGGTGGTATCATCGGTCC
TGCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCTGCTCAGAAAGTTTGCCACC
TCATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTGGTACAGAAAGCTCAGACAA
AAGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTCACCCGCGTGAACAAAGCCC
TGGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAGGTGAACTCCTTCGAGCAGC
TGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGCA
TCGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAACCCTCCAGGTGTGCTGGCCC
TGCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAGGGCAGCCACCCCAAGTTCC
AGAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAATGCGAGTGCCTGGCTGACCA
AGAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGACCTGTGGAAGGACGTGGACC
GCATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAGGGCATGTTCCGCACAGTGG
GGCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGCTGCATCATCCCCAACCACG
AGAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGCATTCGCATCTGCCGGCAGG
GCTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCCAAAGGCTTCATGGACGGGA
AGCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAAATCTTCTTCCGAACTGGCG
TCCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGTCGTGGCTACTTGGCCAGAA
AGGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTCAAGCTGCGGAACTGGCAGT
GGTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGATGAACTGCAGAAGA
CCAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAGGAGAAGAACCTGCTACAGG
AACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAGCAGGAGCTGGAGGAGATAC
TGCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAGATGGCCCAGCAGATGCTGG
ACCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAGGCCAAGATCAAGAAACTGG
AGGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGGATTAGTGACTTAACGACAA
ATCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCAGAACTGGAAGTGCGGCTAA
AGAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTCCACGAGCAGATCGCTGACC
TCCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCCAGGCTTGACGATGAAATCG
CTCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTGGACTCAGAGCGGGCCGCCA
GGAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGACACACTGGACAGCACAGCCA
CTCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACGCGGTCCCATGAGGCTCAGG
TCCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGGGCCAAGGCGAACCTAGACA
AGAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAGCAGGAGGTGGAACATAAGA
AGAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAGCTCAATGACAAAGTCCACA
AGCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCCAAGGACGTGGCGTCCCTCA
GTTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAGCTGCGCCAGCTGGAGGAGG
AGCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCCACTCTCAACATCCAGCTCT
CCGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTCCAGAAGGAGATCGAGAACC
TCACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAGGAGCTGGACGACCTGGTTG
TTGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTAGCCGAGGAGAAAAACATCT
CTTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCCCTGGCTCGGGCCCTTGAAG
AGGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTCAGCTCCAAGGATGACGTGG
GCAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGACG
AGCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAAAGGGATCTCCAAGCCCGGG
ACGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGACGAGCGAAAGCAACGTGCCC
TGGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATCAAGGGGAGGGAGGAAGCCA
TCAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCCAGAGATGAGATCTTTGCCA
CAGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCCGCCGCTGAGAGGGCTCGCA
AACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTCCAGGACGAGAAGCGCCGCC
TGGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGACCGGGTCCGCAAAGCCACAC
AGCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGGCAGCAGCTCGAGCGGCAGA
ACAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCGGCGCTGGAGGCCAAGATTG
CACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAAGACAAGAAGCTGAAGGAAA
TCTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCG
AGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGC
AGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCC
TGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGG
AACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGT
ATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATG
ATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGAT
TAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAG
CAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAG
AAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGC
GTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGA
ACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGG
TCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCA
TCTGCTACATCCTAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAAC
TCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTA
TGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGAAG
ATGTGTCCCAAGCTTTCCTTGAGGCTGTTGCTGAGGAAAAGCCTCATGTAAAACCCTATTTCTCTAAGACCATTCGCGATTTAGAAGTTG
TGGAGGGAAGTGCTGCTAGATTTGACTGCAAGATTGAAGGATACCCAGACCCCGAGGTTGTCTGGTTCAAAGATGACCAGTCAATCAGGG
AGTCCCGCCACTTCCAGATAGACTACGATGAGGACGGGAACTGCTCTTTAATTATTAGTGATGTTTGCGGGGATGACGATGCCAAGTACA
CCTGCAAGGCTGTCAACAGTCTTGGAGAAGCCACCTGCACAGCAGAGCTCATTGTGGAAACGATGGAGGAAGGTGAAGGGGAAGGGGAAG
AGGAAGAAGAGTGAAACAAAGCCAGAGAAAAGCAGTTTCTAAGTCATATTAAAAGGACTATTTCTCTAAAACTCAAAAAAAAAAAAAAAA
CTCAAGATAGTAAAAGCACCTAGTGTGATAGATTATCGGTTAGGTCATTTGTGGGTTGATTCTTCAGAAACAGCAGTTGATACCTAGCAG
CGTTATTGATGGGCATTAATCTATGTTAGTTGGCACCTTAAGATACTAGTGCAGCTAGATTTCATTTAGGGAAATCACCAGTAACTTGAC
TGACCAATTGATTTTAGAGAGAAAGTAACCAAACCAAATATTTATCTGGGCAAAGTCATAAATTCTCCACTTGAATGCGCTCATGAAAAA
TAAGGCCAAAACAAGAGTTCTGGGCCACAGCTCAGCCCAGAGGGTTCCTGGGGATGGGAGGCCTCTCTCTCCCCACCCCCTGACTCTAGA
GAACTGGGTTTTCTCCCAGTACTCCAGCAATTCATTTCTGAAAGCAGTTGAGCCACTTTATTCCAAAGTACACTGCAGATGTTCAAACTC
TCCATTTCTCTTTCCCCTTCCACCTGCCAGTTTTGCTGACTCTCAACTTGTCATGAGTGTAAGCATTAAGGACATTATGCTTCTTCGATT
CTGAAGACAGGTCCCTGCTCATGGATGACTCTGGCTTCCTTAGGAAAATATTTTTCTTCCAAAATCAGTAGGAAATCTAAACTTATCCCC
TCTTTGCAGATGTCTAGCAGCTTCAGACATTTGGTTAAGAACCCATGGGAAAAAAAAAATCCTTGCTAATGTGGTTTCCTTTGTAAACCA
GGATTCTTATTTGTGCTGTTATAGAATATCAGCTCTGAACGTGTGGTAAAGATTTTTGTGTTTGAATATAGGAGAAATCAGTTTGCTGAA
AAGTTAGTCTTAATTATCTATTGGCCACGATGAAACAGATTTCAACTGATAAAGAGCTGGAGAACTCCATGTACTTTGGAATCTCCTCCA
AGATAGCCAGAGTTTAATACATCTTCATTCTCAACACTCTCCAAAGAACTTGACCTACCTTATGGGTTCCATATTTTTCTTCTTAAATGT
GCATCAATCATGCCTTGCCCCCAACCTTTAAATATATTCTTAGACCTGGTAAATGCACTCAGACTTGCGTCTTTAGGAATTTTTAACTTT
CTTTCACTACATTGGCACTTAAATTTTTTCTTTATAAAGCTTTTTGAAGGTCATAAACAAAGACCATAATTGATGATAGACCTAATACAT
TTCCTCTGTGTGTGTGTGTAACATTCCAAATACTTTTTTTTTCTTTTCCACTGTTTGTAAGGTGCAACAATTTAATATTTTTAAGGGACT
TTTTAAGAGTTCCTTAAGAACCAATTTAAAATTACTTCAGTGCAATCCTACACAGTATCAACATTAGAATTTTGATATTAGTCTTATGTT
ATCTTCCATTCTATTTTTATCTGCTTTTTGCTGCTAGTTTCAAACTGCCAGTATTTTTCCTTTTGCTTTTAAAATAGTTACAATATTTTT
CATGATAGCCACAGTATTGCCACAGTTTATTATAATAAAGGGTTTTTATTTGATTTAGCGCATTCAAAGCTTTTTTCTATCACTTTTGTG
TTCAGAATATAACCTTTGTGTGCGTGTATGTTGTGTGTGTGCATGTGTGGCGTATATGTGTGTTACAGGTTAATGCCTTCTTGGAATTGT
GTTAATGTTCTCTTGGTTTATTATGCCATCAGAATGGTAAATGAGAACACTACAACTGTAGTCAGCTCACAATTTTTAAATAAAGGATAC
CACAGTGCATGCTGTTTGTTCAATCTTTGCAGACTTCTCTTTCTTTCCATGCTACCAGTTGTAAAGGACACAGCTATATCCTGGAAATGA
AAAACAAACACTGTGGTGCCTAGATGTGAAGAACTGGCTTATGTGGTTGTGTTTTGCTATGGAACAGAATGATTTAGGAAGTTCTTGTTT
