FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22846

FusionGeneSummary for MTUS1_ASAH1

check button Fusion gene summary
Fusion gene informationFusion gene name: MTUS1_ASAH1
Fusion gene ID: 22846
HgeneTgene
Gene symbol

MTUS1

ASAH1

Gene ID

57509

427

Gene namemicrotubule associated scaffold protein 1N-acylsphingosine amidohydrolase 1
SynonymsATBP|ATIP|ATIP3|ICIS|MP44|MTSG1AC|ACDase|ASAH|PHP|PHP32|SMAPME
Cytomap

8p22

8p22

Type of geneprotein-codingprotein-coding
Descriptionmicrotubule-associated tumor suppressor 1AT2 receptor-binding proteinAT2 receptor-interacting proteinAT2R binding proteinangiotensin-II type 2 receptor-interacting proteinerythroid differentiation-relatedmicrotubule associated tumor suppressor 1mitacid ceramidaseN-acylsphingosine amidohydrolase (acid ceramidase) 1acid CDaseacylsphingosine deacylaseputative 32 kDa heart protein
Modification date2018052320180529
UniProtAcc

Q9ULD2

Q13510

Ensembl transtripts involved in fusion geneENST00000544260, ENST00000381869, 
ENST00000381861, ENST00000262102, 
ENST00000519263, ENST00000400046, 
ENST00000297488, ENST00000518713, 
ENST00000381862, 
ENST00000262097, 
ENST00000381733, ENST00000417108, 
ENST00000520781, ENST00000314146, 
ENST00000520051, 
Fusion gene scores* DoF score3 X 3 X 4=366 X 6 X 5=180
# samples 67
** MAII scorelog2(6/36*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(7/180*10)=-1.36257007938471
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MTUS1 [Title/Abstract] AND ASAH1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-HU-A4GF-01AMTUS1chr8

17601113

-ASAH1chr8

17920739

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000544260ENST00000262097MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000544260ENST00000381733MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000544260ENST00000417108MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000544260ENST00000520781MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000544260ENST00000314146MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-intronENST00000544260ENST00000520051MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000381869ENST00000262097MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000381869ENST00000381733MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000381869ENST00000417108MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000381869ENST00000520781MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000381869ENST00000314146MTUS1chr8

17601113

-ASAH1chr8

17920739

-
5CDS-intronENST00000381869ENST00000520051MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000381861ENST00000262097MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000381861ENST00000381733MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000381861ENST00000417108MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000381861ENST00000520781MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000381861ENST00000314146MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-intronENST00000381861ENST00000520051MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000262102ENST00000262097MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000262102ENST00000381733MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000262102ENST00000417108MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000262102ENST00000520781MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000262102ENST00000314146MTUS1chr8

17601113

-ASAH1chr8

17920739

-
5CDS-intronENST00000262102ENST00000520051MTUS1chr8

17601113

-ASAH1chr8

17920739

-
In-frameENST00000519263ENST00000262097MTUS1chr8

17601113

-ASAH1chr8

17920739

-
In-frameENST00000519263ENST00000381733MTUS1chr8

17601113

-ASAH1chr8

17920739

-
In-frameENST00000519263ENST00000417108MTUS1chr8

17601113

-ASAH1chr8

17920739

-
In-frameENST00000519263ENST00000520781MTUS1chr8

17601113

-ASAH1chr8

17920739

-
In-frameENST00000519263ENST00000314146MTUS1chr8

17601113

-ASAH1chr8

17920739

-
5CDS-intronENST00000519263ENST00000520051MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000400046ENST00000262097MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000400046ENST00000381733MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000400046ENST00000417108MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000400046ENST00000520781MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000400046ENST00000314146MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-intronENST00000400046ENST00000520051MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000297488ENST00000262097MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000297488ENST00000381733MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000297488ENST00000417108MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000297488ENST00000520781MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000297488ENST00000314146MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-intronENST00000297488ENST00000520051MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000518713ENST00000262097MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000518713ENST00000381733MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000518713ENST00000417108MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000518713ENST00000520781MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-3CDSENST00000518713ENST00000314146MTUS1chr8

17601113

-ASAH1chr8

17920739

-
intron-intronENST00000518713ENST00000520051MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000381862ENST00000262097MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000381862ENST00000381733MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000381862ENST00000417108MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000381862ENST00000520781MTUS1chr8

17601113

-ASAH1chr8

17920739

-
Frame-shitENST00000381862ENST00000314146MTUS1chr8

17601113

-ASAH1chr8

17920739

-
5CDS-intronENST00000381862ENST00000520051MTUS1chr8

17601113

-ASAH1chr8

17920739

-

Top

FusionProtFeatures for MTUS1_ASAH1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MTUS1

