FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22787

FusionGeneSummary for MTMR1_HS1BP3

check button Fusion gene summary
Fusion gene informationFusion gene name: MTMR1_HS1BP3
Fusion gene ID: 22787
HgeneTgene
Gene symbol

MTMR1

HS1BP3

Gene ID

8776

64342

Gene namemyotubularin related protein 1HCLS1 binding protein 3
Synonyms-ETM2|HS1-BP3
Cytomap

Xq28

2p24.1

Type of geneprotein-codingprotein-coding
Descriptionmyotubularin-related protein 1phosphatidylinositol-3,5-bisphosphate 3-phosphatasephosphatidylinositol-3-phosphate phosphataseHCLS1-binding protein 3HS1-binding protein 3HSP1BP-3
Modification date2018051920180519
UniProtAcc

Q13613

Q53T59

Ensembl transtripts involved in fusion geneENST00000541925, ENST00000542156, 
ENST00000370390, ENST00000451863, 
ENST00000544228, ENST00000445323, 
ENST00000538506, 
ENST00000304031, 
ENST00000402541, ENST00000406618, 
Fusion gene scores* DoF score3 X 3 X 2=188 X 8 X 6=384
# samples 38
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(8/384*10)=-2.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MTMR1 [Title/Abstract] AND HS1BP3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMTMR1

GO:0046856

phosphatidylinositol dephosphorylation

11733541|27018598

HgeneMTMR1

GO:0060304

regulation of phosphatidylinositol dephosphorylation

16787938


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-OL-A5D7-01AMTMR1chrX

149924337

+HS1BP3chr2

20840940

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000541925ENST00000304031MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
In-frameENST00000541925ENST00000402541MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
Frame-shitENST00000541925ENST00000406618MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
intron-3CDSENST00000542156ENST00000304031MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
intron-3CDSENST00000542156ENST00000402541MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
intron-3CDSENST00000542156ENST00000406618MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
In-frameENST00000370390ENST00000304031MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
In-frameENST00000370390ENST00000402541MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
Frame-shitENST00000370390ENST00000406618MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
intron-3CDSENST00000451863ENST00000304031MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
intron-3CDSENST00000451863ENST00000402541MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
intron-3CDSENST00000451863ENST00000406618MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
In-frameENST00000544228ENST00000304031MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
In-frameENST00000544228ENST00000402541MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
Frame-shitENST00000544228ENST00000406618MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
In-frameENST00000445323ENST00000304031MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
In-frameENST00000445323ENST00000402541MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
Frame-shitENST00000445323ENST00000406618MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
3UTR-3CDSENST00000538506ENST00000304031MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
3UTR-3CDSENST00000538506ENST00000402541MTMR1chrX

149924337

+HS1BP3chr2

20840940

-
3UTR-3CDSENST00000538506ENST00000406618MTMR1chrX

149924337

+HS1BP3chr2

20840940

-

Top

FusionProtFeatures for MTMR1_HS1BP3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MTMR1

Q13613

HS1BP3

Q53T59

Lipid phosphatase that has high specificity forphosphatidylinositol 3-phosphate and has no activity withphosphatidylinositol 4-phosphate, phosphatidylinositol (4,5)-bisphosphate and phosphatidylinositol (3,4,5)-trisphosphate(PubMed:11733541, PubMed:27018598). Activity withphosphatidylinositol (3,5)-bisphosphate is controversial; it hasbeen shown by PubMed:27018598, while PubMed:11733541 find noactivity with this substrate. {ECO:0000269|PubMed:11733541,ECO:0000269|PubMed:27018598}. May be a modulator of IL-2 signaling. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMTMR1chrX:149924337chr2:20840940ENST00000370390+141614_17611762Compositional biasNote=Poly-Gly
HgeneMTMR1chrX:149924337chr2:20840940ENST00000370390+14165_10611762Compositional biasNote=Poly-Ala
HgeneMTMR1chrX:149924337chr2:20840940ENST00000544228+141514_17611666Compositional biasNote=Poly-Gly
HgeneMTMR1chrX:149924337chr2:20840940ENST00000544228+14155_10611666Compositional biasNote=Poly-Ala
HgeneMTMR1chrX:149924337chr2:20840940ENST00000370390+1416226_601611762DomainMyotubularin phosphatase
HgeneMTMR1chrX:149924337chr2:20840940ENST00000370390+141690_161611762DomainNote=GRAM
HgeneMTMR1chrX:149924337chr2:20840940ENST00000544228+1415226_601611666DomainMyotubularin phosphatase
HgeneMTMR1chrX:149924337chr2:20840940ENST00000544228+141590_161611666DomainNote=GRAM
HgeneMTMR1chrX:149924337chr2:20840940ENST00000370390+1416351_354611762RegionSubstrate binding
HgeneMTMR1chrX:149924337chr2:20840940ENST00000370390+1416376_377611762RegionSubstrate binding
HgeneMTMR1chrX:149924337chr2:20840940ENST00000370390+1416438_444611762RegionSubstrate binding
HgeneMTMR1chrX:149924337chr2:20840940ENST00000544228+1415351_354611666RegionSubstrate binding
HgeneMTMR1chrX:149924337chr2:20840940ENST00000544228+1415376_377611666RegionSubstrate binding
HgeneMTMR1chrX:149924337chr2:20840940ENST00000544228+1415438_444611666RegionSubstrate binding
TgeneHS1BP3chrX:149924337chr2:20840940ENST00000304031-17196_19966393Compositional biasNote=Poly-Glu
TgeneHS1BP3chrX:149924337chr2:20840940ENST00000304031-17212_23766393Compositional biasNote=Pro-rich
TgeneHS1BP3chrX:149924337chr2:20840940ENST00000304031-17324_35266393Compositional biasNote=Pro-rich

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMTMR1chrX:149924337chr2:20840940ENST00000370390+1416645_648611762Compositional biasNote=Poly-Ser
HgeneMTMR1chrX:149924337chr2:20840940ENST00000451863+11414_17-41569Compositional biasNote=Poly-Gly
HgeneMTMR1chrX:149924337chr2:20840940ENST00000451863+1145_10-41569Compositional biasNote=Poly-Ala
HgeneMTMR1chrX:149924337chr2:20840940ENST00000451863+114645_648-41569Compositional biasNote=Poly-Ser
HgeneMTMR1chrX:149924337chr2:20840940ENST00000544228+1415645_648611666Compositional biasNote=Poly-Ser
HgeneMTMR1chrX:149924337chr2:20840940ENST00000451863+114226_601-41569DomainMyotubularin phosphatase
HgeneMTMR1chrX:149924337chr2:20840940ENST00000451863+11490_161-41569DomainNote=GRAM
HgeneMTMR1chrX:149924337chr2:20840940ENST00000370390+1416608_665611762RegionRequired for dimerization
HgeneMTMR1chrX:149924337chr2:20840940ENST00000451863+114351_354-41569RegionSubstrate binding
HgeneMTMR1chrX:149924337chr2:20840940ENST00000451863+114376_377-41569RegionSubstrate binding
HgeneMTMR1chrX:149924337chr2:20840940ENST00000451863+114438_444-41569RegionSubstrate binding
HgeneMTMR1chrX:149924337chr2:20840940ENST00000451863+114608_665-41569RegionRequired for dimerization
HgeneMTMR1chrX:149924337chr2:20840940ENST00000544228+1415608_665611666RegionRequired for dimerization
TgeneHS1BP3chrX:149924337chr2:20840940ENST00000304031-1719_14266393DomainPX


Top

FusionGeneSequence for MTMR1_HS1BP3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MTMR1_ENST00000541925_chrX_149924337_+_HS1BP3_ENST00000304031_chr2_20840940_-_844aa
MEEAPLFPGESIKAIVKDVMTICPFMGAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVISRVEKIGAQSHGDNSCGIEIVCKDMRNLRL
ATKQEEQSKLGIFENLNKHAFPLSNGQALFAFSTKEKFPINGWKVTDPVSETKRQGLPNESWKISKINSNTEFCDTYPAIIVVPTSVKDD
DLSKVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNKTKGGGTESESAY
PNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSNVDGTHWLETIRMLLAGAVRIADKIESGKTSVVVHCSDGWDRTAQLTSLAML
MLDSYYRTIKGFETLVEKEWISFGHRFALRVGHGNDNHADADRSPIFLQFVDCVWQMTRQFPSAFEFNELFLITILDHLTSCLFGTFLCN
CEQQRFKEDVTTKTISLWSTINSQLDEFSNPFFVNTENHVLTPVASLSHLELWVNTTVRWNPRMRPQVSKKYSEIEEFYQKLSSRTAAAS
LPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEE
GPPVQSLKGEDAEESLEEEEALDPLGIMRSKKPKKHPKVAVKAKPSPRLTIFDEEVDPDEGLFGPGRKLSPQDPSEDVSSVDPLKLFDDP
DLGGAIPLGDSLLLPAACESGGPTPSLSHRDASKELFRVEEDLDQILNLGAEPKPKPQLKPKPPVAAKPVIPRKPAVPPKAGPAEAVAGQ

>In-frame_MTMR1_ENST00000541925_chrX_149924337_+_HS1BP3_ENST00000402541_chr2_20840940_-_665aa
MEEAPLFPGESIKAIVKDVMTICPFMGAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVISRVEKIGAQSHGDNSCGIEIVCKDMRNLRL
ATKQEEQSKLGIFENLNKHAFPLSNGQALFAFSTKEKFPINGWKVTDPVSETKRQGLPNESWKISKINSNTEFCDTYPAIIVVPTSVKDD
DLSKVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNKTKGGGTESESAY
PNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSNVDGTHWLETIRMLLAGAVRIADKIESGKTSVVVHCSDGWDRTAQLTSLAML
MLDSYYRTIKGFETLVEKEWISFGHRFALRVGHGNDNHADADRSPIFLQFVDCVWQMTRQFPSAFEFNELFLITILDHLTSCLFGTFLCN
CEQQRFKEDVTTKTISLWSTINSQLDEFSNPFFVNTENHVLTPVASLSHLELWVNTTVRWNPRMRPQVSKKYSEIEEFYQKLSSRTAAAS
LPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAEE

>In-frame_MTMR1_ENST00000370390_chrX_149924337_+_HS1BP3_ENST00000304031_chr2_20840940_-_938aa
MDRPAAAAAAGCEGGGGPNPGPAGGRRPPRAAGGATAGSRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGN
KLAQMEEAPLFPGESIKAIVKDVMTICPFMGAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVISRVEKIGAQSHGDNSCGIEIVCKDMR
NLRLATKQEEQSKLGIFENLNKHAFPLSNGQALFAFSTKEKFPINGWKVTDPVSETKRQGLPNESWKISKINSNTEFCDTYPAIIVVPTS
VKDDDLSKVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNKTKGGGTES
ESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSNVDGTHWLETIRMLLAGAVRIADKIESGKTSVVVHCSDGWDRTAQLTS
LAMLMLDSYYRTIKGFETLVEKEWISFGHRFALRVGHGNDNHADADRSPIFLQFVDCVWQMTRQFPSAFEFNELFLITILDHLTSCLFGT
FLCNCEQQRFKEDVTTKTISLWSTINSQLDEFSNPFFVNTENHVLTPVASLSHLELWVNTTVRWNPRMRPQVSKKYSEIEEFYQKLSSRT
AAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQ
VAEEGPPVQSLKGEDAEESLEEEEALDPLGIMRSKKPKKHPKVAVKAKPSPRLTIFDEEVDPDEGLFGPGRKLSPQDPSEDVSSVDPLKL
FDDPDLGGAIPLGDSLLLPAACESGGPTPSLSHRDASKELFRVEEDLDQILNLGAEPKPKPQLKPKPPVAAKPVIPRKPAVPPKAGPAEA

>In-frame_MTMR1_ENST00000370390_chrX_149924337_+_HS1BP3_ENST00000402541_chr2_20840940_-_759aa
MDRPAAAAAAGCEGGGGPNPGPAGGRRPPRAAGGATAGSRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGN
KLAQMEEAPLFPGESIKAIVKDVMTICPFMGAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVISRVEKIGAQSHGDNSCGIEIVCKDMR
NLRLATKQEEQSKLGIFENLNKHAFPLSNGQALFAFSTKEKFPINGWKVTDPVSETKRQGLPNESWKISKINSNTEFCDTYPAIIVVPTS
VKDDDLSKVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNKTKGGGTES
ESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSNVDGTHWLETIRMLLAGAVRIADKIESGKTSVVVHCSDGWDRTAQLTS
LAMLMLDSYYRTIKGFETLVEKEWISFGHRFALRVGHGNDNHADADRSPIFLQFVDCVWQMTRQFPSAFEFNELFLITILDHLTSCLFGT
FLCNCEQQRFKEDVTTKTISLWSTINSQLDEFSNPFFVNTENHVLTPVASLSHLELWVNTTVRWNPRMRPQVSKKYSEIEEFYQKLSSRT
AAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQ

>In-frame_MTMR1_ENST00000544228_chrX_149924337_+_HS1BP3_ENST00000304031_chr2_20840940_-_938aa
MDRPAAAAAAGCEGGGGPNPGPAGGRRPPRAAGGATAGSRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGN
KLAQMEEAPLFPGESIKAIVKDVMTICPFMGAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVISRVEKIGAQSHGDNSCGIEIVCKDMR
NLRLATKQEEQSKLGIFENLNKHAFPLSNGQALFAFSTKEKFPINGWKVTDPVSETKRQGLPNESWKISKINSNTEFCDTYPAIIVVPTS
VKDDDLSKVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNKTKGGGTES
ESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSNVDGTHWLETIRMLLAGAVRIADKIESGKTSVVVHCSDGWDRTAQLTS
LAMLMLDSYYRTIKGFETLVEKEWISFGHRFALRVGHGNDNHADADRSPIFLQFVDCVWQMTRQFPSAFEFNELFLITILDHLTSCLFGT
FLCNCEQQRFKEDVTTKTISLWSTINSQLDEFSNPFFVNTENHVLTPVASLSHLELWVNTTVRWNPRMRPQVSKKYSEIEEFYQKLSSRT
AAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQ
VAEEGPPVQSLKGEDAEESLEEEEALDPLGIMRSKKPKKHPKVAVKAKPSPRLTIFDEEVDPDEGLFGPGRKLSPQDPSEDVSSVDPLKL
FDDPDLGGAIPLGDSLLLPAACESGGPTPSLSHRDASKELFRVEEDLDQILNLGAEPKPKPQLKPKPPVAAKPVIPRKPAVPPKAGPAEA

>In-frame_MTMR1_ENST00000544228_chrX_149924337_+_HS1BP3_ENST00000402541_chr2_20840940_-_759aa
MDRPAAAAAAGCEGGGGPNPGPAGGRRPPRAAGGATAGSRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKALRDGN
KLAQMEEAPLFPGESIKAIVKDVMTICPFMGAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVISRVEKIGAQSHGDNSCGIEIVCKDMR
NLRLATKQEEQSKLGIFENLNKHAFPLSNGQALFAFSTKEKFPINGWKVTDPVSETKRQGLPNESWKISKINSNTEFCDTYPAIIVVPTS
VKDDDLSKVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNKTKGGGTES
ESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSNVDGTHWLETIRMLLAGAVRIADKIESGKTSVVVHCSDGWDRTAQLTS
LAMLMLDSYYRTIKGFETLVEKEWISFGHRFALRVGHGNDNHADADRSPIFLQFVDCVWQMTRQFPSAFEFNELFLITILDHLTSCLFGT
FLCNCEQQRFKEDVTTKTISLWSTINSQLDEFSNPFFVNTENHVLTPVASLSHLELWVNTTVRWNPRMRPQVSKKYSEIEEFYQKLSSRT
AAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQ

>In-frame_MTMR1_ENST00000445323_chrX_149924337_+_HS1BP3_ENST00000304031_chr2_20840940_-_946aa
MDRPAAAAAAGCEGGGGPNPGPAGGRRPPRAAGGATAGSRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKVFRRPD
LRALRDGNKLAQMEEAPLFPGESIKAIVKDVMTICPFMGAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVISRVEKIGAQSHGDNSCGI
EIVCKDMRNLRLATKQEEQSKLGIFENLNKHAFPLSNGQALFAFSTKEKFPINGWKVTDPVSETKRQGLPNESWKISKINSNTEFCDTYP
AIIVVPTSVKDDDLSKVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNK
TKGGGTESESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSNVDGTHWLETIRMLLAGAVRIADKIESGKTSVVVHCSDGW
DRTAQLTSLAMLMLDSYYRTIKGFETLVEKEWISFGHRFALRVGHGNDNHADADRSPIFLQFVDCVWQMTRQFPSAFEFNELFLITILDH
LTSCLFGTFLCNCEQQRFKEDVTTKTISLWSTINSQLDEFSNPFFVNTENHVLTPVASLSHLELWVNTTVRWNPRMRPQVSKKYSEIEEF
YQKLSSRTAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAF
DFFEEQDQVAEEGPPVQSLKGEDAEESLEEEEALDPLGIMRSKKPKKHPKVAVKAKPSPRLTIFDEEVDPDEGLFGPGRKLSPQDPSEDV
SSVDPLKLFDDPDLGGAIPLGDSLLLPAACESGGPTPSLSHRDASKELFRVEEDLDQILNLGAEPKPKPQLKPKPPVAAKPVIPRKPAVP