ATATAGGTAGCCGAATTTACACATTTAGTTCAAAATTTCTCTTGAGCATCAGCTTAGTACTATATCAATCATTCTAGAAGGATATCTTAT
AGAGCAGGTGTCCCCAACCCCCGGTAAGTAGCCTGTTAGGAACCAGGTCACACATAAGGAGGTTAGCAGTGGGCAAGTGAGCAAAGCATC
ATCTATATTTACAGCCGATCCCCATTGCTCGCATTACCGCCTGAGCTCTGCCTCCTGTCAGATCAGCGGCAGCATCAGGTTCTCTCAGGA
ACGAACTCTATTGTGAACTGCTCATGTGAGGGATCTAGGTTTCACGCTCCTTATGAGAATCTAACACCTGATGATCTGTCACTGTCTCCC
ATCACCCCTAGATGGGACAGTCTAGTTGCAGGAAAACAAGCTCAGGGCTTCCACTGATTCTACATTATGATGAGTTGTATACTTATTTTA
TATTATAATAAAATATATTATTACAATGTAATAATAATAGAAATAAAATGCACAATACATGTAATGTGCTTGAATAATCCCAAAACCACC
CCCTCTCCTGGTCCATGGAAAAACTGTCTTCCATGAAAGTGGTCCCTGGTGCCAAAAAGGTTAGGGACCACTGTTACAGAGTATCAGGTC
CTCAAGATGCTAAAATCTATATGACATTTTTAACATGTGACATTATCATCATCATCATCATCATCATCACTGATGATACTATTTACCAGG
GCATGGTTTGAATTGGTGACTTTGGTGCAGTTCATTATTGGCAGCCAAATGCTTTATCCATACCTTCATATTGAAGAATTTGTTATCAGG
AAACTACCAGTCCTGCTTTACAGGAAGTCTGTTATCAGATATCAGATGGCAAGTTCCCCATGTCTTCAGATGTTCAAACAATATTGTGGA
TGGTCTAGAAAGAGTTTAAGACATGCTGTTAAATGTAGGGCTAGATAATTCTCTGATTCTTTGATGTAGTCTGGAAAGAAACAATCCATT
GTCCAGTTAATAAATATTTAGTGTTTTCATTTTTAAGACACTCACAATCCACAAATGTCCCTAACAATTTATTATTTTTAAAGAAAATGA
CTTTTTATTCCTTGCTAGTGAAAAATGTACAATTTATATGCTGCACTGAGAAAAATAACAGATATACTTTCTTCCATTCATTTTCATCCC
AAACATATAAAAAATAATCCATTGATTGTTCCTTGCATTGCATATCTTATTAAAAGATATTTCCTACATGCAACTAATAAGACATGCTGA
CTGTTGTCAGCTCTAAATTTATGTAAAGATTTTTTATTTTTGTTAAAATGTTTGAAATTTGCTTTTTGCTCCACACCTCACCTGTTTTTG
ATAAATCTGTGCTAATAAGTACATAGGAGGTAATAAATAATTGAGTTGTGAGAAACCCAATTCTCCATTTTTCAAGAAAACACAAGTAGC
ACTACTCTCTTTATCCCTTGGGACTCCTTCCTGTAATTTGAAAGGGGGGGCTAATGTTGGTGGCAGTTGTTGCTAAGGATCTCTGCACAG
AGTTAGGGCTTCACTCTCGGCTTCCTGGTTAGATGGGGCCATGTGACTAGTCCTAGTCAGTGAGCTGTGACCAGAAGTGATGTATGTACC
CTCGGGACCAGAGCATTTATGTGCTGGTACAAGCCTCTCCATAATGACGGGCAACACATGAGATGGTGGCTGCTGCAGCCATCTGGGTCT
CTAGCCAACCCAAAATGGGGACATAACACAAGCAAGAAATAAACATTTGTTCTTATAAATCACCAAGATTTTGGGGTTCTCAGTGGCTGC
AACATAACCTAGACTATCCTGATACAGGCTTATCACCATGTTCTGGATGTGTGGTGACCAGGATGGTAGCCACTACTCACAAGTGGCTAT
TTAAATTTAAGTTACTTTAAAAAATAAAATAAAAAATTCAGTTCCTCAGTTGTATGAGTTACATTTCAAATGCTCGACAGTCACATGTAC
ATCACTTTTCAAATTATGTGAAATTAAAACTGAAAAGCTTGTGTGAAAGTCTAGAGAGTATGGTCTATAGTTTCATCAATTGTATTGGAT

>In-frame_MYH11_ENST00000576790_chr16_15809021_-_MYLK_ENST00000359169_chr3_123383105_-_9291nt
GCAGGGAGATTTGGACGCTCCGGCCTGGGAGGTGCGTCAGATCCGAGCTCGCCATCCAGTTTCCTCTCCACTAGTCCCCCCAGTTGGAGA
TCTGGGACCAACAAGGCACCATGGCGCAGAAGGGCCAACTCAGTGACGATGAGAAGTTCCTCTTTGTGGACAAAAACTTCATCAACAGCC
CAGTGGCCCAGGCTGACTGGGCCGCCAAGAGACTCGTCTGGGTCCCCTCGGAGAAGCAGGGCTTCGAGGCAGCCAGCATTAAGGAGGAGA
AGGGGGATGAGGTGGTTGTGGAGCTGGTGGAGAATGGCAAGAAGGTCACGGTTGGGAAAGATGACATCCAGAAGATGAACCCACCCAAGT
TCTCCAAGGTGGAGGACATGGCGGAGCTGACGTGCCTCAACGAAGCCTCCGTGCTACACAACCTGAGGGAGCGGTACTTCTCAGGGCTAA
TATATACGTACTCTGGCCTCTTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGACATGTACAAGG
GCAAGAAGAGGCACGAGATGCCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAGGACCAGTCCA
TTCTATGCACAGGCGAGTCTGGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCCTCCCACAAGG
GCAAGAAAGACACAAGTATCACGGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCTTTCGGCAACGCCAAAACAG
TGAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTGGGAGCCAACATTGAGACCT
ATCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATGATTGCTGGAGCCAAGGAGA
AGATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATCCCAGCAGCCCAGGATGATG
AGATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTGAAGGTGGTATCATCGGTCC
TGCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCTGCTCAGAAAGTTTGCCACC
TCATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTGGTACAGAAAGCTCAGACAA
AAGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTCACCCGCGTGAACAAAGCCC
TGGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAGGTGAACTCCTTCGAGCAGC
TGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGCA
TCGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAACCCTCCAGGTGTGCTGGCCC
TGCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAGGGCAGCCACCCCAAGTTCC
AGAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAATGCGAGTGCCTGGCTGACCA
AGAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGACCTGTGGAAGGACGTGGACC
GCATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAGGGCATGTTCCGCACAGTGG
GGCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGCTGCATCATCCCCAACCACG
AGAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGCATTCGCATCTGCCGGCAGG
GCTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCCAAAGGCTTCATGGACGGGA
AGCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAAATCTTCTTCCGAACTGGCG
TCCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGTCGTGGCTACTTGGCCAGAA
AGGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTCAAGCTGCGGAACTGGCAGT
GGTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGATGAACTGCAGAAGA
CCAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAGGAGAAGAACCTGCTACAGG
AACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAGCAGGAGCTGGAGGAGATAC
TGCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAGATGGCCCAGCAGATGCTGG
ACCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAGGCCAAGATCAAGAAACTGG
AGGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGGATTAGTGACTTAACGACAA
ATCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCAGAACTGGAAGTGCGGCTAA
AGAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTCCACGAGCAGATCGCTGACC
TCCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCCAGGCTTGACGATGAAATCG
CTCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTGGACTCAGAGCGGGCCGCCA
GGAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGACACACTGGACAGCACAGCCA
CTCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACGCGGTCCCATGAGGCTCAGG
TCCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGGGCCAAGGCGAACCTAGACA
AGAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAGCAGGAGGTGGAACATAAGA
AGAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAGCTCAATGACAAAGTCCACA
AGCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCCAAGGACGTGGCGTCCCTCA
GTTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAGCTGCGCCAGCTGGAGGAGG
AGCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCCACTCTCAACATCCAGCTCT
CCGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTCCAGAAGGAGATCGAGAACC
TCACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAGGAGCTGGACGACCTGGTTG
TTGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTAGCCGAGGAGAAAAACATCT
CTTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCCCTGGCTCGGGCCCTTGAAG
AGGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTCAGCTCCAAGGATGACGTGG
GCAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGACG
AGCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAAAGGGATCTCCAAGCCCGGG
ACGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGACGAGCGAAAGCAACGTGCCC
TGGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATCAAGGGGAGGGAGGAAGCCA
TCAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCCAGAGATGAGATCTTTGCCA
CAGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCCGCCGCTGAGAGGGCTCGCA
AACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTCCAGGACGAGAAGCGCCGCC
TGGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGACCGGGTCCGCAAAGCCACAC
AGCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGGCAGCAGCTCGAGCGGCAGA
ACAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCGGCGCTGGAGGCCAAGATTG
CACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAAGACAAGAAGCTGAAGGAAA
TCTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCG
AGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGC
AGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCC
TGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGG
AACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGT
ATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATG
ATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGAT
TAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAG
CAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAG
AAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGC
GTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGA
ACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGG
TCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCA
TCTGCTACATCCTAAACCGCCTGGACTGCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAAC
TCTCCAAGGACCGGATGAAGAAGTACATGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTA
TGGCAATGATCTCAGGGCTCAGTGGCAGGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGAAG
ATGTGTCCCAAGCTTTCCTTGAGGCTGTTGCTGAGGAAAAGCCTCATGTAAAACCCTATTTCTCTAAGACCATTCGCGATTTAGAAGTTG
TGGAGGGAAGTGCTGCTAGATTTGACTGCAAGATTGAAGGATACCCAGACCCCGAGGTTGTCTGGTTCAAAGATGACCAGTCAATCAGGG
AGTCCCGCCACTTCCAGATAGACTACGATGAGGACGGGAACTGCTCTTTAATTATTAGTGATGTTTGCGGGGATGACGATGCCAAGTACA
CCTGCAAGGCTGTCAACAGTCTTGGAGAAGCCACCTGCACAGCAGAGCTCATTGTGGAAACGATGGAGGAAGGTGAAGGGGAAGGGGAAG
AGGAAGAAGAGTGAAACAAAGCCAGAGAAAAGCAGTTTCTAAGTCATATTAAAAGGACTATTTCTCTAAAACTCAAAAAAAAAAAAAAAA
CTCAAGATAGTAAAAGCACCTAGTGTGATAGATTATCGGTTAGGTCATTTGTGGGTTGATTCTTCAGAAACAGCAGTTGATACCTAGCAG
CGTTATTGATGGGCATTAATCTATGTTAGTTGGCACCTTAAGATACTAGTGCAGCTAGATTTCATTTAGGGAAATCACCAGTAACTTGAC
TGACCAATTGATTTTAGAGAGAAAGTAACCAAACCAAATATTTATCTGGGCAAAGTCATAAATTCTCCACTTGAATGCGCTCATGAAAAA
TAAGGCCAAAACAAGAGTTCTGGGCCACAGCTCAGCCCAGAGGGTTCCTGGGGATGGGAGGCCTCTCTCTCCCCACCCCCTGACTCTAGA
GAACTGGGTTTTCTCCCAGTACTCCAGCAATTCATTTCTGAAAGCAGTTGAGCCACTTTATTCCAAAGTACACTGCAGATGTTCAAACTC
TCCATTTCTCTTTCCCCTTCCACCTGCCAGTTTTGCTGACTCTCAACTTGTCATGAGTGTAAGCATTAAGGACATTATGCTTCTTCGATT
CTGAAGACAGGTCCCTGCTCATGGATGACTCTGGCTTCCTTAGGAAAATATTTTTCTTCCAAAATCAGTAGGAAATCTAAACTTATCCCC
TCTTTGCAGATGTCTAGCAGCTTCAGACATTTGGTTAAGAACCCATGGGAAAAAAAAAATCCTTGCTAATGTGGTTTCCTTTGTAAACCA
GGATTCTTATTTGTGCTGTTATAGAATATCAGCTCTGAACGTGTGGTAAAGATTTTTGTGTTTGAATATAGGAGAAATCAGTTTGCTGAA
AAGTTAGTCTTAATTATCTATTGGCCACGATGAAACAGATTTCAACTGATAAAGAGCTGGAGAACTCCATGTACTTTGGAATCTCCTCCA
AGATAGCCAGAGTTTAATACATCTTCATTCTCAACACTCTCCAAAGAACTTGACCTACCTTATGGGTTCCATATTTTTCTTCTTAAATGT
GCATCAATCATGCCTTGCCCCCAACCTTTAAATATATTCTTAGACCTGGTAAATGCACTCAGACTTGCGTCTTTAGGAATTTTTAACTTT
CTTTCACTACATTGGCACTTAAATTTTTTCTTTATAAAGCTTTTTGAAGGTCATAAACAAAGACCATAATTGATGATAGACCTAATACAT
TTCCTCTGTGTGTGTGTGTAACATTCCAAATACTTTTTTTTTCTTTTCCACTGTTTGTAAGGTGCAACAATTTAATATTTTTAAGGGACT
TTTTAAGAGTTCCTTAAGAACCAATTTAAAATTACTTCAGTGCAATCCTACACAGTATCAACATTAGAATTTTGATATTAGTCTTATGTT
ATCTTCCATTCTATTTTTATCTGCTTTTTGCTGCTAGTTTCAAACTGCCAGTATTTTTCCTTTTGCTTTTAAAATAGTTACAATATTTTT
CATGATAGCCACAGTATTGCCACAGTTTATTATAATAAAGGGTTTTTATTTGATTTAGCGCATTCAAAGCTTTTTTCTATCACTTTTGTG
TTCAGAATATAACCTTTGTGTGCGTGTATGTTGTGTGTGTGCATGTGTGGCGTATATGTGTGTTACAGGTTAATGCCTTCTTGGAATTGT
GTTAATGTTCTCTTGGTTTATTATGCCATCAGAATGGTAAATGAGAACACTACAACTGTAGTCAGCTCACAATTTTTAAATAAAGGATAC

>In-frame_MYH11_ENST00000576790_chr16_15809021_-_MYLK_ENST00000360304_chr3_123383105_-_9444nt
GCAGGGAGATTTGGACGCTCCGGCCTGGGAGGTGCGTCAGATCCGAGCTCGCCATCCAGTTTCCTCTCCACTAGTCCCCCCAGTTGGAGA
TCTGGGACCAACAAGGCACCATGGCGCAGAAGGGCCAACTCAGTGACGATGAGAAGTTCCTCTTTGTGGACAAAAACTTCATCAACAGCC