Q9ULD2

ASAH1

Q13510

Hydrolyzes the sphingolipid ceramide into sphingosineand free fatty acid. {ECO:0000269|PubMed:7744740}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for MTUS1_ASAH1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000262097_chr8_17920739_-_1006aa
MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDTETDPAVVTGENISLSLQGVEVFGHEKSSSDFI
SKQVLDMHKDSICQCPALVGTEKPKTLQHSCHSLEAVEGQSVEPSLPFVWKPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGK
SQSFHTAGSLPPTGRRSGSTSSLSTSTWTSSHSDKTHARETTTDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGK
VTSEYTDGSQQRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSTCLIDDECPLMVPAFDKS
EAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVISTDKTMCMSTPVLEPTKVTFSVSPIEATEK
CKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSAS
SPSSVNSRQQTVLSRTPRSDLNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV
SALFQKIKGILPVKMESAECLEMTTVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFETGSLFLGSASKTTTTSGRNISKPDSCGLR
QIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFK
ASSFAGTVGMLTGFKPGLFSLTLNERFSINGGTLGILEWILGKKDVMWIGFLTRTVLENSTSTEEAKNLLTKTKILAPAYFILGGNQSGE
GCVITRDRKESLDVTELDAKQGRWTVVQTNTDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMTDVLSTKPVLNKLTVYTTLIDVTKGQ

>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000381733_chr8_17920739_-_1006aa
MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDTETDPAVVTGENISLSLQGVEVFGHEKSSSDFI
SKQVLDMHKDSICQCPALVGTEKPKTLQHSCHSLEAVEGQSVEPSLPFVWKPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGK
SQSFHTAGSLPPTGRRSGSTSSLSTSTWTSSHSDKTHARETTTDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGK
VTSEYTDGSQQRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSTCLIDDECPLMVPAFDKS
EAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVISTDKTMCMSTPVLEPTKVTFSVSPIEATEK
CKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSAS
SPSSVNSRQQTVLSRTPRSDLNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV
SALFQKIKGILPVKMESAECLEMTTVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFETGSLFLGSASKTTTTSGRNISKPDSCGLR
QIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFK
ASSFAGTVGMLTGFKPGLFSLTLNERFSINGGTLGILEWILGKKDVMWIGFLTRTVLENSTSTEEAKNLLTKTKILAPAYFILGGNQSGE
GCVITRDRKESLDVTELDAKQGRWTVVQTNTDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMTDVLSTKPVLNKLTVYTTLIDVTKGQ

>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000417108_chr8_17920739_-_1006aa
MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDTETDPAVVTGENISLSLQGVEVFGHEKSSSDFI
SKQVLDMHKDSICQCPALVGTEKPKTLQHSCHSLEAVEGQSVEPSLPFVWKPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGK
SQSFHTAGSLPPTGRRSGSTSSLSTSTWTSSHSDKTHARETTTDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGK
VTSEYTDGSQQRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSTCLIDDECPLMVPAFDKS
EAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVISTDKTMCMSTPVLEPTKVTFSVSPIEATEK
CKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSAS
SPSSVNSRQQTVLSRTPRSDLNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV
SALFQKIKGILPVKMESAECLEMTTVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFETGSLFLGSASKTTTTSGRNISKPDSCGLR
QIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFK
ASSFAGTVGMLTGFKPGLFSLTLNERFSINGGTLGILEWILGKKDVMWIGFLTRTVLENSTSTEEAKNLLTKTKILAPAYFILGGNQSGE
GCVITRDRKESLDVTELDAKQGRWTVVQTNTDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMTDVLSTKPVLNKLTVYTTLIDVTKGQ

>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000520781_chr8_17920739_-_1006aa
MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDTETDPAVVTGENISLSLQGVEVFGHEKSSSDFI
SKQVLDMHKDSICQCPALVGTEKPKTLQHSCHSLEAVEGQSVEPSLPFVWKPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGK
SQSFHTAGSLPPTGRRSGSTSSLSTSTWTSSHSDKTHARETTTDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGK
VTSEYTDGSQQRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSTCLIDDECPLMVPAFDKS
EAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVISTDKTMCMSTPVLEPTKVTFSVSPIEATEK
CKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSAS
SPSSVNSRQQTVLSRTPRSDLNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV
SALFQKIKGILPVKMESAECLEMTTVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFETGSLFLGSASKTTTTSGRNISKPDSCGLR
QIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFK
ASSFAGTVGMLTGFKPGLFSLTLNERFSINGGTLGILEWILGKKDVMWIGFLTRTVLENSTSTEEAKNLLTKTKILAPAYFILGGNQSGE
GCVITRDRKESLDVTELDAKQGRWTVVQTNTDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMTDVLSTKPVLNKLTVYTTLIDVTKGQ