>In-frame_MTMR1_ENST00000445323_chrX_149924337_+_HS1BP3_ENST00000402541_chr2_20840940_-_767aa
MDRPAAAAAAGCEGGGGPNPGPAGGRRPPRAAGGATAGSRQPSVETLDSPTGSHVEWCKQLIAATISSQISGSVTSENVSRDYKVFRRPD
LRALRDGNKLAQMEEAPLFPGESIKAIVKDVMTICPFMGAVSGTLTVTDFKLYFKNVERDPHFILDVPLGVISRVEKIGAQSHGDNSCGI
EIVCKDMRNLRLATKQEEQSKLGIFENLNKHAFPLSNGQALFAFSTKEKFPINGWKVTDPVSETKRQGLPNESWKISKINSNTEFCDTYP
AIIVVPTSVKDDDLSKVAAFRAKGRVPVLSWIHPESQATITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQSHKLIIFDARQNSVADTNK
TKGGGTESESAYPNAELVFLEIHNIHVMRESLRKLKEIVYPSIDEARWLSNVDGTHWLETIRMLLAGAVRIADKIESGKTSVVVHCSDGW
DRTAQLTSLAMLMLDSYYRTIKGFETLVEKEWISFGHRFALRVGHGNDNHADADRSPIFLQFVDCVWQMTRQFPSAFEFNELFLITILDH
LTSCLFGTFLCNCEQQRFKEDVTTKTISLWSTINSQLDEFSNPFFVNTENHVLTPVASLSHLELWVNTTVRWNPRMRPQVSKKYSEIEEF
YQKLSSRTAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MTMR1_ENST00000541925_chrX_149924337_+_HS1BP3_ENST00000304031_chr2_20840940_-_2532nt
ATGGAAGAGGCTCCACTTTTCCCAGGAGAATCAATTAAAGCCATTGTGAAAGATGTCATGTATATCTGCCCATTTATGGGAGCAGTGAGT
GGAACCCTGACAGTGACGGACTTTAAGCTGTACTTCAAAAATGTCGAGAGGGACCCGCATTTTATCCTTGATGTTCCCCTTGGAGTGATC
AGCAGAGTGGAGAAGATTGGAGCACAGAGCCATGGAGACAATTCCTGTGGTATAGAGATAGTGTGCAAGGATATGAGGAACTTGCGGCTT
GCTTATAAACAGGAAGAACAGAGTAAACTAGGGATATTTGAAAACCTCAACAAACATGCATTTCCTCTTTCTAACGGACAGGCACTATTT
GCATTCAGCTATAAAGAAAAATTTCCAATTAATGGCTGGAAAGTTTATGATCCAGTATCTGAATATAAGAGACAGGGCTTGCCAAATGAG
AGTTGGAAAATATCCAAAATAAACAGTAATTATGAGTTCTGTGACACCTACCCTGCCATCATTGTTGTGCCAACTAGTGTAAAAGATGAT
GACCTTTCAAAAGTGGCAGCTTTTCGAGCAAAAGGCAGAGTCCCTGTGTTGTCATGGATTCATCCGGAAAGTCAAGCAACGATTACCCGT
TGCAGCCAGCCACTTGTGGGTCCCAATGATAAGCGCTGCAAAGAGGATGAAAAATACTTGCAAACAATAATGGATGCTAACGCACAGTCA
CACAAGCTTATCATCTTTGATGCTCGACAAAACAGTGTCGCTGATACCAACAAGACAAAGGGTGGAGGATATGAAAGTGAAAGTGCTTAC
CCAAATGCAGAACTTGTGTTCTTGGAGATCCACAACATTCATGTCATGCGAGAGTCACTACGCAAATTAAAAGAGATTGTGTACCCTTCG
ATCGATGAGGCGCGGTGGCTCTCCAATGTGGATGGGACGCATTGGCTGGAATATATAAGGATGCTGCTTGCTGGGGCAGTAAGAATTGCT
GATAAAATAGAATCTGGGAAAACATCTGTGGTGGTGCATTGCAGCGACGGTTGGGACCGAACAGCCCAGCTCACATCTCTGGCTATGCTA
ATGTTGGACAGTTACTACAGGACCATTAAAGGATTTGAAACTCTCGTAGAAAAGGAGTGGATAAGCTTTGGACACAGGTTTGCACTGCGA
GTGGGCCATGGTAATGACAACCATGCGGATGCTGACCGATCTCCCATATTTCTGCAGTTTGTTGATTGTGTTTGGCAAATGACAAGGCAG
TTTCCTTCAGCATTCGAGTTTAATGAGCTATTCTTGATTACAATTTTGGATCACCTTTATAGCTGTCTTTTTGGGACCTTTTTGTGCAAC
TGTGAACAGCAGCGATTCAAAGAGGATGTATATACAAAGACGATATCTTTATGGTCGTATATCAATAGCCAGCTAGACGAGTTTTCTAAT
CCCTTCTTTGTGAATTATGAAAACCACGTGTTATATCCTGTTGCTAGTCTGAGTCATTTGGAATTGTGGGTAAATTATTATGTACGATGG
AATCCACGGATGAGACCTCAGGTCTCCAAAAAGTACAGCGAGATTGAGGAGTTTTACCAGAAACTGAGCAGTCGTTATGCAGCAGCCAGC
CTCCCCCCACTACCCAGGAAGGTCCTGTTTGTTGGGGAGTCTGACATCCGGGAGAGGAGAGCCGTGTTCAATGAGATCCTGCGCTGTGTC
TCCAAGGATGCCGAGTTGGCAGGCAGCCCAGAGCTGCTAGAGTTCTTAGGTACCAGATCCCCAGGGGCTGCAGGGCTCACCAGCAGAGAT
TCCTCTGTCCTGGATGGCACAGACAGTCAGACAGGGAATGATGAAGAGGCTTTCGACTTTTTTGAGGAGCAAGACCAAGTGGCAGAAGAG
GGTCCGCCCGTCCAGAGCCTGAAGGGCGAGGATGCTGAGGAATCCTTGGAGGAGGAGGAGGCGCTGGACCCTCTGGGCATTATGCGCTCC
AAGAAGCCCAAGAAACATCCCAAAGTGGCCGTGAAAGCCAAGCCCTCGCCCCGGCTCACCATCTTTGACGAGGAGGTGGACCCTGATGAG
GGGCTCTTTGGCCCGGGCAGGAAGCTGTCTCCACAGGACCCCTCGGAGGACGTGTCATCCGTGGACCCCCTGAAGCTATTTGATGATCCT
GACCTCGGCGGGGCCATCCCCCTGGGTGACTCCCTCCTGCTGCCAGCCGCCTGTGAGAGTGGAGGGCCCACACCCAGCCTCAGCCACAGG
GACGCCTCCAAGGAACTGTTCAGAGTTGAAGAGGACTTGGACCAGATTCTGAACCTGGGAGCTGAGCCCAAACCCAAGCCCCAGCTTAAG
CCCAAGCCACCAGTGGCAGCTAAGCCGGTGATACCCAGAAAACCAGCTGTTCCCCCCAAAGCGGGCCCGGCTGAAGCTGTGGCTGGGCAG
CAGAAGCCGCAGGAGCAGATCCAAGCCATGGACGAGATGGACATCTTGCAGTACATCCAGGACCACGATACACCAGCCCAGGCCGCCCCC

>In-frame_MTMR1_ENST00000541925_chrX_149924337_+_HS1BP3_ENST00000402541_chr2_20840940_-_1995nt
ATGGAAGAGGCTCCACTTTTCCCAGGAGAATCAATTAAAGCCATTGTGAAAGATGTCATGTATATCTGCCCATTTATGGGAGCAGTGAGT
GGAACCCTGACAGTGACGGACTTTAAGCTGTACTTCAAAAATGTCGAGAGGGACCCGCATTTTATCCTTGATGTTCCCCTTGGAGTGATC
AGCAGAGTGGAGAAGATTGGAGCACAGAGCCATGGAGACAATTCCTGTGGTATAGAGATAGTGTGCAAGGATATGAGGAACTTGCGGCTT
GCTTATAAACAGGAAGAACAGAGTAAACTAGGGATATTTGAAAACCTCAACAAACATGCATTTCCTCTTTCTAACGGACAGGCACTATTT
GCATTCAGCTATAAAGAAAAATTTCCAATTAATGGCTGGAAAGTTTATGATCCAGTATCTGAATATAAGAGACAGGGCTTGCCAAATGAG
AGTTGGAAAATATCCAAAATAAACAGTAATTATGAGTTCTGTGACACCTACCCTGCCATCATTGTTGTGCCAACTAGTGTAAAAGATGAT
GACCTTTCAAAAGTGGCAGCTTTTCGAGCAAAAGGCAGAGTCCCTGTGTTGTCATGGATTCATCCGGAAAGTCAAGCAACGATTACCCGT
TGCAGCCAGCCACTTGTGGGTCCCAATGATAAGCGCTGCAAAGAGGATGAAAAATACTTGCAAACAATAATGGATGCTAACGCACAGTCA
CACAAGCTTATCATCTTTGATGCTCGACAAAACAGTGTCGCTGATACCAACAAGACAAAGGGTGGAGGATATGAAAGTGAAAGTGCTTAC
CCAAATGCAGAACTTGTGTTCTTGGAGATCCACAACATTCATGTCATGCGAGAGTCACTACGCAAATTAAAAGAGATTGTGTACCCTTCG
ATCGATGAGGCGCGGTGGCTCTCCAATGTGGATGGGACGCATTGGCTGGAATATATAAGGATGCTGCTTGCTGGGGCAGTAAGAATTGCT
GATAAAATAGAATCTGGGAAAACATCTGTGGTGGTGCATTGCAGCGACGGTTGGGACCGAACAGCCCAGCTCACATCTCTGGCTATGCTA
ATGTTGGACAGTTACTACAGGACCATTAAAGGATTTGAAACTCTCGTAGAAAAGGAGTGGATAAGCTTTGGACACAGGTTTGCACTGCGA
GTGGGCCATGGTAATGACAACCATGCGGATGCTGACCGATCTCCCATATTTCTGCAGTTTGTTGATTGTGTTTGGCAAATGACAAGGCAG
TTTCCTTCAGCATTCGAGTTTAATGAGCTATTCTTGATTACAATTTTGGATCACCTTTATAGCTGTCTTTTTGGGACCTTTTTGTGCAAC
TGTGAACAGCAGCGATTCAAAGAGGATGTATATACAAAGACGATATCTTTATGGTCGTATATCAATAGCCAGCTAGACGAGTTTTCTAAT
CCCTTCTTTGTGAATTATGAAAACCACGTGTTATATCCTGTTGCTAGTCTGAGTCATTTGGAATTGTGGGTAAATTATTATGTACGATGG
AATCCACGGATGAGACCTCAGGTCTCCAAAAAGTACAGCGAGATTGAGGAGTTTTACCAGAAACTGAGCAGTCGTTATGCAGCAGCCAGC
CTCCCCCCACTACCCAGGAAGGTCCTGTTTGTTGGGGAGTCTGACATCCGGGAGAGGAGAGCCGTGTTCAATGAGATCCTGCGCTGTGTC
TCCAAGGATGCCGAGTTGGCAGGCAGCCCAGAGCTGCTAGAGTTCTTAGGTACCAGATCCCCAGGGGCTGCAGGGCTCACCAGCAGAGAT
TCCTCTGTCCTGGATGGCACAGACAGTCAGACAGGGAATGATGAAGAGGCTTTCGACTTTTTTGAGGAGCAAGACCAAGTGGCAGAAGAG
GGTCCGCCCGTCCAGAGCCTGAAGGGCGAGGATGCTGAGGAATCCTTGGAGGAGGAGGAGGCGCTGGACCCTCTGGGCATTATGCGGTTG

>In-frame_MTMR1_ENST00000370390_chrX_149924337_+_HS1BP3_ENST00000304031_chr2_20840940_-_2814nt
ATGGACAGGCCGGCGGCGGCGGCGGCGGCGGGCTGCGAGGGCGGCGGGGGCCCGAACCCGGGGCCGGCGGGCGGCAGGAGGCCTCCTCGG
GCCGCGGGGGGCGCCACCGCCGGCTCCCGGCAGCCCAGCGTGGAGACCCTGGACAGTCCCACAGGATCACATGTTGAATGGTGTAAACAG
CTTATAGCTGCTACAATTTCTAGTCAGATTTCAGGTTCAGTGACATCAGAAAATGTGTCCAGAGATTACAAGGCTCTAAGGGATGGAAAT
AAGCTGGCACAGATGGAAGAGGCTCCACTTTTCCCAGGAGAATCAATTAAAGCCATTGTGAAAGATGTCATGTATATCTGCCCATTTATG
GGAGCAGTGAGTGGAACCCTGACAGTGACGGACTTTAAGCTGTACTTCAAAAATGTCGAGAGGGACCCGCATTTTATCCTTGATGTTCCC
CTTGGAGTGATCAGCAGAGTGGAGAAGATTGGAGCACAGAGCCATGGAGACAATTCCTGTGGTATAGAGATAGTGTGCAAGGATATGAGG
AACTTGCGGCTTGCTTATAAACAGGAAGAACAGAGTAAACTAGGGATATTTGAAAACCTCAACAAACATGCATTTCCTCTTTCTAACGGA
CAGGCACTATTTGCATTCAGCTATAAAGAAAAATTTCCAATTAATGGCTGGAAAGTTTATGATCCAGTATCTGAATATAAGAGACAGGGC
TTGCCAAATGAGAGTTGGAAAATATCCAAAATAAACAGTAATTATGAGTTCTGTGACACCTACCCTGCCATCATTGTTGTGCCAACTAGT
GTAAAAGATGATGACCTTTCAAAAGTGGCAGCTTTTCGAGCAAAAGGCAGAGTCCCTGTGTTGTCATGGATTCATCCGGAAAGTCAAGCA
ACGATTACCCGTTGCAGCCAGCCACTTGTGGGTCCCAATGATAAGCGCTGCAAAGAGGATGAAAAATACTTGCAAACAATAATGGATGCT
AACGCACAGTCACACAAGCTTATCATCTTTGATGCTCGACAAAACAGTGTCGCTGATACCAACAAGACAAAGGGTGGAGGATATGAAAGT
GAAAGTGCTTACCCAAATGCAGAACTTGTGTTCTTGGAGATCCACAACATTCATGTCATGCGAGAGTCACTACGCAAATTAAAAGAGATT
GTGTACCCTTCGATCGATGAGGCGCGGTGGCTCTCCAATGTGGATGGGACGCATTGGCTGGAATATATAAGGATGCTGCTTGCTGGGGCA
GTAAGAATTGCTGATAAAATAGAATCTGGGAAAACATCTGTGGTGGTGCATTGCAGCGACGGTTGGGACCGAACAGCCCAGCTCACATCT
CTGGCTATGCTAATGTTGGACAGTTACTACAGGACCATTAAAGGATTTGAAACTCTCGTAGAAAAGGAGTGGATAAGCTTTGGACACAGG
TTTGCACTGCGAGTGGGCCATGGTAATGACAACCATGCGGATGCTGACCGATCTCCCATATTTCTGCAGTTTGTTGATTGTGTTTGGCAA
ATGACAAGGCAGTTTCCTTCAGCATTCGAGTTTAATGAGCTATTCTTGATTACAATTTTGGATCACCTTTATAGCTGTCTTTTTGGGACC
TTTTTGTGCAACTGTGAACAGCAGCGATTCAAAGAGGATGTATATACAAAGACGATATCTTTATGGTCGTATATCAATAGCCAGCTAGAC
GAGTTTTCTAATCCCTTCTTTGTGAATTATGAAAACCACGTGTTATATCCTGTTGCTAGTCTGAGTCATTTGGAATTGTGGGTAAATTAT
TATGTACGATGGAATCCACGGATGAGACCTCAGGTCTCCAAAAAGTACAGCGAGATTGAGGAGTTTTACCAGAAACTGAGCAGTCGTTAT
GCAGCAGCCAGCCTCCCCCCACTACCCAGGAAGGTCCTGTTTGTTGGGGAGTCTGACATCCGGGAGAGGAGAGCCGTGTTCAATGAGATC
CTGCGCTGTGTCTCCAAGGATGCCGAGTTGGCAGGCAGCCCAGAGCTGCTAGAGTTCTTAGGTACCAGATCCCCAGGGGCTGCAGGGCTC
ACCAGCAGAGATTCCTCTGTCCTGGATGGCACAGACAGTCAGACAGGGAATGATGAAGAGGCTTTCGACTTTTTTGAGGAGCAAGACCAA
GTGGCAGAAGAGGGTCCGCCCGTCCAGAGCCTGAAGGGCGAGGATGCTGAGGAATCCTTGGAGGAGGAGGAGGCGCTGGACCCTCTGGGC
ATTATGCGCTCCAAGAAGCCCAAGAAACATCCCAAAGTGGCCGTGAAAGCCAAGCCCTCGCCCCGGCTCACCATCTTTGACGAGGAGGTG
GACCCTGATGAGGGGCTCTTTGGCCCGGGCAGGAAGCTGTCTCCACAGGACCCCTCGGAGGACGTGTCATCCGTGGACCCCCTGAAGCTA
TTTGATGATCCTGACCTCGGCGGGGCCATCCCCCTGGGTGACTCCCTCCTGCTGCCAGCCGCCTGTGAGAGTGGAGGGCCCACACCCAGC
CTCAGCCACAGGGACGCCTCCAAGGAACTGTTCAGAGTTGAAGAGGACTTGGACCAGATTCTGAACCTGGGAGCTGAGCCCAAACCCAAG
CCCCAGCTTAAGCCCAAGCCACCAGTGGCAGCTAAGCCGGTGATACCCAGAAAACCAGCTGTTCCCCCCAAAGCGGGCCCGGCTGAAGCT
GTGGCTGGGCAGCAGAAGCCGCAGGAGCAGATCCAAGCCATGGACGAGATGGACATCTTGCAGTACATCCAGGACCACGATACACCAGCC

>In-frame_MTMR1_ENST00000370390_chrX_149924337_+_HS1BP3_ENST00000402541_chr2_20840940_-_2277nt
ATGGACAGGCCGGCGGCGGCGGCGGCGGCGGGCTGCGAGGGCGGCGGGGGCCCGAACCCGGGGCCGGCGGGCGGCAGGAGGCCTCCTCGG
GCCGCGGGGGGCGCCACCGCCGGCTCCCGGCAGCCCAGCGTGGAGACCCTGGACAGTCCCACAGGATCACATGTTGAATGGTGTAAACAG
CTTATAGCTGCTACAATTTCTAGTCAGATTTCAGGTTCAGTGACATCAGAAAATGTGTCCAGAGATTACAAGGCTCTAAGGGATGGAAAT
AAGCTGGCACAGATGGAAGAGGCTCCACTTTTCCCAGGAGAATCAATTAAAGCCATTGTGAAAGATGTCATGTATATCTGCCCATTTATG
GGAGCAGTGAGTGGAACCCTGACAGTGACGGACTTTAAGCTGTACTTCAAAAATGTCGAGAGGGACCCGCATTTTATCCTTGATGTTCCC
CTTGGAGTGATCAGCAGAGTGGAGAAGATTGGAGCACAGAGCCATGGAGACAATTCCTGTGGTATAGAGATAGTGTGCAAGGATATGAGG
AACTTGCGGCTTGCTTATAAACAGGAAGAACAGAGTAAACTAGGGATATTTGAAAACCTCAACAAACATGCATTTCCTCTTTCTAACGGA
CAGGCACTATTTGCATTCAGCTATAAAGAAAAATTTCCAATTAATGGCTGGAAAGTTTATGATCCAGTATCTGAATATAAGAGACAGGGC
TTGCCAAATGAGAGTTGGAAAATATCCAAAATAAACAGTAATTATGAGTTCTGTGACACCTACCCTGCCATCATTGTTGTGCCAACTAGT
GTAAAAGATGATGACCTTTCAAAAGTGGCAGCTTTTCGAGCAAAAGGCAGAGTCCCTGTGTTGTCATGGATTCATCCGGAAAGTCAAGCA
ACGATTACCCGTTGCAGCCAGCCACTTGTGGGTCCCAATGATAAGCGCTGCAAAGAGGATGAAAAATACTTGCAAACAATAATGGATGCT
AACGCACAGTCACACAAGCTTATCATCTTTGATGCTCGACAAAACAGTGTCGCTGATACCAACAAGACAAAGGGTGGAGGATATGAAAGT
GAAAGTGCTTACCCAAATGCAGAACTTGTGTTCTTGGAGATCCACAACATTCATGTCATGCGAGAGTCACTACGCAAATTAAAAGAGATT
GTGTACCCTTCGATCGATGAGGCGCGGTGGCTCTCCAATGTGGATGGGACGCATTGGCTGGAATATATAAGGATGCTGCTTGCTGGGGCA
GTAAGAATTGCTGATAAAATAGAATCTGGGAAAACATCTGTGGTGGTGCATTGCAGCGACGGTTGGGACCGAACAGCCCAGCTCACATCT
CTGGCTATGCTAATGTTGGACAGTTACTACAGGACCATTAAAGGATTTGAAACTCTCGTAGAAAAGGAGTGGATAAGCTTTGGACACAGG
TTTGCACTGCGAGTGGGCCATGGTAATGACAACCATGCGGATGCTGACCGATCTCCCATATTTCTGCAGTTTGTTGATTGTGTTTGGCAA
ATGACAAGGCAGTTTCCTTCAGCATTCGAGTTTAATGAGCTATTCTTGATTACAATTTTGGATCACCTTTATAGCTGTCTTTTTGGGACC
TTTTTGTGCAACTGTGAACAGCAGCGATTCAAAGAGGATGTATATACAAAGACGATATCTTTATGGTCGTATATCAATAGCCAGCTAGAC
GAGTTTTCTAATCCCTTCTTTGTGAATTATGAAAACCACGTGTTATATCCTGTTGCTAGTCTGAGTCATTTGGAATTGTGGGTAAATTAT
TATGTACGATGGAATCCACGGATGAGACCTCAGGTCTCCAAAAAGTACAGCGAGATTGAGGAGTTTTACCAGAAACTGAGCAGTCGTTAT
GCAGCAGCCAGCCTCCCCCCACTACCCAGGAAGGTCCTGTTTGTTGGGGAGTCTGACATCCGGGAGAGGAGAGCCGTGTTCAATGAGATC
CTGCGCTGTGTCTCCAAGGATGCCGAGTTGGCAGGCAGCCCAGAGCTGCTAGAGTTCTTAGGTACCAGATCCCCAGGGGCTGCAGGGCTC
ACCAGCAGAGATTCCTCTGTCCTGGATGGCACAGACAGTCAGACAGGGAATGATGAAGAGGCTTTCGACTTTTTTGAGGAGCAAGACCAA
GTGGCAGAAGAGGGTCCGCCCGTCCAGAGCCTGAAGGGCGAGGATGCTGAGGAATCCTTGGAGGAGGAGGAGGCGCTGGACCCTCTGGGC