CAGTGGCCCAGGCTGACTGGGCCGCCAAGAGACTCGTCTGGGTCCCCTCGGAGAAGCAGGGCTTCGAGGCAGCCAGCATTAAGGAGGAGA
AGGGGGATGAGGTGGTTGTGGAGCTGGTGGAGAATGGCAAGAAGGTCACGGTTGGGAAAGATGACATCCAGAAGATGAACCCACCCAAGT
TCTCCAAGGTGGAGGACATGGCGGAGCTGACGTGCCTCAACGAAGCCTCCGTGCTACACAACCTGAGGGAGCGGTACTTCTCAGGGCTAA
TATATACGTACTCTGGCCTCTTCTGCGTGGTGGTCAACCCCTATAAACACCTGCCCATCTACTCGGAGAAGATCGTCGACATGTACAAGG
GCAAGAAGAGGCACGAGATGCCGCCTCACATCTACGCCATCGCAGACACGGCCTACCGGAGCATGCTTCAAGATCGGGAGGACCAGTCCA
TTCTATGCACAGGCGAGTCTGGAGCCGGGAAAACCGAAAACACCAAGAAGGTCATTCAGTACCTGGCCGTGGTGGCCTCCTCCCACAAGG
GCAAGAAAGACACAAGTATCACGGGAGAGCTGGAAAAGCAGCTTCTACAAGCAAACCCGATTCTGGAGGCTTTCGGCAACGCCAAAACAG
TGAAGAACGACAACTCCTCACGATTCGGCAAATTCATCCGCATCAACTTCGACGTCACGGGTTACATCGTGGGAGCCAACATTGAGACCT
ATCTGCTAGAAAAATCACGGGCAATTCGCCAAGCCAGAGACGAGAGGACATTCCACATCTTTTACTACATGATTGCTGGAGCCAAGGAGA
AGATGAGAAGTGACTTGCTTTTGGAGGGCTTCAACAACTACACCTTCCTCTCCAATGGCTTTGTGCCCATCCCAGCAGCCCAGGATGATG
AGATGTTCCAGGAAACCGTGGAGGCCATGGCAATCATGGGTTTCAGCGAGGAGGAGCAGCTATCCATATTGAAGGTGGTATCATCGGTCC
TGCAGCTTGGAAATATCGTCTTCAAGAAGGAAAGAAACACAGACCAGGCGTCCATGCCAGATAACACAGCTGCTCAGAAAGTTTGCCACC
TCATGGGAATTAATGTGACAGATTTCACCAGATCCATCCTCACTCCTCGTATCAAGGTTGGGCGAGATGTGGTACAGAAAGCTCAGACAA
AAGAACAGGCTGACTTTGCTGTAGAGGCTTTGGCCAAGGCAACATATGAGCGCCTTTTCCGCTGGATACTCACCCGCGTGAACAAAGCCC
TGGACAAGACCCATCGGCAAGGGGCTTCCTTCCTGGGGATCCTGGATATAGCTGGATTTGAGATCTTTGAGGTGAACTCCTTCGAGCAGC
TGTGCATCAACTACACCAACGAGAAGCTGCAGCAGCTCTTCAACCACACCATGTTCATCCTGGAGCAGGAGGAGTACCAGCGCGAGGGCA
TCGAGTGGAACTTCATCGACTTTGGGCTGGACCTACAGCCCTGCATCGAGCTCATCGAGCGACCGAACAACCCTCCAGGTGTGCTGGCCC
TGCTGGACGAGGAATGCTGGTTCCCCAAAGCCACGGACAAGTCTTTCGTGGAGAAGCTGTGCACGGAGCAGGGCAGCCACCCCAAGTTCC
AGAAGCCCAAGCAGCTCAAGGACAAGACTGAGTTCTCCATCATCCATTATGCTGGGAAGGTGGACTATAATGCGAGTGCCTGGCTGACCA
AGAATATGGACCCGCTGAATGACAACGTGACTTCCCTGCTCAATGCCTCCTCCGACAAGTTTGTGGCCGACCTGTGGAAGGACGTGGACC
GCATCGTGGGCCTGGACCAGATGGCCAAGATGACGGAGAGCTCGCTGCCCAGCGCCTCCAAGACCAAGAAGGGCATGTTCCGCACAGTGG
GGCAGCTGTACAAGGAGCAGCTGGGCAAGCTGATGACCACGCTACGCAACACCACGCCCAACTTCGTGCGCTGCATCATCCCCAACCACG
AGAAGAGGTCCGGCAAGCTGGATGCGTTCCTGGTGCTGGAGCAGCTGCGGTGCAATGGGGTGCTGGAAGGCATTCGCATCTGCCGGCAGG
GCTTCCCCAACCGGATCGTCTTCCAGGAGTTCCGCCAACGCTACGAGATCCTGGCGGCGAATGCCATCCCCAAAGGCTTCATGGACGGGA
AGCAGGCCTGCATTCTCATGATCAAAGCCCTGGAACTTGACCCCAACTTATACAGGATAGGGCAGAGCAAAATCTTCTTCCGAACTGGCG
TCCTGGCCCACCTAGAGGAGGAGCGAGATTTGAAGATCACCGATGTCATCATGGCCTTCCAGGCGATGTGTCGTGGCTACTTGGCCAGAA
AGGCTTTTGCCAAGAGGCAGCAGCAGCTGACCGCCATGAAGGTGATTCAGAGGAACTGCGCCGCCTACCTCAAGCTGCGGAACTGGCAGT
GGTGGAGGCTTTTCACCAAAGTGAAGCCACTGCTGCAGGTGACACGGCAGGAGGAGGAGATGCAGGCCAAGGAGGATGAACTGCAGAAGA
CCAAGGAGCGGCAGCAGAAGGCAGAGAATGAGCTTAAGGAGCTGGAACAGAAGCACTCGCAGCTGACCGAGGAGAAGAACCTGCTACAGG
AACAGCTGCAGGCAGAGACAGAGCTGTATGCAGAGGCTGAGGAGATGCGGGTGCGGCTGGCGGCCAAGAAGCAGGAGCTGGAGGAGATAC
TGCATGAGATGGAGGCCCGCCTGGAGGAGGAGGAAGACAGGGGCCAGCAGCTACAGGCTGAAAGGAAGAAGATGGCCCAGCAGATGCTGG
ACCTTGAAGAACAGCTGGAGGAGGAGGAAGCTGCCAGGCAGAAGCTGCAACTTGAGAAGGTCACGGCTGAGGCCAAGATCAAGAAACTGG
AGGATGAGATCCTGGTCATGGATGATCAGAACAATAAACTATCAAAAGAACGAAAACTCCTTGAGGAGAGGATTAGTGACTTAACGACAA
ATCTTGCAGAAGAGGAAGAAAAGGCCAAGAATCTTACCAAGCTGAAAAACAAGCATGAATCTATGATTTCAGAACTGGAAGTGCGGCTAA
AGAAGGAAGAGAAGAGCCGACAGGAGCTGGAGAAGCTGAAACGGAAGCTGGAGGGTGATGCCAGCGACTTCCACGAGCAGATCGCTGACC
TCCAGGCGCAGATCGCAGAGCTCAAGATGCAGCTGGCCAAGAAGGAGGAGGAGCTGCAGGCGGCCCTGGCCAGGCTTGACGATGAAATCG
CTCAGAAGAACAATGCCCTGAAGAAGATCCGGGAGCTGGAGGGCCACATCTCAGACCTCCAGGAGGACCTGGACTCAGAGCGGGCCGCCA
GGAACAAGGCTGAAAAGCAGAAGCGAGACCTCGGCGAGGAGCTGGAGGCCCTAAAGACAGAGCTGGAAGACACACTGGACAGCACAGCCA
CTCAGCAGGAGCTCAGGGCCAAGAGGGAGCAGGAGGTGACGGTGCTGAAGAAGGCCCTGGATGAAGAGACGCGGTCCCATGAGGCTCAGG
TCCAGGAGATGAGGCAGAAACACGCACAGGCGGTGGAGGAGCTCACAGAGCAGCTTGAGCAGTTCAAGAGGGCCAAGGCGAACCTAGACA