>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000314146_chr8_17920739_-_1006aa
MTDDNSDDKIEDELQTFFTSDKDGNTHAYNPKSPPTQNSSASSVNWNSANPDDMVVDTETDPAVVTGENISLSLQGVEVFGHEKSSSDFI
SKQVLDMHKDSICQCPALVGTEKPKTLQHSCHSLEAVEGQSVEPSLPFVWKPNDNLNCAGYCDALELNQTFDMTVDKVNCTFISHHAIGK
SQSFHTAGSLPPTGRRSGSTSSLSTSTWTSSHSDKTHARETTTDRESFENPQVTPSEAQDMTYTAFSDVVMQSEVFVSDIGNQCACSSGK
VTSEYTDGSQQRLVGEKETQALTPVSDGMEVPNDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNLRETVSTCLIDDECPLMVPAFDKS
EAQVLNPEHKVTETEDTQMVSKGKDLGTQNHTSELILSSPPGQKVGSSFGLTWDANDMVISTDKTMCMSTPVLEPTKVTFSVSPIEATEK
CKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAKVMSRAVLQPKDAALSKVTPRPQQTSAS
SPSSVNSRQQTVLSRTPRSDLNADKKAEILINKTHKQQFNKLITSQAVHVTTHSKNASHRVPRTTSAVKSNQEDVDKASSSNSACETGSV
SALFQKIKGILPVKMESAECLEMTTVPNIDRISPEKKGEKENGTSMEKQELKQEIMNETFETGSLFLGSASKTTTTSGRNISKPDSCGLR
QIAAPKAKVGPPVSCLRRNSDNRNPSADRAVSPQRIRRVSSSGHLIHGRNMDFGVFLGWNINNDTWVITEQLKPLTVNLDFQRNNKTVFK
ASSFAGTVGMLTGFKPGLFSLTLNERFSINGGTLGILEWILGKKDVMWIGFLTRTVLENSTSTEEAKNLLTKTKILAPAYFILGGNQSGE
GCVITRDRKESLDVTELDAKQGRWTVVQTNTDRWKHPFFLDDRRTPAKMCLNRTSQENISFETMTDVLSTKPVLNKLTVYTTLIDVTKGQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000262097_chr8_17920739_-_3018nt
ATGACTGATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAAC
CCGAAATCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACT
GACCCTGCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATT
AGTAAGCAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGT
TGTCATTCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGC
TACTGTGATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAG
AGTCAGTCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCT
TCCCATTCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGAC
ATGACTTACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAG
GTCACCAGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAA
GTCCCCAATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCAC
AAGGAAATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGC
GAAGCTCAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAAT
CATACCTCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATT
AGCACAGACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAA
TGTAAGAAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGA
AAATCAACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTC
AAAGCAAAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCA
TCACCCTCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTA
ATTAACAAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGG
GTTCCAAGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTT
TCTGCGTTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGAT
AGGATTAGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTT
GAATATGGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGG
CAAATAGCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCC
GTATCTCCTCAGAGGATCAGGCGTGTGTCCAGTTCTGGTCATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAAC
ATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAG
GCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAAT
GGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGC
ACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAA
GGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAAT
TATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCA
TTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAA

>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000381733_chr8_17920739_-_3018nt
ATGACTGATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAAC
CCGAAATCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACT
GACCCTGCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATT
AGTAAGCAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGT
TGTCATTCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGC
TACTGTGATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAG
AGTCAGTCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCT
TCCCATTCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGAC
ATGACTTACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAG
GTCACCAGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAA
GTCCCCAATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCAC
AAGGAAATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGC
GAAGCTCAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAAT
CATACCTCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATT
AGCACAGACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAA
TGTAAGAAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGA
AAATCAACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTC
AAAGCAAAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCA
TCACCCTCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTA
ATTAACAAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGG
GTTCCAAGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTT
TCTGCGTTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGAT
AGGATTAGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTT
GAATATGGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGG
CAAATAGCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCC
GTATCTCCTCAGAGGATCAGGCGTGTGTCCAGTTCTGGTCATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAAC
ATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAG
GCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAAT
GGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGC
ACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAA
GGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAAT
TATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCA
TTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAA

>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000417108_chr8_17920739_-_3018nt
ATGACTGATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAAC
CCGAAATCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACT
GACCCTGCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATT
AGTAAGCAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGT
TGTCATTCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGC
TACTGTGATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAG
AGTCAGTCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCT
TCCCATTCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGAC
ATGACTTACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAG
GTCACCAGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAA
GTCCCCAATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCAC
AAGGAAATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGC
GAAGCTCAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAAT
CATACCTCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATT
AGCACAGACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAA
TGTAAGAAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGA
AAATCAACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTC
AAAGCAAAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCA
TCACCCTCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTA
ATTAACAAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGG
GTTCCAAGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTT
TCTGCGTTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGAT
AGGATTAGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTT
GAATATGGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGG
CAAATAGCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCC
GTATCTCCTCAGAGGATCAGGCGTGTGTCCAGTTCTGGTCATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAAC
ATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAG
GCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAAT
GGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGC
ACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAA
GGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAAT
TATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCA
TTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAA

>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000520781_chr8_17920739_-_3018nt
ATGACTGATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAAC
CCGAAATCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACT
GACCCTGCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATT
AGTAAGCAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGT
TGTCATTCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGC
TACTGTGATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAG
AGTCAGTCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCT
TCCCATTCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGAC
ATGACTTACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAG
GTCACCAGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAA
GTCCCCAATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCAC
AAGGAAATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGC
GAAGCTCAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAAT
CATACCTCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATT
AGCACAGACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAA
TGTAAGAAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGA
AAATCAACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTC
AAAGCAAAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCA
TCACCCTCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTA
ATTAACAAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGG
GTTCCAAGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTT
TCTGCGTTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGAT
AGGATTAGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTT
GAATATGGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGG
CAAATAGCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCC
GTATCTCCTCAGAGGATCAGGCGTGTGTCCAGTTCTGGTCATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAAC
ATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAG
GCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAAT
GGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGC
ACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAA
GGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAAT
TATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCA
TTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAA

>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000314146_chr8_17920739_-_3018nt
ATGACTGATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAAC
CCGAAATCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACT
GACCCTGCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATT
AGTAAGCAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGT
TGTCATTCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGC
TACTGTGATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAG
AGTCAGTCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCT
TCCCATTCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGAC
ATGACTTACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAG
GTCACCAGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAA
GTCCCCAATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCAC
AAGGAAATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGC
GAAGCTCAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAAT
CATACCTCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATT
AGCACAGACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAA
TGTAAGAAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGA
AAATCAACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTC
AAAGCAAAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCA
TCACCCTCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTA
ATTAACAAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGG
GTTCCAAGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTT
TCTGCGTTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGAT
AGGATTAGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTT
GAATATGGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGG
CAAATAGCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCC
GTATCTCCTCAGAGGATCAGGCGTGTGTCCAGTTCTGGTCATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAAC
ATAAATAATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAG
GCTTCAAGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAAT
GGTGGTTATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGC
ACAAGTTATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAA
GGTTGTGTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAAT
TATGACCGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCA
TTTGAAACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000262097_chr8_17920739_-_4301nt
AAACATTTTATTTCTTCCAGGGAACAACAAATCATTTAATCTTCAGAGCATCTTAGACTGAAAACCTTTCAACTGTGCTGAAAAACCTAG
AAGACAGACCATTTTGCCCACCCTCTCATTTAAAAGGAATTGAAGAAGAAATAAAATGGCAGAGGTTTAAGGTTACTATTCAGGATGACT
GATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAACCCGAAA
TCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACTGACCCT
GCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATTAGTAAG
CAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGTTGTCAT
TCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGCTACTGT
GATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAGAGTCAG
TCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCTTCCCAT
TCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGACATGACT
TACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAGGTCACC
AGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAAGTCCCC
AATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCACAAGGAA
ATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGCGAAGCT
CAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAATCATACC
TCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATTAGCACA
GACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAATGTAAG
AAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGAAAATCA
ACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTCAAAGCA
AAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCATCACCC
TCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTAATTAAC
AAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGGGTTCCA
AGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTTTCTGCG
TTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGATAGGATT
AGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTTGAATAT
GGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGGCAAATA
GCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCCGTATCT
CCTCAGAGGATCAGGCGTGTGTCCAGTTCTGGTCATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAAT
AATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCA
AGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGT
TATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGT
TATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGT
GTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGAC
CGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAA
ACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAA
ACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCTGGCCTACAGAATGCGGCCTCTGAGACATGAAGACACCA
TCTCCATGTGACCGAACACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTCGCGGCAGGTTCTCTTTGAGTCAATAGCTTGTCTTCGTC
CATCTGTTGACAAATGACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTTTCTTATTTACAGATAACTTCTTTAGGGGAAGTAAAACA
GTCATCTAGAATTCACTGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGTGGGCAGTCGAACCATGGTGAACTCCACCTCCGTGGAAT
AAATGGAGATTCAGCGTGGGTGTTGAATCCAGCACGTCTGTGTGAGTAACGGGACAGTAAACACTCCACATTCTTCAGTTTTTCACTTCT
ACCTACATATTTGTATGTTTTTCTGTATAACAGCCTTTTCCTTCTGGTTCTAACTGCTGTTAAAATTAATATATCATTATCTTTGCTGTT
ATTGACAGCGATATAATTTTATTACATATGATTAGAGGGATGAGACAGACATTCACCTGTATATTTCTTTTAATGGGCACAAAATGGGCC
CTTGCCTCTAAATAGCACTTTTTGGGGTTCAAGAAGTAATCAGTATGCAAAGCAATCTTTTATACAATAATTGAAGTGTTCCCTTTTTCA
TAATTACTCTACTTCCCAGTAACCCTAAGGAAGTTGCTAACTTAAAAAACTGCATCCCACGTTCTGTTAATTTAGTAAATAAACAAGTCA
AAGACTTGTGGAAAATAGGAAGTGAACCCATATTTTAAATTCTCATAAGTAGCATTCATGTAATAAACAGGTTTTTAGTTTGTTCTTCAG
ATTGATAGGGAGTTTTAAAGAAATTTTAGTAGTTACTAAAATTATGTTACTGTATTTTTCAGAAATCAAACTGCTTATGAAAAGTACTAA
TAGAACTTGTTAACCTTTCTAACCTTCACGATTAACTGTGAAATGTACGTCATTTGTGCAAGACCGTTTGTCCACTTCATTTTGTATAAT