>In-frame_MTMR1_ENST00000544228_chrX_149924337_+_HS1BP3_ENST00000304031_chr2_20840940_-_2814nt
ATGGACAGGCCGGCGGCGGCGGCGGCGGCGGGCTGCGAGGGCGGCGGGGGCCCGAACCCGGGGCCGGCGGGCGGCAGGAGGCCTCCTCGG
GCCGCGGGGGGCGCCACCGCCGGCTCCCGGCAGCCCAGCGTGGAGACCCTGGACAGTCCCACAGGATCACATGTTGAATGGTGTAAACAG
CTTATAGCTGCTACAATTTCTAGTCAGATTTCAGGTTCAGTGACATCAGAAAATGTGTCCAGAGATTACAAGGCTCTAAGGGATGGAAAT
AAGCTGGCACAGATGGAAGAGGCTCCACTTTTCCCAGGAGAATCAATTAAAGCCATTGTGAAAGATGTCATGTATATCTGCCCATTTATG
GGAGCAGTGAGTGGAACCCTGACAGTGACGGACTTTAAGCTGTACTTCAAAAATGTCGAGAGGGACCCGCATTTTATCCTTGATGTTCCC
CTTGGAGTGATCAGCAGAGTGGAGAAGATTGGAGCACAGAGCCATGGAGACAATTCCTGTGGTATAGAGATAGTGTGCAAGGATATGAGG
AACTTGCGGCTTGCTTATAAACAGGAAGAACAGAGTAAACTAGGGATATTTGAAAACCTCAACAAACATGCATTTCCTCTTTCTAACGGA
CAGGCACTATTTGCATTCAGCTATAAAGAAAAATTTCCAATTAATGGCTGGAAAGTTTATGATCCAGTATCTGAATATAAGAGACAGGGC
TTGCCAAATGAGAGTTGGAAAATATCCAAAATAAACAGTAATTATGAGTTCTGTGACACCTACCCTGCCATCATTGTTGTGCCAACTAGT
GTAAAAGATGATGACCTTTCAAAAGTGGCAGCTTTTCGAGCAAAAGGCAGAGTCCCTGTGTTGTCATGGATTCATCCGGAAAGTCAAGCA
ACGATTACCCGTTGCAGCCAGCCACTTGTGGGTCCCAATGATAAGCGCTGCAAAGAGGATGAAAAATACTTGCAAACAATAATGGATGCT
AACGCACAGTCACACAAGCTTATCATCTTTGATGCTCGACAAAACAGTGTCGCTGATACCAACAAGACAAAGGGTGGAGGATATGAAAGT
GAAAGTGCTTACCCAAATGCAGAACTTGTGTTCTTGGAGATCCACAACATTCATGTCATGCGAGAGTCACTACGCAAATTAAAAGAGATT
GTGTACCCTTCGATCGATGAGGCGCGGTGGCTCTCCAATGTGGATGGGACGCATTGGCTGGAATATATAAGGATGCTGCTTGCTGGGGCA
GTAAGAATTGCTGATAAAATAGAATCTGGGAAAACATCTGTGGTGGTGCATTGCAGCGACGGTTGGGACCGAACAGCCCAGCTCACATCT
CTGGCTATGCTAATGTTGGACAGTTACTACAGGACCATTAAAGGATTTGAAACTCTCGTAGAAAAGGAGTGGATAAGCTTTGGACACAGG
TTTGCACTGCGAGTGGGCCATGGTAATGACAACCATGCGGATGCTGACCGATCTCCCATATTTCTGCAGTTTGTTGATTGTGTTTGGCAA
ATGACAAGGCAGTTTCCTTCAGCATTCGAGTTTAATGAGCTATTCTTGATTACAATTTTGGATCACCTTTATAGCTGTCTTTTTGGGACC
TTTTTGTGCAACTGTGAACAGCAGCGATTCAAAGAGGATGTATATACAAAGACGATATCTTTATGGTCGTATATCAATAGCCAGCTAGAC
GAGTTTTCTAATCCCTTCTTTGTGAATTATGAAAACCACGTGTTATATCCTGTTGCTAGTCTGAGTCATTTGGAATTGTGGGTAAATTAT
TATGTACGATGGAATCCACGGATGAGACCTCAGGTCTCCAAAAAGTACAGCGAGATTGAGGAGTTTTACCAGAAACTGAGCAGTCGTTAT
GCAGCAGCCAGCCTCCCCCCACTACCCAGGAAGGTCCTGTTTGTTGGGGAGTCTGACATCCGGGAGAGGAGAGCCGTGTTCAATGAGATC
CTGCGCTGTGTCTCCAAGGATGCCGAGTTGGCAGGCAGCCCAGAGCTGCTAGAGTTCTTAGGTACCAGATCCCCAGGGGCTGCAGGGCTC
ACCAGCAGAGATTCCTCTGTCCTGGATGGCACAGACAGTCAGACAGGGAATGATGAAGAGGCTTTCGACTTTTTTGAGGAGCAAGACCAA
GTGGCAGAAGAGGGTCCGCCCGTCCAGAGCCTGAAGGGCGAGGATGCTGAGGAATCCTTGGAGGAGGAGGAGGCGCTGGACCCTCTGGGC
ATTATGCGCTCCAAGAAGCCCAAGAAACATCCCAAAGTGGCCGTGAAAGCCAAGCCCTCGCCCCGGCTCACCATCTTTGACGAGGAGGTG
GACCCTGATGAGGGGCTCTTTGGCCCGGGCAGGAAGCTGTCTCCACAGGACCCCTCGGAGGACGTGTCATCCGTGGACCCCCTGAAGCTA
TTTGATGATCCTGACCTCGGCGGGGCCATCCCCCTGGGTGACTCCCTCCTGCTGCCAGCCGCCTGTGAGAGTGGAGGGCCCACACCCAGC
CTCAGCCACAGGGACGCCTCCAAGGAACTGTTCAGAGTTGAAGAGGACTTGGACCAGATTCTGAACCTGGGAGCTGAGCCCAAACCCAAG
CCCCAGCTTAAGCCCAAGCCACCAGTGGCAGCTAAGCCGGTGATACCCAGAAAACCAGCTGTTCCCCCCAAAGCGGGCCCGGCTGAAGCT
GTGGCTGGGCAGCAGAAGCCGCAGGAGCAGATCCAAGCCATGGACGAGATGGACATCTTGCAGTACATCCAGGACCACGATACACCAGCC

>In-frame_MTMR1_ENST00000544228_chrX_149924337_+_HS1BP3_ENST00000402541_chr2_20840940_-_2277nt
ATGGACAGGCCGGCGGCGGCGGCGGCGGCGGGCTGCGAGGGCGGCGGGGGCCCGAACCCGGGGCCGGCGGGCGGCAGGAGGCCTCCTCGG
GCCGCGGGGGGCGCCACCGCCGGCTCCCGGCAGCCCAGCGTGGAGACCCTGGACAGTCCCACAGGATCACATGTTGAATGGTGTAAACAG
CTTATAGCTGCTACAATTTCTAGTCAGATTTCAGGTTCAGTGACATCAGAAAATGTGTCCAGAGATTACAAGGCTCTAAGGGATGGAAAT
AAGCTGGCACAGATGGAAGAGGCTCCACTTTTCCCAGGAGAATCAATTAAAGCCATTGTGAAAGATGTCATGTATATCTGCCCATTTATG
GGAGCAGTGAGTGGAACCCTGACAGTGACGGACTTTAAGCTGTACTTCAAAAATGTCGAGAGGGACCCGCATTTTATCCTTGATGTTCCC
CTTGGAGTGATCAGCAGAGTGGAGAAGATTGGAGCACAGAGCCATGGAGACAATTCCTGTGGTATAGAGATAGTGTGCAAGGATATGAGG
AACTTGCGGCTTGCTTATAAACAGGAAGAACAGAGTAAACTAGGGATATTTGAAAACCTCAACAAACATGCATTTCCTCTTTCTAACGGA
CAGGCACTATTTGCATTCAGCTATAAAGAAAAATTTCCAATTAATGGCTGGAAAGTTTATGATCCAGTATCTGAATATAAGAGACAGGGC
TTGCCAAATGAGAGTTGGAAAATATCCAAAATAAACAGTAATTATGAGTTCTGTGACACCTACCCTGCCATCATTGTTGTGCCAACTAGT
GTAAAAGATGATGACCTTTCAAAAGTGGCAGCTTTTCGAGCAAAAGGCAGAGTCCCTGTGTTGTCATGGATTCATCCGGAAAGTCAAGCA
ACGATTACCCGTTGCAGCCAGCCACTTGTGGGTCCCAATGATAAGCGCTGCAAAGAGGATGAAAAATACTTGCAAACAATAATGGATGCT
AACGCACAGTCACACAAGCTTATCATCTTTGATGCTCGACAAAACAGTGTCGCTGATACCAACAAGACAAAGGGTGGAGGATATGAAAGT
GAAAGTGCTTACCCAAATGCAGAACTTGTGTTCTTGGAGATCCACAACATTCATGTCATGCGAGAGTCACTACGCAAATTAAAAGAGATT
GTGTACCCTTCGATCGATGAGGCGCGGTGGCTCTCCAATGTGGATGGGACGCATTGGCTGGAATATATAAGGATGCTGCTTGCTGGGGCA
GTAAGAATTGCTGATAAAATAGAATCTGGGAAAACATCTGTGGTGGTGCATTGCAGCGACGGTTGGGACCGAACAGCCCAGCTCACATCT
CTGGCTATGCTAATGTTGGACAGTTACTACAGGACCATTAAAGGATTTGAAACTCTCGTAGAAAAGGAGTGGATAAGCTTTGGACACAGG
TTTGCACTGCGAGTGGGCCATGGTAATGACAACCATGCGGATGCTGACCGATCTCCCATATTTCTGCAGTTTGTTGATTGTGTTTGGCAA
ATGACAAGGCAGTTTCCTTCAGCATTCGAGTTTAATGAGCTATTCTTGATTACAATTTTGGATCACCTTTATAGCTGTCTTTTTGGGACC
TTTTTGTGCAACTGTGAACAGCAGCGATTCAAAGAGGATGTATATACAAAGACGATATCTTTATGGTCGTATATCAATAGCCAGCTAGAC
GAGTTTTCTAATCCCTTCTTTGTGAATTATGAAAACCACGTGTTATATCCTGTTGCTAGTCTGAGTCATTTGGAATTGTGGGTAAATTAT
TATGTACGATGGAATCCACGGATGAGACCTCAGGTCTCCAAAAAGTACAGCGAGATTGAGGAGTTTTACCAGAAACTGAGCAGTCGTTAT
GCAGCAGCCAGCCTCCCCCCACTACCCAGGAAGGTCCTGTTTGTTGGGGAGTCTGACATCCGGGAGAGGAGAGCCGTGTTCAATGAGATC
CTGCGCTGTGTCTCCAAGGATGCCGAGTTGGCAGGCAGCCCAGAGCTGCTAGAGTTCTTAGGTACCAGATCCCCAGGGGCTGCAGGGCTC
ACCAGCAGAGATTCCTCTGTCCTGGATGGCACAGACAGTCAGACAGGGAATGATGAAGAGGCTTTCGACTTTTTTGAGGAGCAAGACCAA
GTGGCAGAAGAGGGTCCGCCCGTCCAGAGCCTGAAGGGCGAGGATGCTGAGGAATCCTTGGAGGAGGAGGAGGCGCTGGACCCTCTGGGC

>In-frame_MTMR1_ENST00000445323_chrX_149924337_+_HS1BP3_ENST00000304031_chr2_20840940_-_2838nt
ATGGACAGGCCGGCGGCGGCGGCGGCGGCGGGCTGCGAGGGCGGCGGGGGCCCGAACCCGGGGCCGGCGGGCGGCAGGAGGCCTCCTCGG
GCCGCGGGGGGCGCCACCGCCGGCTCCCGGCAGCCCAGCGTGGAGACCCTGGACAGTCCCACAGGATCACATGTTGAATGGTGTAAACAG
CTTATAGCTGCTACAATTTCTAGTCAGATTTCAGGTTCAGTGACATCAGAAAATGTGTCCAGAGATTACAAGGTTTTCAGGAGGCCTGAT
CTAAGGGCTCTAAGGGATGGAAATAAGCTGGCACAGATGGAAGAGGCTCCACTTTTCCCAGGAGAATCAATTAAAGCCATTGTGAAAGAT
GTCATGTATATCTGCCCATTTATGGGAGCAGTGAGTGGAACCCTGACAGTGACGGACTTTAAGCTGTACTTCAAAAATGTCGAGAGGGAC
CCGCATTTTATCCTTGATGTTCCCCTTGGAGTGATCAGCAGAGTGGAGAAGATTGGAGCACAGAGCCATGGAGACAATTCCTGTGGTATA
GAGATAGTGTGCAAGGATATGAGGAACTTGCGGCTTGCTTATAAACAGGAAGAACAGAGTAAACTAGGGATATTTGAAAACCTCAACAAA
CATGCATTTCCTCTTTCTAACGGACAGGCACTATTTGCATTCAGCTATAAAGAAAAATTTCCAATTAATGGCTGGAAAGTTTATGATCCA
GTATCTGAATATAAGAGACAGGGCTTGCCAAATGAGAGTTGGAAAATATCCAAAATAAACAGTAATTATGAGTTCTGTGACACCTACCCT
GCCATCATTGTTGTGCCAACTAGTGTAAAAGATGATGACCTTTCAAAAGTGGCAGCTTTTCGAGCAAAAGGCAGAGTCCCTGTGTTGTCA
TGGATTCATCCGGAAAGTCAAGCAACGATTACCCGTTGCAGCCAGCCACTTGTGGGTCCCAATGATAAGCGCTGCAAAGAGGATGAAAAA
TACTTGCAAACAATAATGGATGCTAACGCACAGTCACACAAGCTTATCATCTTTGATGCTCGACAAAACAGTGTCGCTGATACCAACAAG
ACAAAGGGTGGAGGATATGAAAGTGAAAGTGCTTACCCAAATGCAGAACTTGTGTTCTTGGAGATCCACAACATTCATGTCATGCGAGAG
TCACTACGCAAATTAAAAGAGATTGTGTACCCTTCGATCGATGAGGCGCGGTGGCTCTCCAATGTGGATGGGACGCATTGGCTGGAATAT
ATAAGGATGCTGCTTGCTGGGGCAGTAAGAATTGCTGATAAAATAGAATCTGGGAAAACATCTGTGGTGGTGCATTGCAGCGACGGTTGG
GACCGAACAGCCCAGCTCACATCTCTGGCTATGCTAATGTTGGACAGTTACTACAGGACCATTAAAGGATTTGAAACTCTCGTAGAAAAG
GAGTGGATAAGCTTTGGACACAGGTTTGCACTGCGAGTGGGCCATGGTAATGACAACCATGCGGATGCTGACCGATCTCCCATATTTCTG
CAGTTTGTTGATTGTGTTTGGCAAATGACAAGGCAGTTTCCTTCAGCATTCGAGTTTAATGAGCTATTCTTGATTACAATTTTGGATCAC
CTTTATAGCTGTCTTTTTGGGACCTTTTTGTGCAACTGTGAACAGCAGCGATTCAAAGAGGATGTATATACAAAGACGATATCTTTATGG
TCGTATATCAATAGCCAGCTAGACGAGTTTTCTAATCCCTTCTTTGTGAATTATGAAAACCACGTGTTATATCCTGTTGCTAGTCTGAGT
CATTTGGAATTGTGGGTAAATTATTATGTACGATGGAATCCACGGATGAGACCTCAGGTCTCCAAAAAGTACAGCGAGATTGAGGAGTTT
TACCAGAAACTGAGCAGTCGTTATGCAGCAGCCAGCCTCCCCCCACTACCCAGGAAGGTCCTGTTTGTTGGGGAGTCTGACATCCGGGAG
AGGAGAGCCGTGTTCAATGAGATCCTGCGCTGTGTCTCCAAGGATGCCGAGTTGGCAGGCAGCCCAGAGCTGCTAGAGTTCTTAGGTACC
AGATCCCCAGGGGCTGCAGGGCTCACCAGCAGAGATTCCTCTGTCCTGGATGGCACAGACAGTCAGACAGGGAATGATGAAGAGGCTTTC
GACTTTTTTGAGGAGCAAGACCAAGTGGCAGAAGAGGGTCCGCCCGTCCAGAGCCTGAAGGGCGAGGATGCTGAGGAATCCTTGGAGGAG
GAGGAGGCGCTGGACCCTCTGGGCATTATGCGCTCCAAGAAGCCCAAGAAACATCCCAAAGTGGCCGTGAAAGCCAAGCCCTCGCCCCGG
CTCACCATCTTTGACGAGGAGGTGGACCCTGATGAGGGGCTCTTTGGCCCGGGCAGGAAGCTGTCTCCACAGGACCCCTCGGAGGACGTG
TCATCCGTGGACCCCCTGAAGCTATTTGATGATCCTGACCTCGGCGGGGCCATCCCCCTGGGTGACTCCCTCCTGCTGCCAGCCGCCTGT
GAGAGTGGAGGGCCCACACCCAGCCTCAGCCACAGGGACGCCTCCAAGGAACTGTTCAGAGTTGAAGAGGACTTGGACCAGATTCTGAAC
CTGGGAGCTGAGCCCAAACCCAAGCCCCAGCTTAAGCCCAAGCCACCAGTGGCAGCTAAGCCGGTGATACCCAGAAAACCAGCTGTTCCC
CCCAAAGCGGGCCCGGCTGAAGCTGTGGCTGGGCAGCAGAAGCCGCAGGAGCAGATCCAAGCCATGGACGAGATGGACATCTTGCAGTAC