AGAATAAGCAGACGCTGGAGAAAGAGAACGCAGACCTGGCCGGGGAGCTGCGGGTCCTGGGCCAGGCCAAGCAGGAGGTGGAACATAAGA
AGAAGAAGCTGGAGGCGCAGGTGCAGGAGCTGCAGTCCAAGTGCAGCGATGGGGAGCGGGCCCGGGCGGAGCTCAATGACAAAGTCCACA
AGCTGCAGAATGAAGTTGAGAGCGTCACAGGGATGCTTAACGAGGCCGAGGGGAAGGCCATTAAGCTGGCCAAGGACGTGGCGTCCCTCA
GTTCCCAGCTCCAGGACACCCAGGAGCTGCTTCAAGAAGAAACCCGGCAGAAGCTCAACGTGTCTACGAAGCTGCGCCAGCTGGAGGAGG
AGCGGAACAGCCTGCAAGACCAGCTGGACGAGGAGATGGAGGCCAAGCAGAACCTGGAGCGCCACATCTCCACTCTCAACATCCAGCTCT
CCGACTCGAAGAAGAAGCTGCAGGACTTTGCCAGCACCGTGGAAGCTCTGGAAGAGGGGAAGAAGAGGTTCCAGAAGGAGATCGAGAACC
TCACCCAGCAGTACGAGGAGAAGGCGGCCGCTTATGATAAACTGGAAAAGACCAAGAACAGGCTTCAGCAGGAGCTGGACGACCTGGTTG
TTGATTTGGACAACCAGCGGCAACTCGTGTCCAACCTGGAAAAGAAGCAGAGGAAATTTGATCAGTTGTTAGCCGAGGAGAAAAACATCT
CTTCCAAATACGCGGATGAGAGGGACAGAGCTGAGGCAGAAGCCAGGGAGAAGGAAACCAAGGCCCTGTCCCTGGCTCGGGCCCTTGAAG
AGGCCTTGGAAGCCAAAGAGGAACTCGAGCGGACCAACAAAATGCTCAAAGCCGAAATGGAAGACCTGGTCAGCTCCAAGGATGACGTGG
GCAAGAACGTCCATGAGCTGGAGAAGTCCAAGCGGGCCCTGGAGACCCAGATGGAGGAGATGAAGACGCAGCTGGAAGAGCTGGAGGACG
AGCTGCAAGCCACGGAGGACGCCAAACTGCGGCTGGAAGTCAACATGCAGGCGCTCAAGGGCCAGTTCGAAAGGGATCTCCAAGCCCGGG
ACGAGCAGAATGAGGAGAAGAGGAGGCAACTGCAGAGACAGCTTCACGAGTATGAGACGGAACTGGAAGACGAGCGAAAGCAACGTGCCC
TGGCAGCTGCAGCAAAGAAGAAGCTGGAAGGGGACCTGAAAGACCTGGAGCTTCAGGCCGACTCTGCCATCAAGGGGAGGGAGGAAGCCA
TCAAGCAGCTACGCAAACTGCAGGCTCAGATGAAGGACTTTCAAAGAGAGCTGGAAGATGCCCGTGCCTCCAGAGATGAGATCTTTGCCA
CAGCCAAAGAGAATGAGAAGAAAGCCAAGAGCTTGGAAGCAGACCTCATGCAGCTACAAGAGGACCTCGCCGCCGCTGAGAGGGCTCGCA
AACAAGCGGACCTCGAGAAGGAGGAACTGGCAGAGGAGCTGGCCAGTAGCCTGTCGGGAAGGAACGCACTCCAGGACGAGAAGCGCCGCC
TGGAGGCCCGGATCGCCCAGCTGGAGGAGGAGCTGGAGGAGGAGCAGGGCAACATGGAGGCCATGAGCGACCGGGTCCGCAAAGCCACAC
AGCAGGCCGAGCAGCTCAGCAACGAGCTGGCCACAGAGCGCAGCACGGCCCAGAAGAATGAGAGTGCCCGGCAGCAGCTCGAGCGGCAGA
ACAAGGAGCTCCGGAGCAAGCTCCACGAGATGGAGGGGGCCGTCAAGTCCAAGTTCAAGTCCACCATCGCGGCGCTGGAGGCCAAGATTG
CACAGCTGGAGGAGCAGGTCGAGCAGGAGGCCAGAGAGAAACAGGCGGCCACCAAGTCGCTGAAGCAGAAAGACAAGAAGCTGAAGGAAA
TCTTGCTGCAGGTGGAGGACGAGCGCAAGATGGCCGAGCAGTACAAGGAGCAGATCCAGGAAAGCGAGCACATGAAGGTGGAGAACAGCG
AGAATGGCAGCAAGCTCACCATCCTGGCCGCGCGCCAGGAGCACTGCGGCTGCTACACACTGCTGGTGGAGAACAAGCTGGGCAGCAGGC
AGGCCCAGGTCAACCTCACTGTCGTGGATAAGCCAGACCCCCCAGCTGGCACACCTTGTGCCTCTGACATTCGGAGCTCCTCACTGACCC
TGTCCTGGTATGGCTCCTCATATGATGGGGGCAGTGCTGTACAGTCCTACAGCATCGAGATCTGGGACTCAGCCAACAAGACGTGGAAGG
AACTAGCCACATGCCGCAGCACCTCTTTCAACGTCCAGGACCTGCTGCCTGACCACGAATATAAGTTCCGTGTACGTGCAATCAACGTGT
ATGGAACCAGTGAGCCAAGCCAGGAGTCTGAACTCACAACGGTAGGAGAGAAACCTGAAGAGCCGAAGGATGAAGTGGAGGTGTCAGATG
ATGATGAGAAGGAGCCCGAGGTTGATTACCGGACAGTGACAATCAATACTGAACAAAAAGTATCTGACTTCTACGACATTGAGGAGAGAT
TAGGATCTGGGAAATTTGGACAGGTCTTTCGACTTGTAGAAAAGAAAACTCGAAAAGTCTGGGCAGGGAAGTTCTTCAAGGCATATTCAG
CAAAAGAGAAAGAGAATATCCGGCAGGAGATTAGCATCATGAACTGCCTCCACCACCCTAAGCTGGTCCAGTGTGTGGATGCCTTTGAAG
AAAAGGCCAACATCGTCATGGTCCTGGAGATCGTGTCAGGAGGGGAGCTGTTTGAGCGCATCATTGACGAGGACTTTGAGCTGACGGAGC
GTGAGTGCATCAAGTACATGCGGCAGATCTCGGAGGGAGTGGAGTACATCCACAAGCAGGGCATCGTGCACCTGGACCTCAAGCCGGAGA
ACATCATGTGTGTCAACAAGACGGGCACCAGGATCAAGCTCATCGACTTTGGTCTGGCCAGGAGGCTGGAGAATGCGGGGTCTCTGAAGG
TCCTCTTTGGCACCCCAGAATTTGTGGCTCCTGAAGTGATCAACTATGAGCCCATCGGCTACGCCACAGACATGTGGAGCATCGGGGTCA
TCTGCTACATCCTAGTCAGTGGCCTTTCCCCCTTCATGGGAGACAACGATAACGAAACCTTGGCCAACGTTACCTCAGCCACCTGGGACT
TCGACGACGAGGCATTCGATGAGATCTCCGACGATGCCAAGGATTTCATCAGCAATCTGCTGAAGAAAGATATGAAAAACCGCCTGGACT
GCACGCAGTGCCTTCAGCATCCATGGCTAATGAAAGATACCAAGAACATGGAGGCCAAGAAACTCTCCAAGGACCGGATGAAGAAGTACA
TGGCAAGAAGGAAATGGCAGAAAACGGGCAATGCTGTGAGAGCCATTGGAAGACTGTCCTCTATGGCAATGATCTCAGGGCTCAGTGGCA
GGAAATCCTCAACAGGGTCACCAACCAGCCCGCTCAATGCAGAAAAACTAGAATCTGAAGAAGATGTGTCCCAAGCTTTCCTTGAGGCTG