>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000381733_chr8_17920739_-_4300nt
AAACATTTTATTTCTTCCAGGGAACAACAAATCATTTAATCTTCAGAGCATCTTAGACTGAAAACCTTTCAACTGTGCTGAAAAACCTAG
AAGACAGACCATTTTGCCCACCCTCTCATTTAAAAGGAATTGAAGAAGAAATAAAATGGCAGAGGTTTAAGGTTACTATTCAGGATGACT
GATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAACCCGAAA
TCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACTGACCCT
GCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATTAGTAAG
CAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGTTGTCAT
TCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGCTACTGT
GATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAGAGTCAG
TCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCTTCCCAT
TCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGACATGACT
TACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAGGTCACC
AGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAAGTCCCC
AATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCACAAGGAA
ATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGCGAAGCT
CAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAATCATACC
TCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATTAGCACA
GACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAATGTAAG
AAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGAAAATCA
ACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTCAAAGCA
AAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCATCACCC
TCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTAATTAAC
AAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGGGTTCCA
AGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTTTCTGCG
TTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGATAGGATT
AGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTTGAATAT
GGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGGCAAATA
GCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCCGTATCT
CCTCAGAGGATCAGGCGTGTGTCCAGTTCTGGTCATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAAT
AATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCA
AGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGT
TATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGT
TATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGT
GTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGAC
CGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAA
ACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAA
ACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCTGGCCTACAGAATGCGGCCTCTGAGACATGAAGACACCA
TCTCCATGTGACCGAACACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTCGCGGCAGGTTCTCTTTGAGTCAATAGCTTGTCTTCGTC
CATCTGTTGACAAATGACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTTTCTTATTTACAGATAACTTCTTTAGGGGAAGTAAAACA
GTCATCTAGAATTCACTGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGTGGGCAGTCGAACCATGGTGAACTCCACCTCCGTGGAAT
AAATGGAGATTCAGCGTGGGTGTTGAATCCAGCACGTCTGTGTGAGTAACGGGACAGTAAACACTCCACATTCTTCAGTTTTTCACTTCT
ACCTACATATTTGTATGTTTTTCTGTATAACAGCCTTTTCCTTCTGGTTCTAACTGCTGTTAAAATTAATATATCATTATCTTTGCTGTT
ATTGACAGCGATATAATTTTATTACATATGATTAGAGGGATGAGACAGACATTCACCTGTATATTTCTTTTAATGGGCACAAAATGGGCC
CTTGCCTCTAAATAGCACTTTTTGGGGTTCAAGAAGTAATCAGTATGCAAAGCAATCTTTTATACAATAATTGAAGTGTTCCCTTTTTCA
TAATTACTCTACTTCCCAGTAACCCTAAGGAAGTTGCTAACTTAAAAAACTGCATCCCACGTTCTGTTAATTTAGTAAATAAACAAGTCA
AAGACTTGTGGAAAATAGGAAGTGAACCCATATTTTAAATTCTCATAAGTAGCATTCATGTAATAAACAGGTTTTTAGTTTGTTCTTCAG
ATTGATAGGGAGTTTTAAAGAAATTTTAGTAGTTACTAAAATTATGTTACTGTATTTTTCAGAAATCAAACTGCTTATGAAAAGTACTAA
TAGAACTTGTTAACCTTTCTAACCTTCACGATTAACTGTGAAATGTACGTCATTTGTGCAAGACCGTTTGTCCACTTCATTTTGTATAAT