>In-frame_MTMR1_ENST00000445323_chrX_149924337_+_HS1BP3_ENST00000402541_chr2_20840940_-_2301nt
ATGGACAGGCCGGCGGCGGCGGCGGCGGCGGGCTGCGAGGGCGGCGGGGGCCCGAACCCGGGGCCGGCGGGCGGCAGGAGGCCTCCTCGG
GCCGCGGGGGGCGCCACCGCCGGCTCCCGGCAGCCCAGCGTGGAGACCCTGGACAGTCCCACAGGATCACATGTTGAATGGTGTAAACAG
CTTATAGCTGCTACAATTTCTAGTCAGATTTCAGGTTCAGTGACATCAGAAAATGTGTCCAGAGATTACAAGGTTTTCAGGAGGCCTGAT
CTAAGGGCTCTAAGGGATGGAAATAAGCTGGCACAGATGGAAGAGGCTCCACTTTTCCCAGGAGAATCAATTAAAGCCATTGTGAAAGAT
GTCATGTATATCTGCCCATTTATGGGAGCAGTGAGTGGAACCCTGACAGTGACGGACTTTAAGCTGTACTTCAAAAATGTCGAGAGGGAC
CCGCATTTTATCCTTGATGTTCCCCTTGGAGTGATCAGCAGAGTGGAGAAGATTGGAGCACAGAGCCATGGAGACAATTCCTGTGGTATA
GAGATAGTGTGCAAGGATATGAGGAACTTGCGGCTTGCTTATAAACAGGAAGAACAGAGTAAACTAGGGATATTTGAAAACCTCAACAAA
CATGCATTTCCTCTTTCTAACGGACAGGCACTATTTGCATTCAGCTATAAAGAAAAATTTCCAATTAATGGCTGGAAAGTTTATGATCCA
GTATCTGAATATAAGAGACAGGGCTTGCCAAATGAGAGTTGGAAAATATCCAAAATAAACAGTAATTATGAGTTCTGTGACACCTACCCT
GCCATCATTGTTGTGCCAACTAGTGTAAAAGATGATGACCTTTCAAAAGTGGCAGCTTTTCGAGCAAAAGGCAGAGTCCCTGTGTTGTCA
TGGATTCATCCGGAAAGTCAAGCAACGATTACCCGTTGCAGCCAGCCACTTGTGGGTCCCAATGATAAGCGCTGCAAAGAGGATGAAAAA
TACTTGCAAACAATAATGGATGCTAACGCACAGTCACACAAGCTTATCATCTTTGATGCTCGACAAAACAGTGTCGCTGATACCAACAAG
ACAAAGGGTGGAGGATATGAAAGTGAAAGTGCTTACCCAAATGCAGAACTTGTGTTCTTGGAGATCCACAACATTCATGTCATGCGAGAG
TCACTACGCAAATTAAAAGAGATTGTGTACCCTTCGATCGATGAGGCGCGGTGGCTCTCCAATGTGGATGGGACGCATTGGCTGGAATAT
ATAAGGATGCTGCTTGCTGGGGCAGTAAGAATTGCTGATAAAATAGAATCTGGGAAAACATCTGTGGTGGTGCATTGCAGCGACGGTTGG
GACCGAACAGCCCAGCTCACATCTCTGGCTATGCTAATGTTGGACAGTTACTACAGGACCATTAAAGGATTTGAAACTCTCGTAGAAAAG
GAGTGGATAAGCTTTGGACACAGGTTTGCACTGCGAGTGGGCCATGGTAATGACAACCATGCGGATGCTGACCGATCTCCCATATTTCTG
CAGTTTGTTGATTGTGTTTGGCAAATGACAAGGCAGTTTCCTTCAGCATTCGAGTTTAATGAGCTATTCTTGATTACAATTTTGGATCAC
CTTTATAGCTGTCTTTTTGGGACCTTTTTGTGCAACTGTGAACAGCAGCGATTCAAAGAGGATGTATATACAAAGACGATATCTTTATGG
TCGTATATCAATAGCCAGCTAGACGAGTTTTCTAATCCCTTCTTTGTGAATTATGAAAACCACGTGTTATATCCTGTTGCTAGTCTGAGT
CATTTGGAATTGTGGGTAAATTATTATGTACGATGGAATCCACGGATGAGACCTCAGGTCTCCAAAAAGTACAGCGAGATTGAGGAGTTT
TACCAGAAACTGAGCAGTCGTTATGCAGCAGCCAGCCTCCCCCCACTACCCAGGAAGGTCCTGTTTGTTGGGGAGTCTGACATCCGGGAG
AGGAGAGCCGTGTTCAATGAGATCCTGCGCTGTGTCTCCAAGGATGCCGAGTTGGCAGGCAGCCCAGAGCTGCTAGAGTTCTTAGGTACC
AGATCCCCAGGGGCTGCAGGGCTCACCAGCAGAGATTCCTCTGTCCTGGATGGCACAGACAGTCAGACAGGGAATGATGAAGAGGCTTTC
GACTTTTTTGAGGAGCAAGACCAAGTGGCAGAAGAGGGTCCGCCCGTCCAGAGCCTGAAGGGCGAGGATGCTGAGGAATCCTTGGAGGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MTMR1_ENST00000541925_chrX_149924337_+_HS1BP3_ENST00000304031_chr2_20840940_-_3965nt
ATGGGGTGGGGAGGAATTGCTAAAATGCACGGAATTGCTCCTGCTTCAAGATGTCAAGACCGAGGGAGCTTGAGCTGTTCTATACCTTTT
CCGGGAAGGACAACTGAGTCCCACAGGATCACATGTTGAATGGTGTAAACAGCTTATAGCTGCTACAATTTCTAGTCAGATTTCAGGTTC
AGTGACATCAGAAAATGTGTCCAGAGATTACAAGGTTTTCAGGAGGCCTGATCTAAGGGCTCTAAGGGATGGAAATAAGCTGGCACAGAT
GGAAGAGGCTCCACTTTTCCCAGGAGAATCAATTAAAGCCATTGTGAAAGATGTCATGTATATCTGCCCATTTATGGGAGCAGTGAGTGG
AACCCTGACAGTGACGGACTTTAAGCTGTACTTCAAAAATGTCGAGAGGGACCCGCATTTTATCCTTGATGTTCCCCTTGGAGTGATCAG
CAGAGTGGAGAAGATTGGAGCACAGAGCCATGGAGACAATTCCTGTGGTATAGAGATAGTGTGCAAGGATATGAGGAACTTGCGGCTTGC
TTATAAACAGGAAGAACAGAGTAAACTAGGGATATTTGAAAACCTCAACAAACATGCATTTCCTCTTTCTAACGGACAGGCACTATTTGC
ATTCAGCTATAAAGAAAAATTTCCAATTAATGGCTGGAAAGTTTATGATCCAGTATCTGAATATAAGAGACAGGGCTTGCCAAATGAGAG
TTGGAAAATATCCAAAATAAACAGTAATTATGAGTTCTGTGACACCTACCCTGCCATCATTGTTGTGCCAACTAGTGTAAAAGATGATGA
CCTTTCAAAAGTGGCAGCTTTTCGAGCAAAAGGCAGAGTCCCTGTGTTGTCATGGATTCATCCGGAAAGTCAAGCAACGATTACCCGTTG
CAGCCAGCCACTTGTGGGTCCCAATGATAAGCGCTGCAAAGAGGATGAAAAATACTTGCAAACAATAATGGATGCTAACGCACAGTCACA
CAAGCTTATCATCTTTGATGCTCGACAAAACAGTGTCGCTGATACCAACAAGACAAAGGGTGGAGGATATGAAAGTGAAAGTGCTTACCC
AAATGCAGAACTTGTGTTCTTGGAGATCCACAACATTCATGTCATGCGAGAGTCACTACGCAAATTAAAAGAGATTGTGTACCCTTCGAT
CGATGAGGCGCGGTGGCTCTCCAATGTGGATGGGACGCATTGGCTGGAATATATAAGGATGCTGCTTGCTGGGGCAGTAAGAATTGCTGA
TAAAATAGAATCTGGGAAAACATCTGTGGTGGTGCATTGCAGCGACGGTTGGGACCGAACAGCCCAGCTCACATCTCTGGCTATGCTAAT
GTTGGACAGTTACTACAGGACCATTAAAGGATTTGAAACTCTCGTAGAAAAGGAGTGGATAAGCTTTGGACACAGGTTTGCACTGCGAGT
GGGCCATGGTAATGACAACCATGCGGATGCTGACCGATCTCCCATATTTCTGCAGTTTGTTGATTGTGTTTGGCAAATGACAAGGCAGTT
TCCTTCAGCATTCGAGTTTAATGAGCTATTCTTGATTACAATTTTGGATCACCTTTATAGCTGTCTTTTTGGGACCTTTTTGTGCAACTG
TGAACAGCAGCGATTCAAAGAGGATGTATATACAAAGACGATATCTTTATGGTCGTATATCAATAGCCAGCTAGACGAGTTTTCTAATCC
CTTCTTTGTGAATTATGAAAACCACGTGTTATATCCTGTTGCTAGTCTGAGTCATTTGGAATTGTGGGTAAATTATTATGTACGATGGAA
TCCACGGATGAGACCTCAGGTCTCCAAAAAGTACAGCGAGATTGAGGAGTTTTACCAGAAACTGAGCAGTCGTTATGCAGCAGCCAGCCT
CCCCCCACTACCCAGGAAGGTCCTGTTTGTTGGGGAGTCTGACATCCGGGAGAGGAGAGCCGTGTTCAATGAGATCCTGCGCTGTGTCTC
CAAGGATGCCGAGTTGGCAGGCAGCCCAGAGCTGCTAGAGTTCTTAGGTACCAGATCCCCAGGGGCTGCAGGGCTCACCAGCAGAGATTC
CTCTGTCCTGGATGGCACAGACAGTCAGACAGGGAATGATGAAGAGGCTTTCGACTTTTTTGAGGAGCAAGACCAAGTGGCAGAAGAGGG
TCCGCCCGTCCAGAGCCTGAAGGGCGAGGATGCTGAGGAATCCTTGGAGGAGGAGGAGGCGCTGGACCCTCTGGGCATTATGCGCTCCAA
GAAGCCCAAGAAACATCCCAAAGTGGCCGTGAAAGCCAAGCCCTCGCCCCGGCTCACCATCTTTGACGAGGAGGTGGACCCTGATGAGGG
GCTCTTTGGCCCGGGCAGGAAGCTGTCTCCACAGGACCCCTCGGAGGACGTGTCATCCGTGGACCCCCTGAAGCTATTTGATGATCCTGA
CCTCGGCGGGGCCATCCCCCTGGGTGACTCCCTCCTGCTGCCAGCCGCCTGTGAGAGTGGAGGGCCCACACCCAGCCTCAGCCACAGGGA
CGCCTCCAAGGAACTGTTCAGAGTTGAAGAGGACTTGGACCAGATTCTGAACCTGGGAGCTGAGCCCAAACCCAAGCCCCAGCTTAAGCC
CAAGCCACCAGTGGCAGCTAAGCCGGTGATACCCAGAAAACCAGCTGTTCCCCCCAAAGCGGGCCCGGCTGAAGCTGTGGCTGGGCAGCA
GAAGCCGCAGGAGCAGATCCAAGCCATGGACGAGATGGACATCTTGCAGTACATCCAGGACCACGATACACCAGCCCAGGCCGCCCCCAG
CCTCTTCTGACCCTTCCATGCTGGCCCCTGGCCCAGCAGGCCTGTCTGTGGGGACATCGGTGTGAAGGGAAGGGACTGGGCCCTGCAGGG
TCAGAACCTCCCCACCCCCAGGGGAGGCCAGGCAGAAGCCTGGGTCACAGCACCCAGAACTGCATGGTTCCATTTTCTCCGGGGCTGTGG
GGCCAAAGTAGAAGCCTGCGGGCTGCGGGAGCGGCTCTCACCCTAGGAGCCAGAGCCCAATGTGTCTTATTCCCCGTGGACATGAAGGGG
AGGGAGGGTGTGGGGATGCCTTGCCAACCAGAAGCCCAGCCCCAAGGATGAAGCAAGACATGTGGGGCCGTAGCGAGGTGTCACATGGGG
CAGGGAAGCTTCATGCCCACGGGTTCTGCCAGCCCCAGCACAGACCCAAACTGGGGCTGGGCCTCTATCCCTCCTCTGCCTCTGTTCGCA
TAGTAAGAAGGAGTGACCGGTATCCTCCCCTTCCCCTACCCTAAGCTGTAGCCTGGGTGACTGACTGGCCTGGGCCTGGGGTGGGGACGT
CCCCAAGCCAAATTACTCCAGGGCCTCTGCTCCTCGTGGCTGCCAGGGGCCTGCAGGGTCTGGGTGGGTCTCCCAGGAGAGGAATACTGA
GTGGGAGATCGGCTGTCTGGAGTGTTCTGATGCAAGTCTCTCTCTCCTGAGCCTCCTCTTGATGCAAGCTCTAAAGGGAGAAGTCAGGCC
CTGCCTCTCCAGGGTATAGACGGCCCTGCTAGGCCCCAGTTCTTCCTCCTTCCCCCTTTCCCAGGAAAGGCCAGCCCAGTCCATGGCCTT
CTTGGGCCTCTGGGCACAGAGCCAATGTTCGTCATTGCAGCTCTCAGCAAACTGGGTCATAGCTTTCCCCACAGCTCAGCCTGGGGCCTG
GGCAGGGCTCCCAGCCTGCACCGCCTCCCACTGCCAGTGGGGCATGATTCTCTCAGGCTTCTGCCCCGAGGCCTTCGTCGTCCTCAGGGT
CTGGACTTGGTCAGTGGCCTTTCACCAGTGGAGCTGCCTTCCCAGGGAGAAGGAGCCGTGCGCCAGGGCAGGGCCCGTGCCTTAGACTTC
TCCCGACCCCCAGAGCGCTGGTACACAGGTCTAGGCACCACACAGTGCTTTGGAAATTCTCAGTGAATGATGTTTAATAAAGCAAAAAAT