TTGCTGAGGAAAAGCCTCATGTAAAACCCTATTTCTCTAAGACCATTCGCGATTTAGAAGTTGTGGAGGGAAGTGCTGCTAGATTTGACT
GCAAGATTGAAGGATACCCAGACCCCGAGGTTGTCTGGTTCAAAGATGACCAGTCAATCAGGGAGTCCCGCCACTTCCAGATAGACTACG
ATGAGGACGGGAACTGCTCTTTAATTATTAGTGATGTTTGCGGGGATGACGATGCCAAGTACACCTGCAAGGCTGTCAACAGTCTTGGAG
AAGCCACCTGCACAGCAGAGCTCATTGTGGAAACGATGGAGGAAGGTGAAGGGGAAGGGGAAGAGGAAGAAGAGTGAAACAAAGCCAGAG
AAAAGCAGTTTCTAAGTCATATTAAAAGGACTATTTCTCTAAAACTCAAAAAAAAAAAAAAAACTCAAGATAGTAAAAGCACCTAGTGTG
ATAGATTATCGGTTAGGTCATTTGTGGGTTGATTCTTCAGAAACAGCAGTTGATACCTAGCAGCGTTATTGATGGGCATTAATCTATGTT
AGTTGGCACCTTAAGATACTAGTGCAGCTAGATTTCATTTAGGGAAATCACCAGTAACTTGACTGACCAATTGATTTTAGAGAGAAAGTA
ACCAAACCAAATATTTATCTGGGCAAAGTCATAAATTCTCCACTTGAATGCGCTCATGAAAAATAAGGCCAAAACAAGAGTTCTGGGCCA
CAGCTCAGCCCAGAGGGTTCCTGGGGATGGGAGGCCTCTCTCTCCCCACCCCCTGACTCTAGAGAACTGGGTTTTCTCCCAGTACTCCAG
CAATTCATTTCTGAAAGCAGTTGAGCCACTTTATTCCAAAGTACACTGCAGATGTTCAAACTCTCCATTTCTCTTTCCCCTTCCACCTGC
CAGTTTTGCTGACTCTCAACTTGTCATGAGTGTAAGCATTAAGGACATTATGCTTCTTCGATTCTGAAGACAGGTCCCTGCTCATGGATG
ACTCTGGCTTCCTTAGGAAAATATTTTTCTTCCAAAATCAGTAGGAAATCTAAACTTATCCCCTCTTTGCAGATGTCTAGCAGCTTCAGA
CATTTGGTTAAGAACCCATGGGAAAAAAAAAATCCTTGCTAATGTGGTTTCCTTTGTAAACCAGGATTCTTATTTGTGCTGTTATAGAAT
ATCAGCTCTGAACGTGTGGTAAAGATTTTTGTGTTTGAATATAGGAGAAATCAGTTTGCTGAAAAGTTAGTCTTAATTATCTATTGGCCA
CGATGAAACAGATTTCAACTGATAAAGAGCTGGAGAACTCCATGTACTTTGGAATCTCCTCCAAGATAGCCAGAGTTTAATACATCTTCA
TTCTCAACACTCTCCAAAGAACTTGACCTACCTTATGGGTTCCATATTTTTCTTCTTAAATGTGCATCAATCATGCCTTGCCCCCAACCT
TTAAATATATTCTTAGACCTGGTAAATGCACTCAGACTTGCGTCTTTAGGAATTTTTAACTTTCTTTCACTACATTGGCACTTAAATTTT
TTCTTTATAAAGCTTTTTGAAGGTCATAAACAAAGACCATAATTGATGATAGACCTAATACATTTCCTCTGTGTGTGTGTGTAACATTCC
AAATACTTTTTTTTTCTTTTCCACTGTTTGTAAGGTGCAACAATTTAATATTTTTAAGGGACTTTTTAAGAGTTCCTTAAGAACCAATTT
AAAATTACTTCAGTGCAATCCTACACAGTATCAACATTAGAATTTTGATATTAGTCTTATGTTATCTTCCATTCTATTTTTATCTGCTTT
TTGCTGCTAGTTTCAAACTGCCAGTATTTTTCCTTTTGCTTTTAAAATAGTTACAATATTTTTCATGATAGCCACAGTATTGCCACAGTT
TATTATAATAAAGGGTTTTTATTTGATTTAGCGCATTCAAAGCTTTTTTCTATCACTTTTGTGTTCAGAATATAACCTTTGTGTGCGTGT
ATGTTGTGTGTGTGCATGTGTGGCGTATATGTGTGTTACAGGTTAATGCCTTCTTGGAATTGTGTTAATGTTCTCTTGGTTTATTATGCC


Top

FusionGenePPI for MYH11_MYLK


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MYH11SLX1B, GRB2, DAXX, APC, YWHAQ, SP1, FBXO25, MYOC, SHC1, ACTA2, ACTB, DSTN, MYO1E, EIF3A, RPA1, RPA2, RPA3, LGR4, FAM96A, OVCA2, RWDD2B, MYO5A, SFN, C4BPA, CAPZB, FLNA, MYL6, RAD51, SVIL, YWHAE, ARPC5, ACTR3, RALBP1, POC1A, ASTE1, MED4, LRRC59, CGN, INF2, ARPC5L, TBC1D31, UBXN2A, PLBD2, TMEM189, ZNF746, MPP1, GDF9, COQ2, COX15, DLST, DNM1L, PARK7, PDHA1, SOAT1, SOD1, VDAC1MYLKPRKG2, CALM1, CTTN, PAK1, MLC1, SRC, ALK, MYC, TP53, GOPC, HSPB1, MYH9, PPP1CB, ANLN, MYO19


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MYH11_MYLK


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MYH11_MYLK


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMYH11C0023467Leukemia, Myelocytic, Acute2CTD_human
HgeneMYH11C0023479Acute myelomonocytic leukemia1CTD_human;ORPHANET
HgeneMYH11C1851504Aortic aneurysm, familial thoracic 41CTD_human;UNIPROT
TgeneMYLKC0027626Neoplasm Invasiveness2CTD_human
TgeneMYLKC0027627Neoplasm Metastasis2CTD_human
TgeneMYLKC0017178Gastrointestinal Diseases1CTD_human
TgeneMYLKC0017601Glaucoma1CTD_human
TgeneMYLKC0017638Glioma1CTD_human
TgeneMYLKC0020443Hypercholesterolemia1CTD_human
TgeneMYLKC0020517Hypersensitivity1CTD_human
TgeneMYLKC0032285Pneumonia1CTD_human
TgeneMYLKC0042373Vascular Diseases1CTD_human
TgeneMYLKC0242488Acute Lung Injury1CTD_human
TgeneMYLKC1527311Brain Edema1CTD_human
TgeneMYLKC3151077AORTIC ANEURYSM, FAMILIAL THORACIC 71UNIPROT