>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000417108_chr8_17920739_-_4274nt
AAACATTTTATTTCTTCCAGGGAACAACAAATCATTTAATCTTCAGAGCATCTTAGACTGAAAACCTTTCAACTGTGCTGAAAAACCTAG
AAGACAGACCATTTTGCCCACCCTCTCATTTAAAAGGAATTGAAGAAGAAATAAAATGGCAGAGGTTTAAGGTTACTATTCAGGATGACT
GATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAACCCGAAA
TCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACTGACCCT
GCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATTAGTAAG
CAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGTTGTCAT
TCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGCTACTGT
GATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAGAGTCAG
TCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCTTCCCAT
TCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGACATGACT
TACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAGGTCACC
AGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAAGTCCCC
AATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCACAAGGAA
ATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGCGAAGCT
CAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAATCATACC
TCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATTAGCACA
GACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAATGTAAG
AAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGAAAATCA
ACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTCAAAGCA
AAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCATCACCC
TCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTAATTAAC
AAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGGGTTCCA
AGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTTTCTGCG
TTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGATAGGATT
AGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTTGAATAT
GGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGGCAAATA
GCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCCGTATCT
CCTCAGAGGATCAGGCGTGTGTCCAGTTCTGGTCATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAAT
AATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCA
AGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGT
TATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGT
TATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGT
GTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGAC
CGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAA
ACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAA
ACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCTGGCCTACAGAATGCGGCCTCTGAGACATGAAGACACCA
TCTCCATGTGACCGAACACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTCGCGGCAGGTTCTCTTTGAGTCAATAGCTTGTCTTCGTC
CATCTGTTGACAAATGACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTTTCTTATTTACAGATAACTTCTTTAGGGGAAGTAAAACA
GTCATCTAGAATTCACTGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGTGGGCAGTCGAACCATGGTGAACTCCACCTCCGTGGAAT
AAATGGAGATTCAGCGTGGGTGTTGAATCCAGCACGTCTGTGTGAGTAACGGGACAGTAAACACTCCACATTCTTCAGTTTTTCACTTCT
ACCTACATATTTGTATGTTTTTCTGTATAACAGCCTTTTCCTTCTGGTTCTAACTGCTGTTAAAATTAATATATCATTATCTTTGCTGTT
ATTGACAGCGATATAATTTTATTACATATGATTAGAGGGATGAGACAGACATTCACCTGTATATTTCTTTTAATGGGCACAAAATGGGCC
CTTGCCTCTAAATAGCACTTTTTGGGGTTCAAGAAGTAATCAGTATGCAAAGCAATCTTTTATACAATAATTGAAGTGTTCCCTTTTTCA
TAATTACTCTACTTCCCAGTAACCCTAAGGAAGTTGCTAACTTAAAAAACTGCATCCCACGTTCTGTTAATTTAGTAAATAAACAAGTCA
AAGACTTGTGGAAAATAGGAAGTGAACCCATATTTTAAATTCTCATAAGTAGCATTCATGTAATAAACAGGTTTTTAGTTTGTTCTTCAG
ATTGATAGGGAGTTTTAAAGAAATTTTAGTAGTTACTAAAATTATGTTACTGTATTTTTCAGAAATCAAACTGCTTATGAAAAGTACTAA
TAGAACTTGTTAACCTTTCTAACCTTCACGATTAACTGTGAAATGTACGTCATTTGTGCAAGACCGTTTGTCCACTTCATTTTGTATAAT

>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000520781_chr8_17920739_-_4274nt
AAACATTTTATTTCTTCCAGGGAACAACAAATCATTTAATCTTCAGAGCATCTTAGACTGAAAACCTTTCAACTGTGCTGAAAAACCTAG
AAGACAGACCATTTTGCCCACCCTCTCATTTAAAAGGAATTGAAGAAGAAATAAAATGGCAGAGGTTTAAGGTTACTATTCAGGATGACT
GATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAACCCGAAA
TCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACTGACCCT
GCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATTAGTAAG
CAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGTTGTCAT
TCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGCTACTGT
GATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAGAGTCAG
TCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCTTCCCAT
TCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGACATGACT
TACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAGGTCACC
AGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAAGTCCCC
AATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCACAAGGAA
ATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGCGAAGCT
CAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAATCATACC
TCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATTAGCACA
GACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAATGTAAG
AAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGAAAATCA
ACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTCAAAGCA
AAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCATCACCC
TCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTAATTAAC
AAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGGGTTCCA
AGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTTTCTGCG
TTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGATAGGATT
AGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTTGAATAT
GGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGGCAAATA
GCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCCGTATCT
CCTCAGAGGATCAGGCGTGTGTCCAGTTCTGGTCATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAAT
AATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCA
AGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGT
TATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGT
TATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGT
GTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGAC
CGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAA
ACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAA
ACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCTGGCCTACAGAATGCGGCCTCTGAGACATGAAGACACCA
TCTCCATGTGACCGAACACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTCGCGGCAGGTTCTCTTTGAGTCAATAGCTTGTCTTCGTC
CATCTGTTGACAAATGACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTTTCTTATTTACAGATAACTTCTTTAGGGGAAGTAAAACA
GTCATCTAGAATTCACTGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGTGGGCAGTCGAACCATGGTGAACTCCACCTCCGTGGAAT
AAATGGAGATTCAGCGTGGGTGTTGAATCCAGCACGTCTGTGTGAGTAACGGGACAGTAAACACTCCACATTCTTCAGTTTTTCACTTCT
ACCTACATATTTGTATGTTTTTCTGTATAACAGCCTTTTCCTTCTGGTTCTAACTGCTGTTAAAATTAATATATCATTATCTTTGCTGTT
ATTGACAGCGATATAATTTTATTACATATGATTAGAGGGATGAGACAGACATTCACCTGTATATTTCTTTTAATGGGCACAAAATGGGCC
CTTGCCTCTAAATAGCACTTTTTGGGGTTCAAGAAGTAATCAGTATGCAAAGCAATCTTTTATACAATAATTGAAGTGTTCCCTTTTTCA
TAATTACTCTACTTCCCAGTAACCCTAAGGAAGTTGCTAACTTAAAAAACTGCATCCCACGTTCTGTTAATTTAGTAAATAAACAAGTCA
AAGACTTGTGGAAAATAGGAAGTGAACCCATATTTTAAATTCTCATAAGTAGCATTCATGTAATAAACAGGTTTTTAGTTTGTTCTTCAG
ATTGATAGGGAGTTTTAAAGAAATTTTAGTAGTTACTAAAATTATGTTACTGTATTTTTCAGAAATCAAACTGCTTATGAAAAGTACTAA
TAGAACTTGTTAACCTTTCTAACCTTCACGATTAACTGTGAAATGTACGTCATTTGTGCAAGACCGTTTGTCCACTTCATTTTGTATAAT