>In-frame_MTMR1_ENST00000541925_chrX_149924337_+_HS1BP3_ENST00000402541_chr2_20840940_-_5964nt
ATGGGGTGGGGAGGAATTGCTAAAATGCACGGAATTGCTCCTGCTTCAAGATGTCAAGACCGAGGGAGCTTGAGCTGTTCTATACCTTTT
CCGGGAAGGACAACTGAGTCCCACAGGATCACATGTTGAATGGTGTAAACAGCTTATAGCTGCTACAATTTCTAGTCAGATTTCAGGTTC
AGTGACATCAGAAAATGTGTCCAGAGATTACAAGGTTTTCAGGAGGCCTGATCTAAGGGCTCTAAGGGATGGAAATAAGCTGGCACAGAT
GGAAGAGGCTCCACTTTTCCCAGGAGAATCAATTAAAGCCATTGTGAAAGATGTCATGTATATCTGCCCATTTATGGGAGCAGTGAGTGG
AACCCTGACAGTGACGGACTTTAAGCTGTACTTCAAAAATGTCGAGAGGGACCCGCATTTTATCCTTGATGTTCCCCTTGGAGTGATCAG
CAGAGTGGAGAAGATTGGAGCACAGAGCCATGGAGACAATTCCTGTGGTATAGAGATAGTGTGCAAGGATATGAGGAACTTGCGGCTTGC
TTATAAACAGGAAGAACAGAGTAAACTAGGGATATTTGAAAACCTCAACAAACATGCATTTCCTCTTTCTAACGGACAGGCACTATTTGC
ATTCAGCTATAAAGAAAAATTTCCAATTAATGGCTGGAAAGTTTATGATCCAGTATCTGAATATAAGAGACAGGGCTTGCCAAATGAGAG
TTGGAAAATATCCAAAATAAACAGTAATTATGAGTTCTGTGACACCTACCCTGCCATCATTGTTGTGCCAACTAGTGTAAAAGATGATGA
CCTTTCAAAAGTGGCAGCTTTTCGAGCAAAAGGCAGAGTCCCTGTGTTGTCATGGATTCATCCGGAAAGTCAAGCAACGATTACCCGTTG
CAGCCAGCCACTTGTGGGTCCCAATGATAAGCGCTGCAAAGAGGATGAAAAATACTTGCAAACAATAATGGATGCTAACGCACAGTCACA
CAAGCTTATCATCTTTGATGCTCGACAAAACAGTGTCGCTGATACCAACAAGACAAAGGGTGGAGGATATGAAAGTGAAAGTGCTTACCC
AAATGCAGAACTTGTGTTCTTGGAGATCCACAACATTCATGTCATGCGAGAGTCACTACGCAAATTAAAAGAGATTGTGTACCCTTCGAT
CGATGAGGCGCGGTGGCTCTCCAATGTGGATGGGACGCATTGGCTGGAATATATAAGGATGCTGCTTGCTGGGGCAGTAAGAATTGCTGA
TAAAATAGAATCTGGGAAAACATCTGTGGTGGTGCATTGCAGCGACGGTTGGGACCGAACAGCCCAGCTCACATCTCTGGCTATGCTAAT
GTTGGACAGTTACTACAGGACCATTAAAGGATTTGAAACTCTCGTAGAAAAGGAGTGGATAAGCTTTGGACACAGGTTTGCACTGCGAGT
GGGCCATGGTAATGACAACCATGCGGATGCTGACCGATCTCCCATATTTCTGCAGTTTGTTGATTGTGTTTGGCAAATGACAAGGCAGTT
TCCTTCAGCATTCGAGTTTAATGAGCTATTCTTGATTACAATTTTGGATCACCTTTATAGCTGTCTTTTTGGGACCTTTTTGTGCAACTG
TGAACAGCAGCGATTCAAAGAGGATGTATATACAAAGACGATATCTTTATGGTCGTATATCAATAGCCAGCTAGACGAGTTTTCTAATCC
CTTCTTTGTGAATTATGAAAACCACGTGTTATATCCTGTTGCTAGTCTGAGTCATTTGGAATTGTGGGTAAATTATTATGTACGATGGAA
TCCACGGATGAGACCTCAGGTCTCCAAAAAGTACAGCGAGATTGAGGAGTTTTACCAGAAACTGAGCAGTCGTTATGCAGCAGCCAGCCT
CCCCCCACTACCCAGGAAGGTCCTGTTTGTTGGGGAGTCTGACATCCGGGAGAGGAGAGCCGTGTTCAATGAGATCCTGCGCTGTGTCTC
CAAGGATGCCGAGTTGGCAGGCAGCCCAGAGCTGCTAGAGTTCTTAGGTACCAGATCCCCAGGGGCTGCAGGGCTCACCAGCAGAGATTC
CTCTGTCCTGGATGGCACAGACAGTCAGACAGGGAATGATGAAGAGGCTTTCGACTTTTTTGAGGAGCAAGACCAAGTGGCAGAAGAGGG
TCCGCCCGTCCAGAGCCTGAAGGGCGAGGATGCTGAGGAATCCTTGGAGGAGGAGGAGGCGCTGGACCCTCTGGGCATTATGCGGTTGGT
CTCCTGTTGTTGAGAGGGCCCCTTTGGTGTATTCCAGGCTTTCTGGAGATGACGTCCCCCTTCCCTGGAATCTGAGAAAAGCCCTGAGCA
TCCCAGGTCGCCCCCTCGCAGGGATCTGGGCCACGAGGCCTTGGCCTGGTGTGTTGGGGGAAGTAGCTCTCTGCGTGCCCTTGGTGGTGT
GCATGTCTCTGGGACTGGGCTTAGGTGTCGCCTCCCTTCTCGGGTCACAGGATGTCCTCCACTTGTGGCTCCGCACTGGGGCTTGGTAGA
GTCCTCCGTGACAGCTCAGTAGTGCAGGCTGCGGGCCTGTCCGGCTAGTGTGGGAGGACTGGGTGCTCCTTCCAGCTGTGGGACTCGCAG
AGGTGGCTGCGGCTCTCTGGGCTGCATCATCTGCATAGCAGGAGCATTCACCTTGGCCCTGCCTCCACACAGGGCCATTCACCAGCCATA
CATCTCTGGCCATTTACAATCTCTTTTCTTCGGTTTTCCTCAGTGAAAATGGACTCATGGTCGTATCAACCTCTTAGGGCTCCTGTGACG
ATGAACTGAGTTATGTAAATTTAGCAATCAGCTACCATCATGGCCCCATCTTTCAGTGGAATCAGACCAGGCCAGGGGTGCTGTCCTCCC
CGCTCTCTACCACAACGAATGTCTCTTAGCCGTTTACCAAAGCCCTCGGGCGCCAGATGAGTGTAGGTCCTGCCGCAGAAAGGAATTAGA
GCCCAGTAGAAATTAGGCAGAAGCAAGTTCAACTTCATCAGCATGTAGAATTCTCTCCTAAAATCACAGCCCACTCTGGAAAGGCCTTCT
TCGTGGGGAGGGTTATGGGAGGGTGGGCTGCAGGGTGGCCATGAGACCAGCGTCCAGGGGTGAGGATTTGCACTGGGAAAGGGTACGCGG
CGCTCAGGGAGCTGCAGCAGAAACAGGCCTGAGATCTGGGGTCCTGCGGCACCTGGGCACAGCAAGTGCCCTGCAGTCGCTCCTCCTGGC
CCTCCGTGGCTGGCCTTGTCCCTGAGTGGGGTCAGCGGCCCTGAGGGAGAGGCAGCCAGAGTAGTGGGTGATATGGGGACAAGCCTGTAA
TAGTCACTCCTTATCAGCCTGGCCCAACGCGGCAGGCCTTTCTTGGGCTTTATTTTGGTAAGGGTGAGGCTTTGTTTGAACTCACATTCT
CTGTTGTTCTGAGTAACCACACGTAGTGCCAAACCGAGATGGACTTTGGTGGTCTGTGCCAACCTTTGGCTGAAGAACACACTTAGCCGA
GCGGCTCCTTTTTTGGGTAGGAAAATGTTCTTTGTGGCTGGCAAGTGCTGCCTTGAACTTCCTACTTACTTCATTAGCAGATTGTCAGGG
GAGATGTGTCAGCTATCCTGGGACCCCTTGGCGGGGCGGGGGGGGCGGGGGCAGCCCCCTCCCCAGCTCTGTACTCTGGGGCCCTCACCC
CTGAATCCTGGGAAAGCTTAGCACCTAAGAGTAATCCTGCCGGCTTAAGACCCTCCCCTGCTGGGGTTTCTTTTTAAGGACCCGTGTGAC
AAGGTGCTGATGAATCAACGTTATCACCTCTGTCAGGAATAATAAGTAAATTTTTTGAGAGTTTATGAAATGCTGGGAACTAAGTTAGCA
TTTGCTTGCATGATCTCATTATATCTGTAAGACAGCATTTCTGAAACTACTTGCTACAACCCATAGTAAAAACTATATGGTACGCCATGA
CCCAGGACACACATGTATAAACATCCCATAAAACTGAAGCAAAAGTTCCCAGAACTCATACAAAACCTTACTAAGTGTATTGTACTGGGA
TATTTTCTATTCTATTTCAACGTTTGGAAAGGTCATGACTCGCCAAACTGCTTTCAGGATCCACTGTGGGCACAGGTCAAGAAACGGAGC
CCTGGAGGCCTGCACTGGCATCAGCCTCTTCTGTGTGGTGGGAAACTCAAGTTCAGGGTCAGGTGGTTCGTCCACGTTCCTGCAGCCTGC
AGATGGCAGAGCCAGGACCCCACGCCATCTCCAGTCCAGTCTTTATCAGCCTGGGAGGTGGGCAGGGCCCCAGGATTATCCCCCTTTCAC
AGATGGTAAAATCGAGGAAGGAGTTGAGCAGGATCTTGGCCAGAGCCGTGTGTGTTCCAGAGCTGTGTGTGTGGCAGAGCCGTACCTTGA
AGTTGGGTTTCCACCTCGGCCTTTCACAGACACCCAGGTGGGCTTGTTGATCTCTCTTGGTGCCACCCACCTGCCCTTTGGTGGGGGACT
TTCTGTTCTTCTCGGGAGGCTGTTTGTGCACCCCTCTCCCTCCCGTGCGCTTGGTTCCTGTGCAGATGCAGCGGCACCCGTTTCCCAGCT
TGCCCTGCCCCATGTCTGGGCTTAGCTCTGGGCTCTCCTGGAGCGGCCACCATTTCCATGCAACCAGCCTCGGTCCTTCCCCGCCGTGGC
CGCGGCGAGGCGCTGCTGCTCTGCTGAAGGGCTGCTCCACGGCAGGGCTGCTGGGAGGGTGGGAGTCGCCAGCACAAAGCCGGAGCCCAG
GCCGGCCTGGCTTTTCTTTGTCTTTTAAACCTGGTTTTGATTAGGGACAAGAGAGCGTTATTACACCATTAGAGAGCAATTAAAGATAGA
AAAAGCCCTCACCTCGGCCCATCCCAACACCACCGCTCTCTCCATCTGCTGGGGCTCTCTTCTGACCCCGTCCCAGCAGCATCCATGCAA
CCGCAGGCACAATGCACGTGCCTTTTCGTACTCTGCTTTTCCACCCTATGGTCTGTCCCGATTGCTGCTCCATGTCGCCCCTGTTTTGTA
TTTAAGTTTCTATTTTAGAATGTCACGGTGCTGAGAAAATTGACATTCTACCCTAATAGTTCTGCCTTATGCTGGAAATCCTCTGCGGGA
AACCTTTTTCATTGTGACTCAAATAACACACAATTAGTATAGAAAAATTGCAAACACAGATAAAAGTCCTTTCCCTGTGAATTTCTGAAT
GCACCTTTGAATATTCACATCTTACTGCCAAAATGAGATTGTCTTGTGTGCCGTTCTGGAATTTGCTTTTTTCCAGCTTACATGTTCTAG
GTCCTTCCAGATCAATAGCTGCACTCTCCCTCCTTCCTCTGCTGGTTTCTCAGCTCGATGGGCTGTAAGTGGCATTACCAGGCCCTTGCT
TGTGGGCGTGGCGGGGTTTTCTGTAGGTTTTTGCTATTACAGGCAATAACCTGAGGAACTTCTACATATACAAAGCTTTTATTCTATGGA
GCCTTCCCCTATATACGTGCCCCAGAGCAAGGTCCCTGAAGCTGCTTCTGGGGGCTTTGGGGTACCATTCCAGTAAAAGGTTCTCTAAGG
GCTGAAGCCCCTCTGTTGGGAGGCCCCTCTGCTTTTCTAAGCCCTGCCCACCCCCGCCCTCAGGGCCCACTCCTCCCACCTCTTCTTTTG
CACACAGGGACCCCCTCCAGGCCCTGGGTCCCTGAGGACTCACAGCGTCCTTGGGACAGGCTGGCTCCTGTATGAACAAATGCACCTGCC
TGCAAAGCTGGTCTTCCCAGACTCCCTGGAAGGGGGAGCCCACACCCGGGTCCCCGTGCTGTGGCCTCCGTGGTGAAGCTGGATGTTTCT
CTGGAATGCCACGTTTTATGGTTGTTTTTTAATATGGATTTTGCTTCATCTTTCATAAAACAACCACATGTATTTTAGTATAAAAATAAT

>In-frame_MTMR1_ENST00000370390_chrX_149924337_+_HS1BP3_ENST00000304031_chr2_20840940_-_4136nt
GGGTAACGCGGGGCCGCCAGGTGACAGCTAATGGCGGCGGCCGCCTGAGGCGGGCGGGCGGTATAGAGCGGGCGGCAGGAGGCAAGCAGC
GAAACCTTCCCGGCCGCCGCTCCCGTCCCGACGGCGGCTTCCCCAAGGCGGCAGGACTCGGCGCGCCATGGACAGGCCGGCGGCGGCGGC
GGCGGCGGGCTGCGAGGGCGGCGGGGGCCCGAACCCGGGGCCGGCGGGCGGCAGGAGGCCTCCTCGGGCCGCGGGGGGCGCCACCGCCGG
CTCCCGGCAGCCCAGCGTGGAGACCCTGGACAGTCCCACAGGATCACATGTTGAATGGTGTAAACAGCTTATAGCTGCTACAATTTCTAG
TCAGATTTCAGGTTCAGTGACATCAGAAAATGTGTCCAGAGATTACAAGGCTCTAAGGGATGGAAATAAGCTGGCACAGATGGAAGAGGC
TCCACTTTTCCCAGGAGAATCAATTAAAGCCATTGTGAAAGATGTCATGTATATCTGCCCATTTATGGGAGCAGTGAGTGGAACCCTGAC
AGTGACGGACTTTAAGCTGTACTTCAAAAATGTCGAGAGGGACCCGCATTTTATCCTTGATGTTCCCCTTGGAGTGATCAGCAGAGTGGA
GAAGATTGGAGCACAGAGCCATGGAGACAATTCCTGTGGTATAGAGATAGTGTGCAAGGATATGAGGAACTTGCGGCTTGCTTATAAACA
GGAAGAACAGAGTAAACTAGGGATATTTGAAAACCTCAACAAACATGCATTTCCTCTTTCTAACGGACAGGCACTATTTGCATTCAGCTA
TAAAGAAAAATTTCCAATTAATGGCTGGAAAGTTTATGATCCAGTATCTGAATATAAGAGACAGGGCTTGCCAAATGAGAGTTGGAAAAT
ATCCAAAATAAACAGTAATTATGAGTTCTGTGACACCTACCCTGCCATCATTGTTGTGCCAACTAGTGTAAAAGATGATGACCTTTCAAA
AGTGGCAGCTTTTCGAGCAAAAGGCAGAGTCCCTGTGTTGTCATGGATTCATCCGGAAAGTCAAGCAACGATTACCCGTTGCAGCCAGCC
ACTTGTGGGTCCCAATGATAAGCGCTGCAAAGAGGATGAAAAATACTTGCAAACAATAATGGATGCTAACGCACAGTCACACAAGCTTAT
CATCTTTGATGCTCGACAAAACAGTGTCGCTGATACCAACAAGACAAAGGGTGGAGGATATGAAAGTGAAAGTGCTTACCCAAATGCAGA
ACTTGTGTTCTTGGAGATCCACAACATTCATGTCATGCGAGAGTCACTACGCAAATTAAAAGAGATTGTGTACCCTTCGATCGATGAGGC
GCGGTGGCTCTCCAATGTGGATGGGACGCATTGGCTGGAATATATAAGGATGCTGCTTGCTGGGGCAGTAAGAATTGCTGATAAAATAGA
ATCTGGGAAAACATCTGTGGTGGTGCATTGCAGCGACGGTTGGGACCGAACAGCCCAGCTCACATCTCTGGCTATGCTAATGTTGGACAG
TTACTACAGGACCATTAAAGGATTTGAAACTCTCGTAGAAAAGGAGTGGATAAGCTTTGGACACAGGTTTGCACTGCGAGTGGGCCATGG
TAATGACAACCATGCGGATGCTGACCGATCTCCCATATTTCTGCAGTTTGTTGATTGTGTTTGGCAAATGACAAGGCAGTTTCCTTCAGC
ATTCGAGTTTAATGAGCTATTCTTGATTACAATTTTGGATCACCTTTATAGCTGTCTTTTTGGGACCTTTTTGTGCAACTGTGAACAGCA
GCGATTCAAAGAGGATGTATATACAAAGACGATATCTTTATGGTCGTATATCAATAGCCAGCTAGACGAGTTTTCTAATCCCTTCTTTGT
GAATTATGAAAACCACGTGTTATATCCTGTTGCTAGTCTGAGTCATTTGGAATTGTGGGTAAATTATTATGTACGATGGAATCCACGGAT
GAGACCTCAGGTCTCCAAAAAGTACAGCGAGATTGAGGAGTTTTACCAGAAACTGAGCAGTCGTTATGCAGCAGCCAGCCTCCCCCCACT
ACCCAGGAAGGTCCTGTTTGTTGGGGAGTCTGACATCCGGGAGAGGAGAGCCGTGTTCAATGAGATCCTGCGCTGTGTCTCCAAGGATGC
CGAGTTGGCAGGCAGCCCAGAGCTGCTAGAGTTCTTAGGTACCAGATCCCCAGGGGCTGCAGGGCTCACCAGCAGAGATTCCTCTGTCCT
GGATGGCACAGACAGTCAGACAGGGAATGATGAAGAGGCTTTCGACTTTTTTGAGGAGCAAGACCAAGTGGCAGAAGAGGGTCCGCCCGT
CCAGAGCCTGAAGGGCGAGGATGCTGAGGAATCCTTGGAGGAGGAGGAGGCGCTGGACCCTCTGGGCATTATGCGCTCCAAGAAGCCCAA
GAAACATCCCAAAGTGGCCGTGAAAGCCAAGCCCTCGCCCCGGCTCACCATCTTTGACGAGGAGGTGGACCCTGATGAGGGGCTCTTTGG
CCCGGGCAGGAAGCTGTCTCCACAGGACCCCTCGGAGGACGTGTCATCCGTGGACCCCCTGAAGCTATTTGATGATCCTGACCTCGGCGG
GGCCATCCCCCTGGGTGACTCCCTCCTGCTGCCAGCCGCCTGTGAGAGTGGAGGGCCCACACCCAGCCTCAGCCACAGGGACGCCTCCAA
GGAACTGTTCAGAGTTGAAGAGGACTTGGACCAGATTCTGAACCTGGGAGCTGAGCCCAAACCCAAGCCCCAGCTTAAGCCCAAGCCACC
AGTGGCAGCTAAGCCGGTGATACCCAGAAAACCAGCTGTTCCCCCCAAAGCGGGCCCGGCTGAAGCTGTGGCTGGGCAGCAGAAGCCGCA
GGAGCAGATCCAAGCCATGGACGAGATGGACATCTTGCAGTACATCCAGGACCACGATACACCAGCCCAGGCCGCCCCCAGCCTCTTCTG
ACCCTTCCATGCTGGCCCCTGGCCCAGCAGGCCTGTCTGTGGGGACATCGGTGTGAAGGGAAGGGACTGGGCCCTGCAGGGTCAGAACCT
CCCCACCCCCAGGGGAGGCCAGGCAGAAGCCTGGGTCACAGCACCCAGAACTGCATGGTTCCATTTTCTCCGGGGCTGTGGGGCCAAAGT
AGAAGCCTGCGGGCTGCGGGAGCGGCTCTCACCCTAGGAGCCAGAGCCCAATGTGTCTTATTCCCCGTGGACATGAAGGGGAGGGAGGGT
GTGGGGATGCCTTGCCAACCAGAAGCCCAGCCCCAAGGATGAAGCAAGACATGTGGGGCCGTAGCGAGGTGTCACATGGGGCAGGGAAGC
TTCATGCCCACGGGTTCTGCCAGCCCCAGCACAGACCCAAACTGGGGCTGGGCCTCTATCCCTCCTCTGCCTCTGTTCGCATAGTAAGAA
GGAGTGACCGGTATCCTCCCCTTCCCCTACCCTAAGCTGTAGCCTGGGTGACTGACTGGCCTGGGCCTGGGGTGGGGACGTCCCCAAGCC
AAATTACTCCAGGGCCTCTGCTCCTCGTGGCTGCCAGGGGCCTGCAGGGTCTGGGTGGGTCTCCCAGGAGAGGAATACTGAGTGGGAGAT
CGGCTGTCTGGAGTGTTCTGATGCAAGTCTCTCTCTCCTGAGCCTCCTCTTGATGCAAGCTCTAAAGGGAGAAGTCAGGCCCTGCCTCTC
CAGGGTATAGACGGCCCTGCTAGGCCCCAGTTCTTCCTCCTTCCCCCTTTCCCAGGAAAGGCCAGCCCAGTCCATGGCCTTCTTGGGCCT
CTGGGCACAGAGCCAATGTTCGTCATTGCAGCTCTCAGCAAACTGGGTCATAGCTTTCCCCACAGCTCAGCCTGGGGCCTGGGCAGGGCT
CCCAGCCTGCACCGCCTCCCACTGCCAGTGGGGCATGATTCTCTCAGGCTTCTGCCCCGAGGCCTTCGTCGTCCTCAGGGTCTGGACTTG
GTCAGTGGCCTTTCACCAGTGGAGCTGCCTTCCCAGGGAGAAGGAGCCGTGCGCCAGGGCAGGGCCCGTGCCTTAGACTTCTCCCGACCC

>In-frame_MTMR1_ENST00000370390_chrX_149924337_+_HS1BP3_ENST00000402541_chr2_20840940_-_6135nt
GGGTAACGCGGGGCCGCCAGGTGACAGCTAATGGCGGCGGCCGCCTGAGGCGGGCGGGCGGTATAGAGCGGGCGGCAGGAGGCAAGCAGC
GAAACCTTCCCGGCCGCCGCTCCCGTCCCGACGGCGGCTTCCCCAAGGCGGCAGGACTCGGCGCGCCATGGACAGGCCGGCGGCGGCGGC
GGCGGCGGGCTGCGAGGGCGGCGGGGGCCCGAACCCGGGGCCGGCGGGCGGCAGGAGGCCTCCTCGGGCCGCGGGGGGCGCCACCGCCGG
CTCCCGGCAGCCCAGCGTGGAGACCCTGGACAGTCCCACAGGATCACATGTTGAATGGTGTAAACAGCTTATAGCTGCTACAATTTCTAG
TCAGATTTCAGGTTCAGTGACATCAGAAAATGTGTCCAGAGATTACAAGGCTCTAAGGGATGGAAATAAGCTGGCACAGATGGAAGAGGC
TCCACTTTTCCCAGGAGAATCAATTAAAGCCATTGTGAAAGATGTCATGTATATCTGCCCATTTATGGGAGCAGTGAGTGGAACCCTGAC
AGTGACGGACTTTAAGCTGTACTTCAAAAATGTCGAGAGGGACCCGCATTTTATCCTTGATGTTCCCCTTGGAGTGATCAGCAGAGTGGA
GAAGATTGGAGCACAGAGCCATGGAGACAATTCCTGTGGTATAGAGATAGTGTGCAAGGATATGAGGAACTTGCGGCTTGCTTATAAACA
GGAAGAACAGAGTAAACTAGGGATATTTGAAAACCTCAACAAACATGCATTTCCTCTTTCTAACGGACAGGCACTATTTGCATTCAGCTA
TAAAGAAAAATTTCCAATTAATGGCTGGAAAGTTTATGATCCAGTATCTGAATATAAGAGACAGGGCTTGCCAAATGAGAGTTGGAAAAT
ATCCAAAATAAACAGTAATTATGAGTTCTGTGACACCTACCCTGCCATCATTGTTGTGCCAACTAGTGTAAAAGATGATGACCTTTCAAA
AGTGGCAGCTTTTCGAGCAAAAGGCAGAGTCCCTGTGTTGTCATGGATTCATCCGGAAAGTCAAGCAACGATTACCCGTTGCAGCCAGCC
ACTTGTGGGTCCCAATGATAAGCGCTGCAAAGAGGATGAAAAATACTTGCAAACAATAATGGATGCTAACGCACAGTCACACAAGCTTAT
CATCTTTGATGCTCGACAAAACAGTGTCGCTGATACCAACAAGACAAAGGGTGGAGGATATGAAAGTGAAAGTGCTTACCCAAATGCAGA
ACTTGTGTTCTTGGAGATCCACAACATTCATGTCATGCGAGAGTCACTACGCAAATTAAAAGAGATTGTGTACCCTTCGATCGATGAGGC
GCGGTGGCTCTCCAATGTGGATGGGACGCATTGGCTGGAATATATAAGGATGCTGCTTGCTGGGGCAGTAAGAATTGCTGATAAAATAGA
ATCTGGGAAAACATCTGTGGTGGTGCATTGCAGCGACGGTTGGGACCGAACAGCCCAGCTCACATCTCTGGCTATGCTAATGTTGGACAG
TTACTACAGGACCATTAAAGGATTTGAAACTCTCGTAGAAAAGGAGTGGATAAGCTTTGGACACAGGTTTGCACTGCGAGTGGGCCATGG
TAATGACAACCATGCGGATGCTGACCGATCTCCCATATTTCTGCAGTTTGTTGATTGTGTTTGGCAAATGACAAGGCAGTTTCCTTCAGC
ATTCGAGTTTAATGAGCTATTCTTGATTACAATTTTGGATCACCTTTATAGCTGTCTTTTTGGGACCTTTTTGTGCAACTGTGAACAGCA
GCGATTCAAAGAGGATGTATATACAAAGACGATATCTTTATGGTCGTATATCAATAGCCAGCTAGACGAGTTTTCTAATCCCTTCTTTGT
GAATTATGAAAACCACGTGTTATATCCTGTTGCTAGTCTGAGTCATTTGGAATTGTGGGTAAATTATTATGTACGATGGAATCCACGGAT
GAGACCTCAGGTCTCCAAAAAGTACAGCGAGATTGAGGAGTTTTACCAGAAACTGAGCAGTCGTTATGCAGCAGCCAGCCTCCCCCCACT
ACCCAGGAAGGTCCTGTTTGTTGGGGAGTCTGACATCCGGGAGAGGAGAGCCGTGTTCAATGAGATCCTGCGCTGTGTCTCCAAGGATGC
CGAGTTGGCAGGCAGCCCAGAGCTGCTAGAGTTCTTAGGTACCAGATCCCCAGGGGCTGCAGGGCTCACCAGCAGAGATTCCTCTGTCCT
GGATGGCACAGACAGTCAGACAGGGAATGATGAAGAGGCTTTCGACTTTTTTGAGGAGCAAGACCAAGTGGCAGAAGAGGGTCCGCCCGT
CCAGAGCCTGAAGGGCGAGGATGCTGAGGAATCCTTGGAGGAGGAGGAGGCGCTGGACCCTCTGGGCATTATGCGGTTGGTCTCCTGTTG
TTGAGAGGGCCCCTTTGGTGTATTCCAGGCTTTCTGGAGATGACGTCCCCCTTCCCTGGAATCTGAGAAAAGCCCTGAGCATCCCAGGTC
GCCCCCTCGCAGGGATCTGGGCCACGAGGCCTTGGCCTGGTGTGTTGGGGGAAGTAGCTCTCTGCGTGCCCTTGGTGGTGTGCATGTCTC
TGGGACTGGGCTTAGGTGTCGCCTCCCTTCTCGGGTCACAGGATGTCCTCCACTTGTGGCTCCGCACTGGGGCTTGGTAGAGTCCTCCGT
GACAGCTCAGTAGTGCAGGCTGCGGGCCTGTCCGGCTAGTGTGGGAGGACTGGGTGCTCCTTCCAGCTGTGGGACTCGCAGAGGTGGCTG
CGGCTCTCTGGGCTGCATCATCTGCATAGCAGGAGCATTCACCTTGGCCCTGCCTCCACACAGGGCCATTCACCAGCCATACATCTCTGG
CCATTTACAATCTCTTTTCTTCGGTTTTCCTCAGTGAAAATGGACTCATGGTCGTATCAACCTCTTAGGGCTCCTGTGACGATGAACTGA
GTTATGTAAATTTAGCAATCAGCTACCATCATGGCCCCATCTTTCAGTGGAATCAGACCAGGCCAGGGGTGCTGTCCTCCCCGCTCTCTA
CCACAACGAATGTCTCTTAGCCGTTTACCAAAGCCCTCGGGCGCCAGATGAGTGTAGGTCCTGCCGCAGAAAGGAATTAGAGCCCAGTAG
AAATTAGGCAGAAGCAAGTTCAACTTCATCAGCATGTAGAATTCTCTCCTAAAATCACAGCCCACTCTGGAAAGGCCTTCTTCGTGGGGA
GGGTTATGGGAGGGTGGGCTGCAGGGTGGCCATGAGACCAGCGTCCAGGGGTGAGGATTTGCACTGGGAAAGGGTACGCGGCGCTCAGGG
AGCTGCAGCAGAAACAGGCCTGAGATCTGGGGTCCTGCGGCACCTGGGCACAGCAAGTGCCCTGCAGTCGCTCCTCCTGGCCCTCCGTGG
CTGGCCTTGTCCCTGAGTGGGGTCAGCGGCCCTGAGGGAGAGGCAGCCAGAGTAGTGGGTGATATGGGGACAAGCCTGTAATAGTCACTC
CTTATCAGCCTGGCCCAACGCGGCAGGCCTTTCTTGGGCTTTATTTTGGTAAGGGTGAGGCTTTGTTTGAACTCACATTCTCTGTTGTTC
TGAGTAACCACACGTAGTGCCAAACCGAGATGGACTTTGGTGGTCTGTGCCAACCTTTGGCTGAAGAACACACTTAGCCGAGCGGCTCCT
TTTTTGGGTAGGAAAATGTTCTTTGTGGCTGGCAAGTGCTGCCTTGAACTTCCTACTTACTTCATTAGCAGATTGTCAGGGGAGATGTGT
CAGCTATCCTGGGACCCCTTGGCGGGGCGGGGGGGGCGGGGGCAGCCCCCTCCCCAGCTCTGTACTCTGGGGCCCTCACCCCTGAATCCT
GGGAAAGCTTAGCACCTAAGAGTAATCCTGCCGGCTTAAGACCCTCCCCTGCTGGGGTTTCTTTTTAAGGACCCGTGTGACAAGGTGCTG
ATGAATCAACGTTATCACCTCTGTCAGGAATAATAAGTAAATTTTTTGAGAGTTTATGAAATGCTGGGAACTAAGTTAGCATTTGCTTGC
ATGATCTCATTATATCTGTAAGACAGCATTTCTGAAACTACTTGCTACAACCCATAGTAAAAACTATATGGTACGCCATGACCCAGGACA
CACATGTATAAACATCCCATAAAACTGAAGCAAAAGTTCCCAGAACTCATACAAAACCTTACTAAGTGTATTGTACTGGGATATTTTCTA
TTCTATTTCAACGTTTGGAAAGGTCATGACTCGCCAAACTGCTTTCAGGATCCACTGTGGGCACAGGTCAAGAAACGGAGCCCTGGAGGC
CTGCACTGGCATCAGCCTCTTCTGTGTGGTGGGAAACTCAAGTTCAGGGTCAGGTGGTTCGTCCACGTTCCTGCAGCCTGCAGATGGCAG
AGCCAGGACCCCACGCCATCTCCAGTCCAGTCTTTATCAGCCTGGGAGGTGGGCAGGGCCCCAGGATTATCCCCCTTTCACAGATGGTAA
AATCGAGGAAGGAGTTGAGCAGGATCTTGGCCAGAGCCGTGTGTGTTCCAGAGCTGTGTGTGTGGCAGAGCCGTACCTTGAAGTTGGGTT
TCCACCTCGGCCTTTCACAGACACCCAGGTGGGCTTGTTGATCTCTCTTGGTGCCACCCACCTGCCCTTTGGTGGGGGACTTTCTGTTCT
TCTCGGGAGGCTGTTTGTGCACCCCTCTCCCTCCCGTGCGCTTGGTTCCTGTGCAGATGCAGCGGCACCCGTTTCCCAGCTTGCCCTGCC
CCATGTCTGGGCTTAGCTCTGGGCTCTCCTGGAGCGGCCACCATTTCCATGCAACCAGCCTCGGTCCTTCCCCGCCGTGGCCGCGGCGAG
GCGCTGCTGCTCTGCTGAAGGGCTGCTCCACGGCAGGGCTGCTGGGAGGGTGGGAGTCGCCAGCACAAAGCCGGAGCCCAGGCCGGCCTG
GCTTTTCTTTGTCTTTTAAACCTGGTTTTGATTAGGGACAAGAGAGCGTTATTACACCATTAGAGAGCAATTAAAGATAGAAAAAGCCCT
CACCTCGGCCCATCCCAACACCACCGCTCTCTCCATCTGCTGGGGCTCTCTTCTGACCCCGTCCCAGCAGCATCCATGCAACCGCAGGCA
CAATGCACGTGCCTTTTCGTACTCTGCTTTTCCACCCTATGGTCTGTCCCGATTGCTGCTCCATGTCGCCCCTGTTTTGTATTTAAGTTT
CTATTTTAGAATGTCACGGTGCTGAGAAAATTGACATTCTACCCTAATAGTTCTGCCTTATGCTGGAAATCCTCTGCGGGAAACCTTTTT
CATTGTGACTCAAATAACACACAATTAGTATAGAAAAATTGCAAACACAGATAAAAGTCCTTTCCCTGTGAATTTCTGAATGCACCTTTG
AATATTCACATCTTACTGCCAAAATGAGATTGTCTTGTGTGCCGTTCTGGAATTTGCTTTTTTCCAGCTTACATGTTCTAGGTCCTTCCA
GATCAATAGCTGCACTCTCCCTCCTTCCTCTGCTGGTTTCTCAGCTCGATGGGCTGTAAGTGGCATTACCAGGCCCTTGCTTGTGGGCGT
GGCGGGGTTTTCTGTAGGTTTTTGCTATTACAGGCAATAACCTGAGGAACTTCTACATATACAAAGCTTTTATTCTATGGAGCCTTCCCC
TATATACGTGCCCCAGAGCAAGGTCCCTGAAGCTGCTTCTGGGGGCTTTGGGGTACCATTCCAGTAAAAGGTTCTCTAAGGGCTGAAGCC
CCTCTGTTGGGAGGCCCCTCTGCTTTTCTAAGCCCTGCCCACCCCCGCCCTCAGGGCCCACTCCTCCCACCTCTTCTTTTGCACACAGGG
ACCCCCTCCAGGCCCTGGGTCCCTGAGGACTCACAGCGTCCTTGGGACAGGCTGGCTCCTGTATGAACAAATGCACCTGCCTGCAAAGCT
GGTCTTCCCAGACTCCCTGGAAGGGGGAGCCCACACCCGGGTCCCCGTGCTGTGGCCTCCGTGGTGAAGCTGGATGTTTCTCTGGAATGC
CACGTTTTATGGTTGTTTTTTAATATGGATTTTGCTTCATCTTTCATAAAACAACCACATGTATTTTAGTATAAAAATAATATCTTACTC

>In-frame_MTMR1_ENST00000544228_chrX_149924337_+_HS1BP3_ENST00000304031_chr2_20840940_-_4100nt
GCGGCCGCCTGAGGCGGGCGGGCGGTATAGAGCGGGCGGCAGGAGGCAAGCAGCGAAACCTTCCCGGCCGCCGCTCCCGTCCCGACGGCG
GCTTCCCCAAGGCGGCAGGACTCGGCGCGCCATGGACAGGCCGGCGGCGGCGGCGGCGGCGGGCTGCGAGGGCGGCGGGGGCCCGAACCC
GGGGCCGGCGGGCGGCAGGAGGCCTCCTCGGGCCGCGGGGGGCGCCACCGCCGGCTCCCGGCAGCCCAGCGTGGAGACCCTGGACAGTCC
CACAGGATCACATGTTGAATGGTGTAAACAGCTTATAGCTGCTACAATTTCTAGTCAGATTTCAGGTTCAGTGACATCAGAAAATGTGTC
CAGAGATTACAAGGCTCTAAGGGATGGAAATAAGCTGGCACAGATGGAAGAGGCTCCACTTTTCCCAGGAGAATCAATTAAAGCCATTGT
GAAAGATGTCATGTATATCTGCCCATTTATGGGAGCAGTGAGTGGAACCCTGACAGTGACGGACTTTAAGCTGTACTTCAAAAATGTCGA
GAGGGACCCGCATTTTATCCTTGATGTTCCCCTTGGAGTGATCAGCAGAGTGGAGAAGATTGGAGCACAGAGCCATGGAGACAATTCCTG
TGGTATAGAGATAGTGTGCAAGGATATGAGGAACTTGCGGCTTGCTTATAAACAGGAAGAACAGAGTAAACTAGGGATATTTGAAAACCT
CAACAAACATGCATTTCCTCTTTCTAACGGACAGGCACTATTTGCATTCAGCTATAAAGAAAAATTTCCAATTAATGGCTGGAAAGTTTA
TGATCCAGTATCTGAATATAAGAGACAGGGCTTGCCAAATGAGAGTTGGAAAATATCCAAAATAAACAGTAATTATGAGTTCTGTGACAC
CTACCCTGCCATCATTGTTGTGCCAACTAGTGTAAAAGATGATGACCTTTCAAAAGTGGCAGCTTTTCGAGCAAAAGGCAGAGTCCCTGT
GTTGTCATGGATTCATCCGGAAAGTCAAGCAACGATTACCCGTTGCAGCCAGCCACTTGTGGGTCCCAATGATAAGCGCTGCAAAGAGGA
TGAAAAATACTTGCAAACAATAATGGATGCTAACGCACAGTCACACAAGCTTATCATCTTTGATGCTCGACAAAACAGTGTCGCTGATAC
CAACAAGACAAAGGGTGGAGGATATGAAAGTGAAAGTGCTTACCCAAATGCAGAACTTGTGTTCTTGGAGATCCACAACATTCATGTCAT
GCGAGAGTCACTACGCAAATTAAAAGAGATTGTGTACCCTTCGATCGATGAGGCGCGGTGGCTCTCCAATGTGGATGGGACGCATTGGCT
GGAATATATAAGGATGCTGCTTGCTGGGGCAGTAAGAATTGCTGATAAAATAGAATCTGGGAAAACATCTGTGGTGGTGCATTGCAGCGA
CGGTTGGGACCGAACAGCCCAGCTCACATCTCTGGCTATGCTAATGTTGGACAGTTACTACAGGACCATTAAAGGATTTGAAACTCTCGT
AGAAAAGGAGTGGATAAGCTTTGGACACAGGTTTGCACTGCGAGTGGGCCATGGTAATGACAACCATGCGGATGCTGACCGATCTCCCAT
ATTTCTGCAGTTTGTTGATTGTGTTTGGCAAATGACAAGGCAGTTTCCTTCAGCATTCGAGTTTAATGAGCTATTCTTGATTACAATTTT
GGATCACCTTTATAGCTGTCTTTTTGGGACCTTTTTGTGCAACTGTGAACAGCAGCGATTCAAAGAGGATGTATATACAAAGACGATATC
TTTATGGTCGTATATCAATAGCCAGCTAGACGAGTTTTCTAATCCCTTCTTTGTGAATTATGAAAACCACGTGTTATATCCTGTTGCTAG
TCTGAGTCATTTGGAATTGTGGGTAAATTATTATGTACGATGGAATCCACGGATGAGACCTCAGGTCTCCAAAAAGTACAGCGAGATTGA
GGAGTTTTACCAGAAACTGAGCAGTCGTTATGCAGCAGCCAGCCTCCCCCCACTACCCAGGAAGGTCCTGTTTGTTGGGGAGTCTGACAT
CCGGGAGAGGAGAGCCGTGTTCAATGAGATCCTGCGCTGTGTCTCCAAGGATGCCGAGTTGGCAGGCAGCCCAGAGCTGCTAGAGTTCTT
AGGTACCAGATCCCCAGGGGCTGCAGGGCTCACCAGCAGAGATTCCTCTGTCCTGGATGGCACAGACAGTCAGACAGGGAATGATGAAGA
GGCTTTCGACTTTTTTGAGGAGCAAGACCAAGTGGCAGAAGAGGGTCCGCCCGTCCAGAGCCTGAAGGGCGAGGATGCTGAGGAATCCTT
GGAGGAGGAGGAGGCGCTGGACCCTCTGGGCATTATGCGCTCCAAGAAGCCCAAGAAACATCCCAAAGTGGCCGTGAAAGCCAAGCCCTC
GCCCCGGCTCACCATCTTTGACGAGGAGGTGGACCCTGATGAGGGGCTCTTTGGCCCGGGCAGGAAGCTGTCTCCACAGGACCCCTCGGA
GGACGTGTCATCCGTGGACCCCCTGAAGCTATTTGATGATCCTGACCTCGGCGGGGCCATCCCCCTGGGTGACTCCCTCCTGCTGCCAGC
CGCCTGTGAGAGTGGAGGGCCCACACCCAGCCTCAGCCACAGGGACGCCTCCAAGGAACTGTTCAGAGTTGAAGAGGACTTGGACCAGAT
TCTGAACCTGGGAGCTGAGCCCAAACCCAAGCCCCAGCTTAAGCCCAAGCCACCAGTGGCAGCTAAGCCGGTGATACCCAGAAAACCAGC
TGTTCCCCCCAAAGCGGGCCCGGCTGAAGCTGTGGCTGGGCAGCAGAAGCCGCAGGAGCAGATCCAAGCCATGGACGAGATGGACATCTT
GCAGTACATCCAGGACCACGATACACCAGCCCAGGCCGCCCCCAGCCTCTTCTGACCCTTCCATGCTGGCCCCTGGCCCAGCAGGCCTGT
CTGTGGGGACATCGGTGTGAAGGGAAGGGACTGGGCCCTGCAGGGTCAGAACCTCCCCACCCCCAGGGGAGGCCAGGCAGAAGCCTGGGT
CACAGCACCCAGAACTGCATGGTTCCATTTTCTCCGGGGCTGTGGGGCCAAAGTAGAAGCCTGCGGGCTGCGGGAGCGGCTCTCACCCTA
GGAGCCAGAGCCCAATGTGTCTTATTCCCCGTGGACATGAAGGGGAGGGAGGGTGTGGGGATGCCTTGCCAACCAGAAGCCCAGCCCCAA
GGATGAAGCAAGACATGTGGGGCCGTAGCGAGGTGTCACATGGGGCAGGGAAGCTTCATGCCCACGGGTTCTGCCAGCCCCAGCACAGAC
CCAAACTGGGGCTGGGCCTCTATCCCTCCTCTGCCTCTGTTCGCATAGTAAGAAGGAGTGACCGGTATCCTCCCCTTCCCCTACCCTAAG
CTGTAGCCTGGGTGACTGACTGGCCTGGGCCTGGGGTGGGGACGTCCCCAAGCCAAATTACTCCAGGGCCTCTGCTCCTCGTGGCTGCCA
GGGGCCTGCAGGGTCTGGGTGGGTCTCCCAGGAGAGGAATACTGAGTGGGAGATCGGCTGTCTGGAGTGTTCTGATGCAAGTCTCTCTCT
CCTGAGCCTCCTCTTGATGCAAGCTCTAAAGGGAGAAGTCAGGCCCTGCCTCTCCAGGGTATAGACGGCCCTGCTAGGCCCCAGTTCTTC
CTCCTTCCCCCTTTCCCAGGAAAGGCCAGCCCAGTCCATGGCCTTCTTGGGCCTCTGGGCACAGAGCCAATGTTCGTCATTGCAGCTCTC
AGCAAACTGGGTCATAGCTTTCCCCACAGCTCAGCCTGGGGCCTGGGCAGGGCTCCCAGCCTGCACCGCCTCCCACTGCCAGTGGGGCAT
GATTCTCTCAGGCTTCTGCCCCGAGGCCTTCGTCGTCCTCAGGGTCTGGACTTGGTCAGTGGCCTTTCACCAGTGGAGCTGCCTTCCCAG
GGAGAAGGAGCCGTGCGCCAGGGCAGGGCCCGTGCCTTAGACTTCTCCCGACCCCCAGAGCGCTGGTACACAGGTCTAGGCACCACACAG