>In-frame_MTUS1_ENST00000519263_chr8_17601113_-_ASAH1_ENST00000314146_chr8_17920739_-_3528nt
AAACATTTTATTTCTTCCAGGGAACAACAAATCATTTAATCTTCAGAGCATCTTAGACTGAAAACCTTTCAACTGTGCTGAAAAACCTAG
AAGACAGACCATTTTGCCCACCCTCTCATTTAAAAGGAATTGAAGAAGAAATAAAATGGCAGAGGTTTAAGGTTACTATTCAGGATGACT
GATGATAATTCAGATGATAAAATAGAAGATGAATTGCAAACCTTCTTTACCAGTGATAAAGATGGAAATACACATGCATACAACCCGAAA
TCACCACCTACACAAAACTCTTCAGCCAGCAGTGTGAACTGGAATTCTGCCAACCCAGATGACATGGTGGTTGATTATGAAACTGACCCT
GCTGTAGTTACTGGTGAAAATATTTCTTTAAGCCTTCAGGGTGTTGAAGTATTTGGTCATGAAAAGTCTTCTAGTGATTTCATTAGTAAG
CAGGTGTTAGATATGCATAAAGATTCTATTTGTCAGTGTCCTGCACTTGTAGGTACTGAGAAGCCCAAATATCTGCAACACAGTTGTCAT
TCCCTAGAAGCAGTTGAGGGCCAGAGTGTTGAGCCATCTTTGCCTTTTGTGTGGAAGCCTAATGACAATTTGAACTGTGCAGGCTACTGT
GATGCCTTGGAGCTAAACCAAACATTTGACATGACAGTGGATAAAGTTAACTGCACCTTTATATCACATCATGCCATCGGAAAGAGTCAG
TCCTTCCATACTGCTGGAAGCCTGCCACCAACTGGTAGGAGAAGTGGAAGTACATCTTCTTTATCCTATTCCACTTGGACATCTTCCCAT
TCTGATAAGACGCATGCAAGAGAAACTACTTATGATAGAGAAAGCTTTGAAAACCCTCAAGTCACACCATCAGAAGCCCAAGACATGACT
TACACAGCATTTTCTGATGTGGTGATGCAAAGTGAGGTTTTTGTTTCAGATATTGGAAATCAGTGTGCATGTTCTTCAGGAAAGGTCACC
AGTGAGTACACAGATGGATCACAACAAAGACTAGTTGGAGAAAAGGAGACACAAGCACTAACACCAGTTTCTGATGGCATGGAAGTCCCC
AATGATTCTGCATTACAAGAGTTCTTTTGTTTATCCCATGATGAATCCAATAGCGAACCACATTCACAGAGCTCATACAGGCACAAGGAA
ATGGGCCAAAATCTGAGAGAGACAGTGTCCTATTGTCTTATTGATGATGAATGCCCTTTAATGGTGCCAGCTTTTGATAAGAGCGAAGCT
CAAGTGCTGAACCCAGAGCATAAAGTCACTGAGACTGAAGACACACAAATGGTCTCCAAAGGAAAGGATTTGGGAACCCAAAATCATACC
TCAGAATTGATTCTAAGTAGCCCGCCAGGACAAAAGGTGGGCTCGTCATTTGGACTGACTTGGGATGCAAATGATATGGTCATTAGCACA
GACAAAACGATGTGCATGTCAACACCAGTCCTAGAACCCACAAAAGTAACCTTTTCTGTTTCACCGATTGAAGCGACGGAGAAATGTAAG
AAAGTGGAGAAGGGTAATCGAGGGCTTAAAAACATACCAGACTCGAAGGAGGCACCTGTGAACCTGTGTAAACCCAGTTTAGGAAAATCA
ACAATCAAAACGAATACCCCAATAGGCTGCAAAGTTAGAAAAACTGAAATTATAAGTTACCCAAGACCAAACTTCAAGAATGTCAAAGCA
AAAGTTATGTCTAGAGCAGTGTTGCAGCCCAAAGATGCTGCTTTATCAAAGGTCACGCCCAGACCTCAGCAGACCAGTGCCTCATCACCC
TCATCAGTGAATTCAAGACAACAAACAGTCTTGAGCAGAACACCGAGATCTGACTTGAATGCAGACAAAAAAGCAGAAATTCTAATTAAC
AAGACACATAAGCAGCAGTTTAATAAACTCATTACTAGCCAGGCTGTGCATGTTACAACTCATTCTAAAAATGCTTCACACAGGGTTCCA
AGAACAACATCTGCCGTGAAATCGAATCAGGAAGATGTTGACAAAGCCAGTTCTTCTAACTCAGCATGCGAGACCGGGTCCGTTTCTGCG
TTGTTTCAGAAGATCAAAGGCATACTCCCTGTTAAAATGGAAAGTGCAGAATGTTTGGAAATGACCTATGTTCCCAACATTGATAGGATT
AGCCCTGAAAAGAAGGGTGAAAAAGAAAATGGGACATCTATGGAAAAACAAGAGCTGAAACAAGAGATTATGAATGAGACTTTTGAATAT
GGTTCTCTGTTTTTGGGCTCTGCTTCAAAAACAACGACCACCTCAGGTAGGAATATATCCAAGCCTGACTCCTGCGGTTTGAGGCAAATA
GCTGCTCCAAAAGCCAAAGTGGGGCCCCCTGTTTCCTGTTTGAGGCGGAACAGTGACAATAGAAATCCCAGTGCTGATCGAGCCGTATCT
CCTCAGAGGATCAGGCGTGTGTCCAGTTCTGGTCATCTAATACATGGGAGAAACATGGATTTTGGAGTATTTCTTGGGTGGAACATAAAT
AATGATACCTGGGTCATAACTGAGCAACTAAAACCTTTAACAGTGAATTTGGATTTCCAAAGAAACAACAAAACTGTCTTCAAGGCTTCA
AGCTTTGCTGGCTATGTGGGCATGTTAACAGGATTCAAACCAGGACTGTTCAGTCTTACACTGAATGAACGTTTCAGTATAAATGGTGGT
TATCTGGGTATTCTAGAATGGATTCTGGGAAAGAAAGATGTCATGTGGATAGGGTTCCTCACTAGAACAGTTCTGGAAAATAGCACAAGT
TATGAAGAAGCCAAGAATTTATTGACCAAGACCAAGATATTGGCCCCAGCCTACTTTATCCTGGGAGGCAACCAGTCTGGGGAAGGTTGT
GTGATTACACGAGACAGAAAGGAATCATTGGATGTATATGAACTCGATGCTAAGCAGGGTAGATGGTATGTGGTACAAACAAATTATGAC
CGTTGGAAACATCCCTTCTTCCTTGATGATCGCAGAACGCCTGCAAAGATGTGTCTGAACCGCACCAGCCAAGAGAATATCTCATTTGAA
ACCATGTATGATGTCCTGTCAACAAAACCTGTCCTCAACAAGCTGACCGTATACACAACCTTGATAGATGTTACCAAAGGTCAATTCGAA
ACTTACCTGCGGGACTGCCCTGACCCTTGTATAGGTTGGTGAGCACACGTCTGGCCTACAGAATGCGGCCTCTGAGACATGAAGACACCA
TCTCCATGTGACCGAACACTGCAGCTGTCTGACCTTCCAAAGACTAAGACTCGCGGCAGGTTCTCTTTGAGTCAATAGCTTGTCTTCGTC
CATCTGTTGACAAATGACAGATCTTTTTTTTTTCCCCCTATCAGTTGATTTTTCTTATTTACAGATAACTTCTTTAGGGGAAGTAAAACA
GTCATCTAGAATTCACTGAGTTTTGTTTCACTTTGACATTTGGGGATCTGGTGGGCAGTCGAACCATGGTGAACTCCACCTCCGTGGAAT