>In-frame_MTMR1_ENST00000544228_chrX_149924337_+_HS1BP3_ENST00000402541_chr2_20840940_-_6099nt
GCGGCCGCCTGAGGCGGGCGGGCGGTATAGAGCGGGCGGCAGGAGGCAAGCAGCGAAACCTTCCCGGCCGCCGCTCCCGTCCCGACGGCG
GCTTCCCCAAGGCGGCAGGACTCGGCGCGCCATGGACAGGCCGGCGGCGGCGGCGGCGGCGGGCTGCGAGGGCGGCGGGGGCCCGAACCC
GGGGCCGGCGGGCGGCAGGAGGCCTCCTCGGGCCGCGGGGGGCGCCACCGCCGGCTCCCGGCAGCCCAGCGTGGAGACCCTGGACAGTCC
CACAGGATCACATGTTGAATGGTGTAAACAGCTTATAGCTGCTACAATTTCTAGTCAGATTTCAGGTTCAGTGACATCAGAAAATGTGTC
CAGAGATTACAAGGCTCTAAGGGATGGAAATAAGCTGGCACAGATGGAAGAGGCTCCACTTTTCCCAGGAGAATCAATTAAAGCCATTGT
GAAAGATGTCATGTATATCTGCCCATTTATGGGAGCAGTGAGTGGAACCCTGACAGTGACGGACTTTAAGCTGTACTTCAAAAATGTCGA
GAGGGACCCGCATTTTATCCTTGATGTTCCCCTTGGAGTGATCAGCAGAGTGGAGAAGATTGGAGCACAGAGCCATGGAGACAATTCCTG
TGGTATAGAGATAGTGTGCAAGGATATGAGGAACTTGCGGCTTGCTTATAAACAGGAAGAACAGAGTAAACTAGGGATATTTGAAAACCT
CAACAAACATGCATTTCCTCTTTCTAACGGACAGGCACTATTTGCATTCAGCTATAAAGAAAAATTTCCAATTAATGGCTGGAAAGTTTA
TGATCCAGTATCTGAATATAAGAGACAGGGCTTGCCAAATGAGAGTTGGAAAATATCCAAAATAAACAGTAATTATGAGTTCTGTGACAC
CTACCCTGCCATCATTGTTGTGCCAACTAGTGTAAAAGATGATGACCTTTCAAAAGTGGCAGCTTTTCGAGCAAAAGGCAGAGTCCCTGT
GTTGTCATGGATTCATCCGGAAAGTCAAGCAACGATTACCCGTTGCAGCCAGCCACTTGTGGGTCCCAATGATAAGCGCTGCAAAGAGGA
TGAAAAATACTTGCAAACAATAATGGATGCTAACGCACAGTCACACAAGCTTATCATCTTTGATGCTCGACAAAACAGTGTCGCTGATAC
CAACAAGACAAAGGGTGGAGGATATGAAAGTGAAAGTGCTTACCCAAATGCAGAACTTGTGTTCTTGGAGATCCACAACATTCATGTCAT
GCGAGAGTCACTACGCAAATTAAAAGAGATTGTGTACCCTTCGATCGATGAGGCGCGGTGGCTCTCCAATGTGGATGGGACGCATTGGCT
GGAATATATAAGGATGCTGCTTGCTGGGGCAGTAAGAATTGCTGATAAAATAGAATCTGGGAAAACATCTGTGGTGGTGCATTGCAGCGA
CGGTTGGGACCGAACAGCCCAGCTCACATCTCTGGCTATGCTAATGTTGGACAGTTACTACAGGACCATTAAAGGATTTGAAACTCTCGT
AGAAAAGGAGTGGATAAGCTTTGGACACAGGTTTGCACTGCGAGTGGGCCATGGTAATGACAACCATGCGGATGCTGACCGATCTCCCAT
ATTTCTGCAGTTTGTTGATTGTGTTTGGCAAATGACAAGGCAGTTTCCTTCAGCATTCGAGTTTAATGAGCTATTCTTGATTACAATTTT
GGATCACCTTTATAGCTGTCTTTTTGGGACCTTTTTGTGCAACTGTGAACAGCAGCGATTCAAAGAGGATGTATATACAAAGACGATATC
TTTATGGTCGTATATCAATAGCCAGCTAGACGAGTTTTCTAATCCCTTCTTTGTGAATTATGAAAACCACGTGTTATATCCTGTTGCTAG
TCTGAGTCATTTGGAATTGTGGGTAAATTATTATGTACGATGGAATCCACGGATGAGACCTCAGGTCTCCAAAAAGTACAGCGAGATTGA
GGAGTTTTACCAGAAACTGAGCAGTCGTTATGCAGCAGCCAGCCTCCCCCCACTACCCAGGAAGGTCCTGTTTGTTGGGGAGTCTGACAT
CCGGGAGAGGAGAGCCGTGTTCAATGAGATCCTGCGCTGTGTCTCCAAGGATGCCGAGTTGGCAGGCAGCCCAGAGCTGCTAGAGTTCTT
AGGTACCAGATCCCCAGGGGCTGCAGGGCTCACCAGCAGAGATTCCTCTGTCCTGGATGGCACAGACAGTCAGACAGGGAATGATGAAGA
GGCTTTCGACTTTTTTGAGGAGCAAGACCAAGTGGCAGAAGAGGGTCCGCCCGTCCAGAGCCTGAAGGGCGAGGATGCTGAGGAATCCTT
GGAGGAGGAGGAGGCGCTGGACCCTCTGGGCATTATGCGGTTGGTCTCCTGTTGTTGAGAGGGCCCCTTTGGTGTATTCCAGGCTTTCTG
GAGATGACGTCCCCCTTCCCTGGAATCTGAGAAAAGCCCTGAGCATCCCAGGTCGCCCCCTCGCAGGGATCTGGGCCACGAGGCCTTGGC
CTGGTGTGTTGGGGGAAGTAGCTCTCTGCGTGCCCTTGGTGGTGTGCATGTCTCTGGGACTGGGCTTAGGTGTCGCCTCCCTTCTCGGGT
CACAGGATGTCCTCCACTTGTGGCTCCGCACTGGGGCTTGGTAGAGTCCTCCGTGACAGCTCAGTAGTGCAGGCTGCGGGCCTGTCCGGC
TAGTGTGGGAGGACTGGGTGCTCCTTCCAGCTGTGGGACTCGCAGAGGTGGCTGCGGCTCTCTGGGCTGCATCATCTGCATAGCAGGAGC
ATTCACCTTGGCCCTGCCTCCACACAGGGCCATTCACCAGCCATACATCTCTGGCCATTTACAATCTCTTTTCTTCGGTTTTCCTCAGTG
AAAATGGACTCATGGTCGTATCAACCTCTTAGGGCTCCTGTGACGATGAACTGAGTTATGTAAATTTAGCAATCAGCTACCATCATGGCC
CCATCTTTCAGTGGAATCAGACCAGGCCAGGGGTGCTGTCCTCCCCGCTCTCTACCACAACGAATGTCTCTTAGCCGTTTACCAAAGCCC
TCGGGCGCCAGATGAGTGTAGGTCCTGCCGCAGAAAGGAATTAGAGCCCAGTAGAAATTAGGCAGAAGCAAGTTCAACTTCATCAGCATG
TAGAATTCTCTCCTAAAATCACAGCCCACTCTGGAAAGGCCTTCTTCGTGGGGAGGGTTATGGGAGGGTGGGCTGCAGGGTGGCCATGAG
ACCAGCGTCCAGGGGTGAGGATTTGCACTGGGAAAGGGTACGCGGCGCTCAGGGAGCTGCAGCAGAAACAGGCCTGAGATCTGGGGTCCT
GCGGCACCTGGGCACAGCAAGTGCCCTGCAGTCGCTCCTCCTGGCCCTCCGTGGCTGGCCTTGTCCCTGAGTGGGGTCAGCGGCCCTGAG
GGAGAGGCAGCCAGAGTAGTGGGTGATATGGGGACAAGCCTGTAATAGTCACTCCTTATCAGCCTGGCCCAACGCGGCAGGCCTTTCTTG
GGCTTTATTTTGGTAAGGGTGAGGCTTTGTTTGAACTCACATTCTCTGTTGTTCTGAGTAACCACACGTAGTGCCAAACCGAGATGGACT
TTGGTGGTCTGTGCCAACCTTTGGCTGAAGAACACACTTAGCCGAGCGGCTCCTTTTTTGGGTAGGAAAATGTTCTTTGTGGCTGGCAAG
TGCTGCCTTGAACTTCCTACTTACTTCATTAGCAGATTGTCAGGGGAGATGTGTCAGCTATCCTGGGACCCCTTGGCGGGGCGGGGGGGG
CGGGGGCAGCCCCCTCCCCAGCTCTGTACTCTGGGGCCCTCACCCCTGAATCCTGGGAAAGCTTAGCACCTAAGAGTAATCCTGCCGGCT
TAAGACCCTCCCCTGCTGGGGTTTCTTTTTAAGGACCCGTGTGACAAGGTGCTGATGAATCAACGTTATCACCTCTGTCAGGAATAATAA
GTAAATTTTTTGAGAGTTTATGAAATGCTGGGAACTAAGTTAGCATTTGCTTGCATGATCTCATTATATCTGTAAGACAGCATTTCTGAA
ACTACTTGCTACAACCCATAGTAAAAACTATATGGTACGCCATGACCCAGGACACACATGTATAAACATCCCATAAAACTGAAGCAAAAG
TTCCCAGAACTCATACAAAACCTTACTAAGTGTATTGTACTGGGATATTTTCTATTCTATTTCAACGTTTGGAAAGGTCATGACTCGCCA
AACTGCTTTCAGGATCCACTGTGGGCACAGGTCAAGAAACGGAGCCCTGGAGGCCTGCACTGGCATCAGCCTCTTCTGTGTGGTGGGAAA
CTCAAGTTCAGGGTCAGGTGGTTCGTCCACGTTCCTGCAGCCTGCAGATGGCAGAGCCAGGACCCCACGCCATCTCCAGTCCAGTCTTTA
TCAGCCTGGGAGGTGGGCAGGGCCCCAGGATTATCCCCCTTTCACAGATGGTAAAATCGAGGAAGGAGTTGAGCAGGATCTTGGCCAGAG
CCGTGTGTGTTCCAGAGCTGTGTGTGTGGCAGAGCCGTACCTTGAAGTTGGGTTTCCACCTCGGCCTTTCACAGACACCCAGGTGGGCTT
GTTGATCTCTCTTGGTGCCACCCACCTGCCCTTTGGTGGGGGACTTTCTGTTCTTCTCGGGAGGCTGTTTGTGCACCCCTCTCCCTCCCG
TGCGCTTGGTTCCTGTGCAGATGCAGCGGCACCCGTTTCCCAGCTTGCCCTGCCCCATGTCTGGGCTTAGCTCTGGGCTCTCCTGGAGCG
GCCACCATTTCCATGCAACCAGCCTCGGTCCTTCCCCGCCGTGGCCGCGGCGAGGCGCTGCTGCTCTGCTGAAGGGCTGCTCCACGGCAG
GGCTGCTGGGAGGGTGGGAGTCGCCAGCACAAAGCCGGAGCCCAGGCCGGCCTGGCTTTTCTTTGTCTTTTAAACCTGGTTTTGATTAGG
GACAAGAGAGCGTTATTACACCATTAGAGAGCAATTAAAGATAGAAAAAGCCCTCACCTCGGCCCATCCCAACACCACCGCTCTCTCCAT
CTGCTGGGGCTCTCTTCTGACCCCGTCCCAGCAGCATCCATGCAACCGCAGGCACAATGCACGTGCCTTTTCGTACTCTGCTTTTCCACC
CTATGGTCTGTCCCGATTGCTGCTCCATGTCGCCCCTGTTTTGTATTTAAGTTTCTATTTTAGAATGTCACGGTGCTGAGAAAATTGACA
TTCTACCCTAATAGTTCTGCCTTATGCTGGAAATCCTCTGCGGGAAACCTTTTTCATTGTGACTCAAATAACACACAATTAGTATAGAAA
AATTGCAAACACAGATAAAAGTCCTTTCCCTGTGAATTTCTGAATGCACCTTTGAATATTCACATCTTACTGCCAAAATGAGATTGTCTT
GTGTGCCGTTCTGGAATTTGCTTTTTTCCAGCTTACATGTTCTAGGTCCTTCCAGATCAATAGCTGCACTCTCCCTCCTTCCTCTGCTGG
TTTCTCAGCTCGATGGGCTGTAAGTGGCATTACCAGGCCCTTGCTTGTGGGCGTGGCGGGGTTTTCTGTAGGTTTTTGCTATTACAGGCA
ATAACCTGAGGAACTTCTACATATACAAAGCTTTTATTCTATGGAGCCTTCCCCTATATACGTGCCCCAGAGCAAGGTCCCTGAAGCTGC
TTCTGGGGGCTTTGGGGTACCATTCCAGTAAAAGGTTCTCTAAGGGCTGAAGCCCCTCTGTTGGGAGGCCCCTCTGCTTTTCTAAGCCCT
GCCCACCCCCGCCCTCAGGGCCCACTCCTCCCACCTCTTCTTTTGCACACAGGGACCCCCTCCAGGCCCTGGGTCCCTGAGGACTCACAG
CGTCCTTGGGACAGGCTGGCTCCTGTATGAACAAATGCACCTGCCTGCAAAGCTGGTCTTCCCAGACTCCCTGGAAGGGGGAGCCCACAC
CCGGGTCCCCGTGCTGTGGCCTCCGTGGTGAAGCTGGATGTTTCTCTGGAATGCCACGTTTTATGGTTGTTTTTTAATATGGATTTTGCT