Top

FusionGenePPI for MTUS1_ASAH1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MTUS1AGTR2, MMS19, ORC4, FHL3, CEP104, SPICE1, NINL, DCTN1, DYNLT1, LCA5, POC1A, CLTC, KIF11, MAGEA10, SMC1A, CDC14A, MTUS2, CLUHASAH1SETDB1, TSC22D1, PSMA3, FBXO6, CAMK1D, SRPK1, GSG1, PNKD, AAGAB, AAMP, NEFH, CAMK2B, HSF2, HSPB2, HERC2, CYP1A2, GLT1D1, ZIC1, ZSCAN12, FTH1, NONO, TBC1D22B, SLCO6A1, AIRE, HTATIP2, RNF6, TRMT2A, ZNF684, ZNF556, HMP19, LYPD1, NCDN


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MTUS1_ASAH1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MTUS1_ASAH1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMTUS1C2239176Liver carcinoma1UNIPROT
TgeneASAH1C0268255Farber Lipogranulomatosis8CTD_human;ORPHANET;UNIPROT
TgeneASAH1C0023794Lipoidosis2CTD_human
TgeneASAH1C1834569Jankovic Rivera syndrome2ORPHANET;UNIPROT
TgeneASAH1C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneASAH1C0036341Schizophrenia1PSYGENET
TgeneASAH1C0221765Chronic schizophrenia1PSYGENET