>In-frame_MTMR1_ENST00000445323_chrX_149924337_+_HS1BP3_ENST00000304031_chr2_20840940_-_4124nt
GCGGCCGCCTGAGGCGGGCGGGCGGTATAGAGCGGGCGGCAGGAGGCAAGCAGCGAAACCTTCCCGGCCGCCGCTCCCGTCCCGACGGCG
GCTTCCCCAAGGCGGCAGGACTCGGCGCGCCATGGACAGGCCGGCGGCGGCGGCGGCGGCGGGCTGCGAGGGCGGCGGGGGCCCGAACCC
GGGGCCGGCGGGCGGCAGGAGGCCTCCTCGGGCCGCGGGGGGCGCCACCGCCGGCTCCCGGCAGCCCAGCGTGGAGACCCTGGACAGTCC
CACAGGATCACATGTTGAATGGTGTAAACAGCTTATAGCTGCTACAATTTCTAGTCAGATTTCAGGTTCAGTGACATCAGAAAATGTGTC
CAGAGATTACAAGGTTTTCAGGAGGCCTGATCTAAGGGCTCTAAGGGATGGAAATAAGCTGGCACAGATGGAAGAGGCTCCACTTTTCCC
AGGAGAATCAATTAAAGCCATTGTGAAAGATGTCATGTATATCTGCCCATTTATGGGAGCAGTGAGTGGAACCCTGACAGTGACGGACTT
TAAGCTGTACTTCAAAAATGTCGAGAGGGACCCGCATTTTATCCTTGATGTTCCCCTTGGAGTGATCAGCAGAGTGGAGAAGATTGGAGC
ACAGAGCCATGGAGACAATTCCTGTGGTATAGAGATAGTGTGCAAGGATATGAGGAACTTGCGGCTTGCTTATAAACAGGAAGAACAGAG
TAAACTAGGGATATTTGAAAACCTCAACAAACATGCATTTCCTCTTTCTAACGGACAGGCACTATTTGCATTCAGCTATAAAGAAAAATT
TCCAATTAATGGCTGGAAAGTTTATGATCCAGTATCTGAATATAAGAGACAGGGCTTGCCAAATGAGAGTTGGAAAATATCCAAAATAAA
CAGTAATTATGAGTTCTGTGACACCTACCCTGCCATCATTGTTGTGCCAACTAGTGTAAAAGATGATGACCTTTCAAAAGTGGCAGCTTT
TCGAGCAAAAGGCAGAGTCCCTGTGTTGTCATGGATTCATCCGGAAAGTCAAGCAACGATTACCCGTTGCAGCCAGCCACTTGTGGGTCC
CAATGATAAGCGCTGCAAAGAGGATGAAAAATACTTGCAAACAATAATGGATGCTAACGCACAGTCACACAAGCTTATCATCTTTGATGC
TCGACAAAACAGTGTCGCTGATACCAACAAGACAAAGGGTGGAGGATATGAAAGTGAAAGTGCTTACCCAAATGCAGAACTTGTGTTCTT
GGAGATCCACAACATTCATGTCATGCGAGAGTCACTACGCAAATTAAAAGAGATTGTGTACCCTTCGATCGATGAGGCGCGGTGGCTCTC
CAATGTGGATGGGACGCATTGGCTGGAATATATAAGGATGCTGCTTGCTGGGGCAGTAAGAATTGCTGATAAAATAGAATCTGGGAAAAC
ATCTGTGGTGGTGCATTGCAGCGACGGTTGGGACCGAACAGCCCAGCTCACATCTCTGGCTATGCTAATGTTGGACAGTTACTACAGGAC
CATTAAAGGATTTGAAACTCTCGTAGAAAAGGAGTGGATAAGCTTTGGACACAGGTTTGCACTGCGAGTGGGCCATGGTAATGACAACCA
TGCGGATGCTGACCGATCTCCCATATTTCTGCAGTTTGTTGATTGTGTTTGGCAAATGACAAGGCAGTTTCCTTCAGCATTCGAGTTTAA
TGAGCTATTCTTGATTACAATTTTGGATCACCTTTATAGCTGTCTTTTTGGGACCTTTTTGTGCAACTGTGAACAGCAGCGATTCAAAGA
GGATGTATATACAAAGACGATATCTTTATGGTCGTATATCAATAGCCAGCTAGACGAGTTTTCTAATCCCTTCTTTGTGAATTATGAAAA
CCACGTGTTATATCCTGTTGCTAGTCTGAGTCATTTGGAATTGTGGGTAAATTATTATGTACGATGGAATCCACGGATGAGACCTCAGGT
CTCCAAAAAGTACAGCGAGATTGAGGAGTTTTACCAGAAACTGAGCAGTCGTTATGCAGCAGCCAGCCTCCCCCCACTACCCAGGAAGGT
CCTGTTTGTTGGGGAGTCTGACATCCGGGAGAGGAGAGCCGTGTTCAATGAGATCCTGCGCTGTGTCTCCAAGGATGCCGAGTTGGCAGG
CAGCCCAGAGCTGCTAGAGTTCTTAGGTACCAGATCCCCAGGGGCTGCAGGGCTCACCAGCAGAGATTCCTCTGTCCTGGATGGCACAGA
CAGTCAGACAGGGAATGATGAAGAGGCTTTCGACTTTTTTGAGGAGCAAGACCAAGTGGCAGAAGAGGGTCCGCCCGTCCAGAGCCTGAA
GGGCGAGGATGCTGAGGAATCCTTGGAGGAGGAGGAGGCGCTGGACCCTCTGGGCATTATGCGCTCCAAGAAGCCCAAGAAACATCCCAA
AGTGGCCGTGAAAGCCAAGCCCTCGCCCCGGCTCACCATCTTTGACGAGGAGGTGGACCCTGATGAGGGGCTCTTTGGCCCGGGCAGGAA
GCTGTCTCCACAGGACCCCTCGGAGGACGTGTCATCCGTGGACCCCCTGAAGCTATTTGATGATCCTGACCTCGGCGGGGCCATCCCCCT
GGGTGACTCCCTCCTGCTGCCAGCCGCCTGTGAGAGTGGAGGGCCCACACCCAGCCTCAGCCACAGGGACGCCTCCAAGGAACTGTTCAG
AGTTGAAGAGGACTTGGACCAGATTCTGAACCTGGGAGCTGAGCCCAAACCCAAGCCCCAGCTTAAGCCCAAGCCACCAGTGGCAGCTAA
GCCGGTGATACCCAGAAAACCAGCTGTTCCCCCCAAAGCGGGCCCGGCTGAAGCTGTGGCTGGGCAGCAGAAGCCGCAGGAGCAGATCCA
AGCCATGGACGAGATGGACATCTTGCAGTACATCCAGGACCACGATACACCAGCCCAGGCCGCCCCCAGCCTCTTCTGACCCTTCCATGC
TGGCCCCTGGCCCAGCAGGCCTGTCTGTGGGGACATCGGTGTGAAGGGAAGGGACTGGGCCCTGCAGGGTCAGAACCTCCCCACCCCCAG
GGGAGGCCAGGCAGAAGCCTGGGTCACAGCACCCAGAACTGCATGGTTCCATTTTCTCCGGGGCTGTGGGGCCAAAGTAGAAGCCTGCGG
GCTGCGGGAGCGGCTCTCACCCTAGGAGCCAGAGCCCAATGTGTCTTATTCCCCGTGGACATGAAGGGGAGGGAGGGTGTGGGGATGCCT
TGCCAACCAGAAGCCCAGCCCCAAGGATGAAGCAAGACATGTGGGGCCGTAGCGAGGTGTCACATGGGGCAGGGAAGCTTCATGCCCACG
GGTTCTGCCAGCCCCAGCACAGACCCAAACTGGGGCTGGGCCTCTATCCCTCCTCTGCCTCTGTTCGCATAGTAAGAAGGAGTGACCGGT
ATCCTCCCCTTCCCCTACCCTAAGCTGTAGCCTGGGTGACTGACTGGCCTGGGCCTGGGGTGGGGACGTCCCCAAGCCAAATTACTCCAG
GGCCTCTGCTCCTCGTGGCTGCCAGGGGCCTGCAGGGTCTGGGTGGGTCTCCCAGGAGAGGAATACTGAGTGGGAGATCGGCTGTCTGGA
GTGTTCTGATGCAAGTCTCTCTCTCCTGAGCCTCCTCTTGATGCAAGCTCTAAAGGGAGAAGTCAGGCCCTGCCTCTCCAGGGTATAGAC
GGCCCTGCTAGGCCCCAGTTCTTCCTCCTTCCCCCTTTCCCAGGAAAGGCCAGCCCAGTCCATGGCCTTCTTGGGCCTCTGGGCACAGAG
CCAATGTTCGTCATTGCAGCTCTCAGCAAACTGGGTCATAGCTTTCCCCACAGCTCAGCCTGGGGCCTGGGCAGGGCTCCCAGCCTGCAC
CGCCTCCCACTGCCAGTGGGGCATGATTCTCTCAGGCTTCTGCCCCGAGGCCTTCGTCGTCCTCAGGGTCTGGACTTGGTCAGTGGCCTT
TCACCAGTGGAGCTGCCTTCCCAGGGAGAAGGAGCCGTGCGCCAGGGCAGGGCCCGTGCCTTAGACTTCTCCCGACCCCCAGAGCGCTGG

>In-frame_MTMR1_ENST00000445323_chrX_149924337_+_HS1BP3_ENST00000402541_chr2_20840940_-_6123nt
GCGGCCGCCTGAGGCGGGCGGGCGGTATAGAGCGGGCGGCAGGAGGCAAGCAGCGAAACCTTCCCGGCCGCCGCTCCCGTCCCGACGGCG
GCTTCCCCAAGGCGGCAGGACTCGGCGCGCCATGGACAGGCCGGCGGCGGCGGCGGCGGCGGGCTGCGAGGGCGGCGGGGGCCCGAACCC
GGGGCCGGCGGGCGGCAGGAGGCCTCCTCGGGCCGCGGGGGGCGCCACCGCCGGCTCCCGGCAGCCCAGCGTGGAGACCCTGGACAGTCC
CACAGGATCACATGTTGAATGGTGTAAACAGCTTATAGCTGCTACAATTTCTAGTCAGATTTCAGGTTCAGTGACATCAGAAAATGTGTC
CAGAGATTACAAGGTTTTCAGGAGGCCTGATCTAAGGGCTCTAAGGGATGGAAATAAGCTGGCACAGATGGAAGAGGCTCCACTTTTCCC
AGGAGAATCAATTAAAGCCATTGTGAAAGATGTCATGTATATCTGCCCATTTATGGGAGCAGTGAGTGGAACCCTGACAGTGACGGACTT
TAAGCTGTACTTCAAAAATGTCGAGAGGGACCCGCATTTTATCCTTGATGTTCCCCTTGGAGTGATCAGCAGAGTGGAGAAGATTGGAGC
ACAGAGCCATGGAGACAATTCCTGTGGTATAGAGATAGTGTGCAAGGATATGAGGAACTTGCGGCTTGCTTATAAACAGGAAGAACAGAG
TAAACTAGGGATATTTGAAAACCTCAACAAACATGCATTTCCTCTTTCTAACGGACAGGCACTATTTGCATTCAGCTATAAAGAAAAATT
TCCAATTAATGGCTGGAAAGTTTATGATCCAGTATCTGAATATAAGAGACAGGGCTTGCCAAATGAGAGTTGGAAAATATCCAAAATAAA
CAGTAATTATGAGTTCTGTGACACCTACCCTGCCATCATTGTTGTGCCAACTAGTGTAAAAGATGATGACCTTTCAAAAGTGGCAGCTTT
TCGAGCAAAAGGCAGAGTCCCTGTGTTGTCATGGATTCATCCGGAAAGTCAAGCAACGATTACCCGTTGCAGCCAGCCACTTGTGGGTCC
CAATGATAAGCGCTGCAAAGAGGATGAAAAATACTTGCAAACAATAATGGATGCTAACGCACAGTCACACAAGCTTATCATCTTTGATGC
TCGACAAAACAGTGTCGCTGATACCAACAAGACAAAGGGTGGAGGATATGAAAGTGAAAGTGCTTACCCAAATGCAGAACTTGTGTTCTT
GGAGATCCACAACATTCATGTCATGCGAGAGTCACTACGCAAATTAAAAGAGATTGTGTACCCTTCGATCGATGAGGCGCGGTGGCTCTC
CAATGTGGATGGGACGCATTGGCTGGAATATATAAGGATGCTGCTTGCTGGGGCAGTAAGAATTGCTGATAAAATAGAATCTGGGAAAAC
ATCTGTGGTGGTGCATTGCAGCGACGGTTGGGACCGAACAGCCCAGCTCACATCTCTGGCTATGCTAATGTTGGACAGTTACTACAGGAC
CATTAAAGGATTTGAAACTCTCGTAGAAAAGGAGTGGATAAGCTTTGGACACAGGTTTGCACTGCGAGTGGGCCATGGTAATGACAACCA
TGCGGATGCTGACCGATCTCCCATATTTCTGCAGTTTGTTGATTGTGTTTGGCAAATGACAAGGCAGTTTCCTTCAGCATTCGAGTTTAA
TGAGCTATTCTTGATTACAATTTTGGATCACCTTTATAGCTGTCTTTTTGGGACCTTTTTGTGCAACTGTGAACAGCAGCGATTCAAAGA
GGATGTATATACAAAGACGATATCTTTATGGTCGTATATCAATAGCCAGCTAGACGAGTTTTCTAATCCCTTCTTTGTGAATTATGAAAA
CCACGTGTTATATCCTGTTGCTAGTCTGAGTCATTTGGAATTGTGGGTAAATTATTATGTACGATGGAATCCACGGATGAGACCTCAGGT
CTCCAAAAAGTACAGCGAGATTGAGGAGTTTTACCAGAAACTGAGCAGTCGTTATGCAGCAGCCAGCCTCCCCCCACTACCCAGGAAGGT
CCTGTTTGTTGGGGAGTCTGACATCCGGGAGAGGAGAGCCGTGTTCAATGAGATCCTGCGCTGTGTCTCCAAGGATGCCGAGTTGGCAGG
CAGCCCAGAGCTGCTAGAGTTCTTAGGTACCAGATCCCCAGGGGCTGCAGGGCTCACCAGCAGAGATTCCTCTGTCCTGGATGGCACAGA
CAGTCAGACAGGGAATGATGAAGAGGCTTTCGACTTTTTTGAGGAGCAAGACCAAGTGGCAGAAGAGGGTCCGCCCGTCCAGAGCCTGAA
GGGCGAGGATGCTGAGGAATCCTTGGAGGAGGAGGAGGCGCTGGACCCTCTGGGCATTATGCGGTTGGTCTCCTGTTGTTGAGAGGGCCC
CTTTGGTGTATTCCAGGCTTTCTGGAGATGACGTCCCCCTTCCCTGGAATCTGAGAAAAGCCCTGAGCATCCCAGGTCGCCCCCTCGCAG
GGATCTGGGCCACGAGGCCTTGGCCTGGTGTGTTGGGGGAAGTAGCTCTCTGCGTGCCCTTGGTGGTGTGCATGTCTCTGGGACTGGGCT
TAGGTGTCGCCTCCCTTCTCGGGTCACAGGATGTCCTCCACTTGTGGCTCCGCACTGGGGCTTGGTAGAGTCCTCCGTGACAGCTCAGTA
GTGCAGGCTGCGGGCCTGTCCGGCTAGTGTGGGAGGACTGGGTGCTCCTTCCAGCTGTGGGACTCGCAGAGGTGGCTGCGGCTCTCTGGG
CTGCATCATCTGCATAGCAGGAGCATTCACCTTGGCCCTGCCTCCACACAGGGCCATTCACCAGCCATACATCTCTGGCCATTTACAATC
TCTTTTCTTCGGTTTTCCTCAGTGAAAATGGACTCATGGTCGTATCAACCTCTTAGGGCTCCTGTGACGATGAACTGAGTTATGTAAATT
TAGCAATCAGCTACCATCATGGCCCCATCTTTCAGTGGAATCAGACCAGGCCAGGGGTGCTGTCCTCCCCGCTCTCTACCACAACGAATG
TCTCTTAGCCGTTTACCAAAGCCCTCGGGCGCCAGATGAGTGTAGGTCCTGCCGCAGAAAGGAATTAGAGCCCAGTAGAAATTAGGCAGA
AGCAAGTTCAACTTCATCAGCATGTAGAATTCTCTCCTAAAATCACAGCCCACTCTGGAAAGGCCTTCTTCGTGGGGAGGGTTATGGGAG
GGTGGGCTGCAGGGTGGCCATGAGACCAGCGTCCAGGGGTGAGGATTTGCACTGGGAAAGGGTACGCGGCGCTCAGGGAGCTGCAGCAGA
AACAGGCCTGAGATCTGGGGTCCTGCGGCACCTGGGCACAGCAAGTGCCCTGCAGTCGCTCCTCCTGGCCCTCCGTGGCTGGCCTTGTCC
CTGAGTGGGGTCAGCGGCCCTGAGGGAGAGGCAGCCAGAGTAGTGGGTGATATGGGGACAAGCCTGTAATAGTCACTCCTTATCAGCCTG
GCCCAACGCGGCAGGCCTTTCTTGGGCTTTATTTTGGTAAGGGTGAGGCTTTGTTTGAACTCACATTCTCTGTTGTTCTGAGTAACCACA
CGTAGTGCCAAACCGAGATGGACTTTGGTGGTCTGTGCCAACCTTTGGCTGAAGAACACACTTAGCCGAGCGGCTCCTTTTTTGGGTAGG
AAAATGTTCTTTGTGGCTGGCAAGTGCTGCCTTGAACTTCCTACTTACTTCATTAGCAGATTGTCAGGGGAGATGTGTCAGCTATCCTGG
GACCCCTTGGCGGGGCGGGGGGGGCGGGGGCAGCCCCCTCCCCAGCTCTGTACTCTGGGGCCCTCACCCCTGAATCCTGGGAAAGCTTAG
CACCTAAGAGTAATCCTGCCGGCTTAAGACCCTCCCCTGCTGGGGTTTCTTTTTAAGGACCCGTGTGACAAGGTGCTGATGAATCAACGT
TATCACCTCTGTCAGGAATAATAAGTAAATTTTTTGAGAGTTTATGAAATGCTGGGAACTAAGTTAGCATTTGCTTGCATGATCTCATTA
TATCTGTAAGACAGCATTTCTGAAACTACTTGCTACAACCCATAGTAAAAACTATATGGTACGCCATGACCCAGGACACACATGTATAAA
CATCCCATAAAACTGAAGCAAAAGTTCCCAGAACTCATACAAAACCTTACTAAGTGTATTGTACTGGGATATTTTCTATTCTATTTCAAC
GTTTGGAAAGGTCATGACTCGCCAAACTGCTTTCAGGATCCACTGTGGGCACAGGTCAAGAAACGGAGCCCTGGAGGCCTGCACTGGCAT
CAGCCTCTTCTGTGTGGTGGGAAACTCAAGTTCAGGGTCAGGTGGTTCGTCCACGTTCCTGCAGCCTGCAGATGGCAGAGCCAGGACCCC
ACGCCATCTCCAGTCCAGTCTTTATCAGCCTGGGAGGTGGGCAGGGCCCCAGGATTATCCCCCTTTCACAGATGGTAAAATCGAGGAAGG
AGTTGAGCAGGATCTTGGCCAGAGCCGTGTGTGTTCCAGAGCTGTGTGTGTGGCAGAGCCGTACCTTGAAGTTGGGTTTCCACCTCGGCC
TTTCACAGACACCCAGGTGGGCTTGTTGATCTCTCTTGGTGCCACCCACCTGCCCTTTGGTGGGGGACTTTCTGTTCTTCTCGGGAGGCT
GTTTGTGCACCCCTCTCCCTCCCGTGCGCTTGGTTCCTGTGCAGATGCAGCGGCACCCGTTTCCCAGCTTGCCCTGCCCCATGTCTGGGC
TTAGCTCTGGGCTCTCCTGGAGCGGCCACCATTTCCATGCAACCAGCCTCGGTCCTTCCCCGCCGTGGCCGCGGCGAGGCGCTGCTGCTC
TGCTGAAGGGCTGCTCCACGGCAGGGCTGCTGGGAGGGTGGGAGTCGCCAGCACAAAGCCGGAGCCCAGGCCGGCCTGGCTTTTCTTTGT
CTTTTAAACCTGGTTTTGATTAGGGACAAGAGAGCGTTATTACACCATTAGAGAGCAATTAAAGATAGAAAAAGCCCTCACCTCGGCCCA
TCCCAACACCACCGCTCTCTCCATCTGCTGGGGCTCTCTTCTGACCCCGTCCCAGCAGCATCCATGCAACCGCAGGCACAATGCACGTGC
CTTTTCGTACTCTGCTTTTCCACCCTATGGTCTGTCCCGATTGCTGCTCCATGTCGCCCCTGTTTTGTATTTAAGTTTCTATTTTAGAAT
GTCACGGTGCTGAGAAAATTGACATTCTACCCTAATAGTTCTGCCTTATGCTGGAAATCCTCTGCGGGAAACCTTTTTCATTGTGACTCA
AATAACACACAATTAGTATAGAAAAATTGCAAACACAGATAAAAGTCCTTTCCCTGTGAATTTCTGAATGCACCTTTGAATATTCACATC
TTACTGCCAAAATGAGATTGTCTTGTGTGCCGTTCTGGAATTTGCTTTTTTCCAGCTTACATGTTCTAGGTCCTTCCAGATCAATAGCTG
CACTCTCCCTCCTTCCTCTGCTGGTTTCTCAGCTCGATGGGCTGTAAGTGGCATTACCAGGCCCTTGCTTGTGGGCGTGGCGGGGTTTTC
TGTAGGTTTTTGCTATTACAGGCAATAACCTGAGGAACTTCTACATATACAAAGCTTTTATTCTATGGAGCCTTCCCCTATATACGTGCC
CCAGAGCAAGGTCCCTGAAGCTGCTTCTGGGGGCTTTGGGGTACCATTCCAGTAAAAGGTTCTCTAAGGGCTGAAGCCCCTCTGTTGGGA
GGCCCCTCTGCTTTTCTAAGCCCTGCCCACCCCCGCCCTCAGGGCCCACTCCTCCCACCTCTTCTTTTGCACACAGGGACCCCCTCCAGG
CCCTGGGTCCCTGAGGACTCACAGCGTCCTTGGGACAGGCTGGCTCCTGTATGAACAAATGCACCTGCCTGCAAAGCTGGTCTTCCCAGA
CTCCCTGGAAGGGGGAGCCCACACCCGGGTCCCCGTGCTGTGGCCTCCGTGGTGAAGCTGGATGTTTCTCTGGAATGCCACGTTTTATGG
TTGTTTTTTAATATGGATTTTGCTTCATCTTTCATAAAACAACCACATGTATTTTAGTATAAAAATAATATCTTACTCTATATTTGGATG


Top

FusionGenePPI for MTMR1_HS1BP3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MTMR1AURKB, CEP250, TUBGCP3, EFNB2, SKAP1, TRIM10, PSMC2, FBXW11, FOS, SLC4A1AP, MTMR2, SBF1, SBF2, GMNN, RPGR, LIPC, RAB6B, HAVCR2, PIP4K2A, SELE, LRRC4C, TMEM52B, ERBB3, ROR2, PTK7HS1BP3VCP, ZDHHC17, TMED3, RWDD2B, NAA38, CEP170, ABTB2, PDXDC1, RAD50, ANTXR2, TCP10L


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MTMR1_HS1BP3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MTMR1_HS1BP3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource