FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 22777

FusionGeneSummary for MTM1_VBP1

check button Fusion gene summary
Fusion gene informationFusion gene name: MTM1_VBP1
Fusion gene ID: 22777
HgeneTgene
Gene symbol

MTM1

VBP1

Gene ID

4534

7411

Gene namemyotubularin 1VHL binding protein 1
SynonymsCNM|MTMX|XLMTMHIBBJ46|PFD3|PFDN3|VBP-1
Cytomap

Xq28

Xq28

Type of geneprotein-codingprotein-coding
Descriptionmyotubularinphosphatidylinositol-3,5-bisphosphate 3-phosphatasephosphatidylinositol-3-phosphate phosphataseprefoldin subunit 3von Hippel-Lindau binding protein 1
Modification date2018051920180523
UniProtAcc

Q13496

P61758

Ensembl transtripts involved in fusion geneENST00000370396, ENST00000542741, 
ENST00000543350, ENST00000306167, 
ENST00000413012, 
ENST00000535916, 
ENST00000286428, ENST00000459836, 
Fusion gene scores* DoF score3 X 3 X 2=184 X 4 X 4=64
# samples 34
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MTM1 [Title/Abstract] AND VBP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMTM1

GO:0006470

protein dephosphorylation

9537414

HgeneMTM1

GO:0008333

endosome to lysosome transport

14722070

HgeneMTM1

GO:0044088

regulation of vacuole organization

14722070

HgeneMTM1

GO:0046856

phosphatidylinositol dephosphorylation

10900271|12646134

HgeneMTM1

GO:0070584

mitochondrion morphogenesis

21135508


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-55-6712-01AMTM1chrX

149787612

+VBP1chrX

154448460

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000370396ENST00000535916MTM1chrX

149787612

+VBP1chrX

154448460

+
In-frameENST00000370396ENST00000286428MTM1chrX

149787612

+VBP1chrX

154448460

+
5CDS-intronENST00000370396ENST00000459836MTM1chrX

149787612

+VBP1chrX

154448460

+
In-frameENST00000542741ENST00000535916MTM1chrX

149787612

+VBP1chrX

154448460

+
In-frameENST00000542741ENST00000286428MTM1chrX

149787612

+VBP1chrX

154448460

+
5CDS-intronENST00000542741ENST00000459836MTM1chrX

149787612

+VBP1chrX

154448460

+
In-frameENST00000543350ENST00000535916MTM1chrX

149787612

+VBP1chrX

154448460

+
In-frameENST00000543350ENST00000286428MTM1chrX

149787612

+VBP1chrX

154448460

+
5CDS-intronENST00000543350ENST00000459836MTM1chrX

149787612

+VBP1chrX

154448460

+
3UTR-3CDSENST00000306167ENST00000535916MTM1chrX

149787612

+VBP1chrX

154448460

+
3UTR-3CDSENST00000306167ENST00000286428MTM1chrX

149787612

+VBP1chrX

154448460

+
3UTR-intronENST00000306167ENST00000459836MTM1chrX

149787612

+VBP1chrX

154448460

+
In-frameENST00000413012ENST00000535916MTM1chrX

149787612

+VBP1chrX

154448460

+
In-frameENST00000413012ENST00000286428MTM1chrX

149787612

+VBP1chrX

154448460

+
5CDS-intronENST00000413012ENST00000459836MTM1chrX

149787612

+VBP1chrX

154448460

+

Top

FusionProtFeatures for MTM1_VBP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MTM1

Q13496

VBP1

P61758

Lipid phosphatase which dephosphorylatesphosphatidylinositol 3-monophosphate (PI3P) andphosphatidylinositol 3,5-bisphosphate (PI(3,5)P2). Has also beenshown to dephosphorylate phosphotyrosine- and phosphoserine-containing peptides. Negatively regulates EGFR degradation throughregulation of EGFR trafficking from the late endosome to thelysosome. Plays a role in vacuolar formation and morphology.Regulates desmin intermediate filament assembly and architecture.Plays a role in mitochondrial morphology and positioning. Requiredfor skeletal muscle maintenance but not for myogenesis.{ECO:0000269|PubMed:10900271, ECO:0000269|PubMed:11001925,ECO:0000269|PubMed:12646134, ECO:0000269|PubMed:14722070,ECO:0000269|PubMed:21135508, ECO:0000269|PubMed:9537414}. Binds specifically to cytosolic chaperonin (c-CPN) andtransfers target proteins to it. Binds to nascent polypeptidechain and promotes folding in an environment in which there aremany competing pathways for nonnative proteins.{ECO:0000269|PubMed:9630229}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMTM1chrX:149787612chrX:154448460ENST00000370396+61529_97148604DomainNote=GRAM

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMTM1chrX:149787612chrX:154448460ENST00000370396+615163_538148604DomainMyotubularin phosphatase


Top

FusionGeneSequence for MTM1_VBP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MTM1_ENST00000370396_chrX_149787612_+_VBP1_ENST00000535916_chrX_154448460_+_315aa
MASASTSKTNSHSLENESIKRTSRDGVNRDLTEAVPRLPGETLITDKEVIYICPFNGPIKGRVYITNTRLTLRSLETDSSLILDVPLGVI
SRIEKMGGATSRGENSTGLDITCKDMRNLRFALKQEGHSRRDMFEILTRYAFPLAHSLEDVDSFMKQPGNETADTVLKKLDEQYQKTKFM
ELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLTCKASVPPTDKMCLWLGANVMLETDIDEAQALLEKNLSTATK

>In-frame_MTM1_ENST00000370396_chrX_149787612_+_VBP1_ENST00000286428_chrX_154448460_+_315aa
MASASTSKTNSHSLENESIKRTSRDGVNRDLTEAVPRLPGETLITDKEVIYICPFNGPIKGRVYITNTRLTLRSLETDSSLILDVPLGVI
SRIEKMGGATSRGENSTGLDITCKDMRNLRFALKQEGHSRRDMFEILTRYAFPLAHSLEDVDSFMKQPGNETADTVLKKLDEQYQKTKFM
ELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLTCKASVPPTDKMCLWLGANVMLETDIDEAQALLEKNLSTATK

>In-frame_MTM1_ENST00000542741_chrX_149787612_+_VBP1_ENST00000535916_chrX_154448460_+_220aa
MGGATSRGENSTGLDITCKDMRNLRFALKQEGHSRRDMFEILTRYAFPLAHSLEDVDSFMKQPGNETADTVLKKLDEQYQKTKFMELNLA
QKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLTCKASVPPTDKMCLWLGANVMLETDIDEAQALLEKNLSTATKNLDSL

>In-frame_MTM1_ENST00000542741_chrX_149787612_+_VBP1_ENST00000286428_chrX_154448460_+_220aa
MGGATSRGENSTGLDITCKDMRNLRFALKQEGHSRRDMFEILTRYAFPLAHSLEDVDSFMKQPGNETADTVLKKLDEQYQKTKFMELNLA
QKKRRLKGQIPEIKQTLEILKYMQKKKESTNSMETRFLLADNLTCKASVPPTDKMCLWLGANVMLETDIDEAQALLEKNLSTATKNLDSL

>In-frame_MTM1_ENST00000543350_chrX_149787612_+_VBP1_ENST00000535916_chrX_154448460_+_200aa
MRNLRFALKQEGHSRRDMFEILTRYAFPLAHSLEDVDSFMKQPGNETADTVLKKLDEQYQKTKFMELNLAQKKRRLKGQIPEIKQTLEIL
KYMQKKKESTNSMETRFLLADNLTCKASVPPTDKMCLWLGANVMLETDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMAR

>In-frame_MTM1_ENST00000543350_chrX_149787612_+_VBP1_ENST00000286428_chrX_154448460_+_200aa
MRNLRFALKQEGHSRRDMFEILTRYAFPLAHSLEDVDSFMKQPGNETADTVLKKLDEQYQKTKFMELNLAQKKRRLKGQIPEIKQTLEIL
KYMQKKKESTNSMETRFLLADNLTCKASVPPTDKMCLWLGANVMLETDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMAR

>In-frame_MTM1_ENST00000413012_chrX_149787612_+_VBP1_ENST00000535916_chrX_154448460_+_278aa
MASASTSKTNSHSLENESIKRTSRDGVNRDLTEAVPRLPGETLITDKEVIYICPFNGPIKGRVYITNTRLTLRSLETDMRNLRFALKQEG
HSRRDMFEILTRYAFPLAHSLEDVDSFMKQPGNETADTVLKKLDEQYQKTKFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNS
METRFLLADNLTCKASVPPTDKMCLWLGANVMLETDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVTNWDVKRRNKD

>In-frame_MTM1_ENST00000413012_chrX_149787612_+_VBP1_ENST00000286428_chrX_154448460_+_278aa
MASASTSKTNSHSLENESIKRTSRDGVNRDLTEAVPRLPGETLITDKEVIYICPFNGPIKGRVYITNTRLTLRSLETDMRNLRFALKQEG
HSRRDMFEILTRYAFPLAHSLEDVDSFMKQPGNETADTVLKKLDEQYQKTKFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNS
METRFLLADNLTCKASVPPTDKMCLWLGANVMLETDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVTNWDVKRRNKD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MTM1_ENST00000370396_chrX_149787612_+_VBP1_ENST00000535916_chrX_154448460_+_945nt
ATGGCTTCTGCATCAACTTCTAAATATAATTCACACTCCTTGGAGAATGAGTCTATTAAGAGGACGTCTCGAGATGGAGTCAATCGAGAT
CTCACTGAGGCTGTTCCTCGACTTCCAGGAGAAACACTAATCACTGACAAAGAAGTTATTTACATATGTCCTTTCAATGGCCCCATTAAG
GGAAGAGTTTACATCACAAATTATCGTCTTTATTTAAGAAGTTTGGAAACGGATTCTTCTCTAATACTTGATGTTCCTCTGGGTGTGATC
TCGAGAATTGAAAAAATGGGAGGCGCGACAAGTAGAGGAGAAAATTCCTATGGTCTAGATATTACTTGTAAAGACATGAGAAACCTGAGG
TTCGCTTTGAAACAGGAAGGCCACAGCAGAAGAGATATGTTTGAGATCCTCACGAGATACGCGTTTCCCCTGGCTCACAGTCTGGAAGAT
GTAGATTCCTTCATGAAACAGCCTGGGAATGAGACTGCAGATACAGTATTAAAGAAGCTGGATGAACAGTACCAGAAGTATAAGTTTATG
GAACTCAACCTTGCTCAAAAGAAAAGAAGGCTAAAAGGTCAGATTCCTGAAATTAAACAGACTTTGGAAATTCTAAAATACATGCAGAAG
AAAAAAGAGTCCACCAACTCAATGGAGACCAGATTCTTGCTGGCAGATAACCTGTATTGCAAAGCTTCAGTTCCTCCTACCGATAAAATG
TGTCTGTGGTTGGGGGCTAATGTAATGCTTGAATATGATATTGATGAAGCTCAGGCATTGTTGGAAAAGAATTTATCGACTGCCACAAAG
AATCTTGATTCCCTGGAGGAAGACCTTGACTTTCTTCGAGATCAATTTACTACCACAGAAGTCAATATGGCCAGGGTTTATAATTGGGAT

>In-frame_MTM1_ENST00000370396_chrX_149787612_+_VBP1_ENST00000286428_chrX_154448460_+_945nt
ATGGCTTCTGCATCAACTTCTAAATATAATTCACACTCCTTGGAGAATGAGTCTATTAAGAGGACGTCTCGAGATGGAGTCAATCGAGAT
CTCACTGAGGCTGTTCCTCGACTTCCAGGAGAAACACTAATCACTGACAAAGAAGTTATTTACATATGTCCTTTCAATGGCCCCATTAAG
GGAAGAGTTTACATCACAAATTATCGTCTTTATTTAAGAAGTTTGGAAACGGATTCTTCTCTAATACTTGATGTTCCTCTGGGTGTGATC
TCGAGAATTGAAAAAATGGGAGGCGCGACAAGTAGAGGAGAAAATTCCTATGGTCTAGATATTACTTGTAAAGACATGAGAAACCTGAGG
TTCGCTTTGAAACAGGAAGGCCACAGCAGAAGAGATATGTTTGAGATCCTCACGAGATACGCGTTTCCCCTGGCTCACAGTCTGGAAGAT
GTAGATTCCTTCATGAAACAGCCTGGGAATGAGACTGCAGATACAGTATTAAAGAAGCTGGATGAACAGTACCAGAAGTATAAGTTTATG
GAACTCAACCTTGCTCAAAAGAAAAGAAGGCTAAAAGGTCAGATTCCTGAAATTAAACAGACTTTGGAAATTCTAAAATACATGCAGAAG
AAAAAAGAGTCCACCAACTCAATGGAGACCAGATTCTTGCTGGCAGATAACCTGTATTGCAAAGCTTCAGTTCCTCCTACCGATAAAATG
TGTCTGTGGTTGGGGGCTAATGTAATGCTTGAATATGATATTGATGAAGCTCAGGCATTGTTGGAAAAGAATTTATCGACTGCCACAAAG
AATCTTGATTCCCTGGAGGAAGACCTTGACTTTCTTCGAGATCAATTTACTACCACAGAAGTCAATATGGCCAGGGTTTATAATTGGGAT

>In-frame_MTM1_ENST00000542741_chrX_149787612_+_VBP1_ENST00000535916_chrX_154448460_+_660nt
ATGGGAGGCGCGACAAGTAGAGGAGAAAATTCCTATGGTCTAGATATTACTTGTAAAGACATGAGAAACCTGAGGTTCGCTTTGAAACAG
GAAGGCCACAGCAGAAGAGATATGTTTGAGATCCTCACGAGATACGCGTTTCCCCTGGCTCACAGTCTGGAAGATGTAGATTCCTTCATG
AAACAGCCTGGGAATGAGACTGCAGATACAGTATTAAAGAAGCTGGATGAACAGTACCAGAAGTATAAGTTTATGGAACTCAACCTTGCT
CAAAAGAAAAGAAGGCTAAAAGGTCAGATTCCTGAAATTAAACAGACTTTGGAAATTCTAAAATACATGCAGAAGAAAAAAGAGTCCACC
AACTCAATGGAGACCAGATTCTTGCTGGCAGATAACCTGTATTGCAAAGCTTCAGTTCCTCCTACCGATAAAATGTGTCTGTGGTTGGGG
GCTAATGTAATGCTTGAATATGATATTGATGAAGCTCAGGCATTGTTGGAAAAGAATTTATCGACTGCCACAAAGAATCTTGATTCCCTG
GAGGAAGACCTTGACTTTCTTCGAGATCAATTTACTACCACAGAAGTCAATATGGCCAGGGTTTATAATTGGGATGTAAAAAGAAGAAAC

>In-frame_MTM1_ENST00000542741_chrX_149787612_+_VBP1_ENST00000286428_chrX_154448460_+_660nt
ATGGGAGGCGCGACAAGTAGAGGAGAAAATTCCTATGGTCTAGATATTACTTGTAAAGACATGAGAAACCTGAGGTTCGCTTTGAAACAG
GAAGGCCACAGCAGAAGAGATATGTTTGAGATCCTCACGAGATACGCGTTTCCCCTGGCTCACAGTCTGGAAGATGTAGATTCCTTCATG
AAACAGCCTGGGAATGAGACTGCAGATACAGTATTAAAGAAGCTGGATGAACAGTACCAGAAGTATAAGTTTATGGAACTCAACCTTGCT
CAAAAGAAAAGAAGGCTAAAAGGTCAGATTCCTGAAATTAAACAGACTTTGGAAATTCTAAAATACATGCAGAAGAAAAAAGAGTCCACC
AACTCAATGGAGACCAGATTCTTGCTGGCAGATAACCTGTATTGCAAAGCTTCAGTTCCTCCTACCGATAAAATGTGTCTGTGGTTGGGG
GCTAATGTAATGCTTGAATATGATATTGATGAAGCTCAGGCATTGTTGGAAAAGAATTTATCGACTGCCACAAAGAATCTTGATTCCCTG
GAGGAAGACCTTGACTTTCTTCGAGATCAATTTACTACCACAGAAGTCAATATGGCCAGGGTTTATAATTGGGATGTAAAAAGAAGAAAC

>In-frame_MTM1_ENST00000543350_chrX_149787612_+_VBP1_ENST00000535916_chrX_154448460_+_600nt
ATGAGAAACCTGAGGTTCGCTTTGAAACAGGAAGGCCACAGCAGAAGAGATATGTTTGAGATCCTCACGAGATACGCGTTTCCCCTGGCT
CACAGTCTGGAAGATGTAGATTCCTTCATGAAACAGCCTGGGAATGAGACTGCAGATACAGTATTAAAGAAGCTGGATGAACAGTACCAG
AAGTATAAGTTTATGGAACTCAACCTTGCTCAAAAGAAAAGAAGGCTAAAAGGTCAGATTCCTGAAATTAAACAGACTTTGGAAATTCTA
AAATACATGCAGAAGAAAAAAGAGTCCACCAACTCAATGGAGACCAGATTCTTGCTGGCAGATAACCTGTATTGCAAAGCTTCAGTTCCT
CCTACCGATAAAATGTGTCTGTGGTTGGGGGCTAATGTAATGCTTGAATATGATATTGATGAAGCTCAGGCATTGTTGGAAAAGAATTTA
TCGACTGCCACAAAGAATCTTGATTCCCTGGAGGAAGACCTTGACTTTCTTCGAGATCAATTTACTACCACAGAAGTCAATATGGCCAGG

>In-frame_MTM1_ENST00000543350_chrX_149787612_+_VBP1_ENST00000286428_chrX_154448460_+_600nt
ATGAGAAACCTGAGGTTCGCTTTGAAACAGGAAGGCCACAGCAGAAGAGATATGTTTGAGATCCTCACGAGATACGCGTTTCCCCTGGCT
CACAGTCTGGAAGATGTAGATTCCTTCATGAAACAGCCTGGGAATGAGACTGCAGATACAGTATTAAAGAAGCTGGATGAACAGTACCAG
AAGTATAAGTTTATGGAACTCAACCTTGCTCAAAAGAAAAGAAGGCTAAAAGGTCAGATTCCTGAAATTAAACAGACTTTGGAAATTCTA
AAATACATGCAGAAGAAAAAAGAGTCCACCAACTCAATGGAGACCAGATTCTTGCTGGCAGATAACCTGTATTGCAAAGCTTCAGTTCCT
CCTACCGATAAAATGTGTCTGTGGTTGGGGGCTAATGTAATGCTTGAATATGATATTGATGAAGCTCAGGCATTGTTGGAAAAGAATTTA
TCGACTGCCACAAAGAATCTTGATTCCCTGGAGGAAGACCTTGACTTTCTTCGAGATCAATTTACTACCACAGAAGTCAATATGGCCAGG

>In-frame_MTM1_ENST00000413012_chrX_149787612_+_VBP1_ENST00000535916_chrX_154448460_+_834nt
ATGGCTTCTGCATCAACTTCTAAATATAATTCACACTCCTTGGAGAATGAGTCTATTAAGAGGACGTCTCGAGATGGAGTCAATCGAGAT
CTCACTGAGGCTGTTCCTCGACTTCCAGGAGAAACACTAATCACTGACAAAGAAGTTATTTACATATGTCCTTTCAATGGCCCCATTAAG
GGAAGAGTTTACATCACAAATTATCGTCTTTATTTAAGAAGTTTGGAAACGGACATGAGAAACCTGAGGTTCGCTTTGAAACAGGAAGGC
CACAGCAGAAGAGATATGTTTGAGATCCTCACGAGATACGCGTTTCCCCTGGCTCACAGTCTGGAAGATGTAGATTCCTTCATGAAACAG
CCTGGGAATGAGACTGCAGATACAGTATTAAAGAAGCTGGATGAACAGTACCAGAAGTATAAGTTTATGGAACTCAACCTTGCTCAAAAG
AAAAGAAGGCTAAAAGGTCAGATTCCTGAAATTAAACAGACTTTGGAAATTCTAAAATACATGCAGAAGAAAAAAGAGTCCACCAACTCA
ATGGAGACCAGATTCTTGCTGGCAGATAACCTGTATTGCAAAGCTTCAGTTCCTCCTACCGATAAAATGTGTCTGTGGTTGGGGGCTAAT
GTAATGCTTGAATATGATATTGATGAAGCTCAGGCATTGTTGGAAAAGAATTTATCGACTGCCACAAAGAATCTTGATTCCCTGGAGGAA
GACCTTGACTTTCTTCGAGATCAATTTACTACCACAGAAGTCAATATGGCCAGGGTTTATAATTGGGATGTAAAAAGAAGAAACAAGGAT

>In-frame_MTM1_ENST00000413012_chrX_149787612_+_VBP1_ENST00000286428_chrX_154448460_+_834nt
ATGGCTTCTGCATCAACTTCTAAATATAATTCACACTCCTTGGAGAATGAGTCTATTAAGAGGACGTCTCGAGATGGAGTCAATCGAGAT
CTCACTGAGGCTGTTCCTCGACTTCCAGGAGAAACACTAATCACTGACAAAGAAGTTATTTACATATGTCCTTTCAATGGCCCCATTAAG
GGAAGAGTTTACATCACAAATTATCGTCTTTATTTAAGAAGTTTGGAAACGGACATGAGAAACCTGAGGTTCGCTTTGAAACAGGAAGGC
CACAGCAGAAGAGATATGTTTGAGATCCTCACGAGATACGCGTTTCCCCTGGCTCACAGTCTGGAAGATGTAGATTCCTTCATGAAACAG
CCTGGGAATGAGACTGCAGATACAGTATTAAAGAAGCTGGATGAACAGTACCAGAAGTATAAGTTTATGGAACTCAACCTTGCTCAAAAG
AAAAGAAGGCTAAAAGGTCAGATTCCTGAAATTAAACAGACTTTGGAAATTCTAAAATACATGCAGAAGAAAAAAGAGTCCACCAACTCA
ATGGAGACCAGATTCTTGCTGGCAGATAACCTGTATTGCAAAGCTTCAGTTCCTCCTACCGATAAAATGTGTCTGTGGTTGGGGGCTAAT
GTAATGCTTGAATATGATATTGATGAAGCTCAGGCATTGTTGGAAAAGAATTTATCGACTGCCACAAAGAATCTTGATTCCCTGGAGGAA
GACCTTGACTTTCTTCGAGATCAATTTACTACCACAGAAGTCAATATGGCCAGGGTTTATAATTGGGATGTAAAAAGAAGAAACAAGGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_MTM1_ENST00000370396_chrX_149787612_+_VBP1_ENST00000535916_chrX_154448460_+_1201nt
GCAGCCGAGCAGCCTGGCAACGGCGGTGGCGCCCGGAGCCCGAGAGTTTCCAGGATGGCTTCTGCATCAACTTCTAAATATAATTCACAC
TCCTTGGAGAATGAGTCTATTAAGAGGACGTCTCGAGATGGAGTCAATCGAGATCTCACTGAGGCTGTTCCTCGACTTCCAGGAGAAACA
CTAATCACTGACAAAGAAGTTATTTACATATGTCCTTTCAATGGCCCCATTAAGGGAAGAGTTTACATCACAAATTATCGTCTTTATTTA
AGAAGTTTGGAAACGGATTCTTCTCTAATACTTGATGTTCCTCTGGGTGTGATCTCGAGAATTGAAAAAATGGGAGGCGCGACAAGTAGA
GGAGAAAATTCCTATGGTCTAGATATTACTTGTAAAGACATGAGAAACCTGAGGTTCGCTTTGAAACAGGAAGGCCACAGCAGAAGAGAT
ATGTTTGAGATCCTCACGAGATACGCGTTTCCCCTGGCTCACAGTCTGGAAGATGTAGATTCCTTCATGAAACAGCCTGGGAATGAGACT
GCAGATACAGTATTAAAGAAGCTGGATGAACAGTACCAGAAGTATAAGTTTATGGAACTCAACCTTGCTCAAAAGAAAAGAAGGCTAAAA
GGTCAGATTCCTGAAATTAAACAGACTTTGGAAATTCTAAAATACATGCAGAAGAAAAAAGAGTCCACCAACTCAATGGAGACCAGATTC
TTGCTGGCAGATAACCTGTATTGCAAAGCTTCAGTTCCTCCTACCGATAAAATGTGTCTGTGGTTGGGGGCTAATGTAATGCTTGAATAT
GATATTGATGAAGCTCAGGCATTGTTGGAAAAGAATTTATCGACTGCCACAAAGAATCTTGATTCCCTGGAGGAAGACCTTGACTTTCTT
CGAGATCAATTTACTACCACAGAAGTCAATATGGCCAGGGTTTATAATTGGGATGTAAAAAGAAGAAACAAGGATGACTCTACCAAGAAC
AAAGCATAATGCTGGCAATTAAAAATGTGGTTTAGTTTTCCAAACATGTTATCTTAAATACCCCTTTATCCTTACAGGTTGACATAACTT
TGAATGTTTTAACAGCAAGAATTTTAAGAAAAGATAAACACCATTTTATTTATTTATAAAAACAAAATTAGTTTCAAATATTTTTGACAT

>In-frame_MTM1_ENST00000370396_chrX_149787612_+_VBP1_ENST00000286428_chrX_154448460_+_1974nt
GCAGCCGAGCAGCCTGGCAACGGCGGTGGCGCCCGGAGCCCGAGAGTTTCCAGGATGGCTTCTGCATCAACTTCTAAATATAATTCACAC
TCCTTGGAGAATGAGTCTATTAAGAGGACGTCTCGAGATGGAGTCAATCGAGATCTCACTGAGGCTGTTCCTCGACTTCCAGGAGAAACA
CTAATCACTGACAAAGAAGTTATTTACATATGTCCTTTCAATGGCCCCATTAAGGGAAGAGTTTACATCACAAATTATCGTCTTTATTTA
AGAAGTTTGGAAACGGATTCTTCTCTAATACTTGATGTTCCTCTGGGTGTGATCTCGAGAATTGAAAAAATGGGAGGCGCGACAAGTAGA
GGAGAAAATTCCTATGGTCTAGATATTACTTGTAAAGACATGAGAAACCTGAGGTTCGCTTTGAAACAGGAAGGCCACAGCAGAAGAGAT
ATGTTTGAGATCCTCACGAGATACGCGTTTCCCCTGGCTCACAGTCTGGAAGATGTAGATTCCTTCATGAAACAGCCTGGGAATGAGACT
GCAGATACAGTATTAAAGAAGCTGGATGAACAGTACCAGAAGTATAAGTTTATGGAACTCAACCTTGCTCAAAAGAAAAGAAGGCTAAAA
GGTCAGATTCCTGAAATTAAACAGACTTTGGAAATTCTAAAATACATGCAGAAGAAAAAAGAGTCCACCAACTCAATGGAGACCAGATTC
TTGCTGGCAGATAACCTGTATTGCAAAGCTTCAGTTCCTCCTACCGATAAAATGTGTCTGTGGTTGGGGGCTAATGTAATGCTTGAATAT
GATATTGATGAAGCTCAGGCATTGTTGGAAAAGAATTTATCGACTGCCACAAAGAATCTTGATTCCCTGGAGGAAGACCTTGACTTTCTT
CGAGATCAATTTACTACCACAGAAGTCAATATGGCCAGGGTTTATAATTGGGATGTAAAAAGAAGAAACAAGGATGACTCTACCAAGAAC
AAAGCATAATGCTGGCAATTAAAAATGTGGTTTAGTTTTCCAAACATGTTATCTTAAATACCCCTTTATCCTTACAGGTTGACATAACTT
TGAATGTTTTAACAGCAAGAATTTTAAGAAAAGATAAACACCATTTTATTTATTTATAAAAACAAAATTAGTTTCAAATATTTTTGACAT
TGTGATTTTTTTTTCCACATTTCTCAGCAAAGCTAATGGTATTTTAATCATTATTTTTGCCTGTCATAAGAAAACTCTTAGCTGAAATGG
CCGAAAACTGTGAGACATGCTATGGAAGCTGAATGCCGGACGCTAGCACAGTTTACTTTTTCCCTTTCTAATCGGCTGATGTTACTCTCA
CTTGATGTGGTTAAACCATTTTAGAGGTAGAGAAGACAGACAGTTTGAATATTTGTAAACTTGTTTTTCTTTGGTATATTTAGGACTTAG
TGGTCCTCTGTTGCTATTGTCTTCTATAAGTGGAGTTTCATGACTTACTGCTTAACGAATAACTAACTACTATGATATTCTGGACATTTT
AGGAAATGGTAATTTGCCTTGCTACACATTAAGAGGGCTATTAAGACTACATTTTTTCTAACCTCAGATAAGTGCAGTGTCTTTGCAATG
CCAACATAAGGGAGATCTTGGCCAACGTGAAATAAAATTACTCATTCAAAACTCTGCCTAAGGTGATTTTGTAGTTCTTAACAGTTCTCC
AGAGCATCTTGAACAGGAATATTAAGATAAATGTGAATCTGCAATGGCTGAAAAGAGTTGTGAGCTTTTTTATTCATGATAAAACCTTAT
AGGAATAGTATAAAAAATCCCTGTGGAAAGCTACTAGTACATTGACCAGCGCTGGGTGATACAGATTCTGATAAAAACATAAATGTATTA

>In-frame_MTM1_ENST00000542741_chrX_149787612_+_VBP1_ENST00000535916_chrX_154448460_+_1104nt
AGCCGAGCAGCCTGGCAACGGCGGTGGCGCCCGGAGCCCGAGAGTTTCCAGGATGGCTTCTGCATCAACTTCTAAATATAATTCACACTC
CTTGGAGAATGAGTCTATTAAGAGGACGTCTCGAGATGGAGTCAATCGAGATCTCACTGAGGCTGTTCCTCGACTTCCAGGAGAAACACT
AATCACTGGATTCTTCTCTAATACTTGATGTTCCTCTGGGTGTGATCTCGAGAATTGAAAAAATGGGAGGCGCGACAAGTAGAGGAGAAA
ATTCCTATGGTCTAGATATTACTTGTAAAGACATGAGAAACCTGAGGTTCGCTTTGAAACAGGAAGGCCACAGCAGAAGAGATATGTTTG
AGATCCTCACGAGATACGCGTTTCCCCTGGCTCACAGTCTGGAAGATGTAGATTCCTTCATGAAACAGCCTGGGAATGAGACTGCAGATA
CAGTATTAAAGAAGCTGGATGAACAGTACCAGAAGTATAAGTTTATGGAACTCAACCTTGCTCAAAAGAAAAGAAGGCTAAAAGGTCAGA
TTCCTGAAATTAAACAGACTTTGGAAATTCTAAAATACATGCAGAAGAAAAAAGAGTCCACCAACTCAATGGAGACCAGATTCTTGCTGG
CAGATAACCTGTATTGCAAAGCTTCAGTTCCTCCTACCGATAAAATGTGTCTGTGGTTGGGGGCTAATGTAATGCTTGAATATGATATTG
ATGAAGCTCAGGCATTGTTGGAAAAGAATTTATCGACTGCCACAAAGAATCTTGATTCCCTGGAGGAAGACCTTGACTTTCTTCGAGATC
AATTTACTACCACAGAAGTCAATATGGCCAGGGTTTATAATTGGGATGTAAAAAGAAGAAACAAGGATGACTCTACCAAGAACAAAGCAT
AATGCTGGCAATTAAAAATGTGGTTTAGTTTTCCAAACATGTTATCTTAAATACCCCTTTATCCTTACAGGTTGACATAACTTTGAATGT
TTTAACAGCAAGAATTTTAAGAAAAGATAAACACCATTTTATTTATTTATAAAAACAAAATTAGTTTCAAATATTTTTGACATTGTGATT

>In-frame_MTM1_ENST00000542741_chrX_149787612_+_VBP1_ENST00000286428_chrX_154448460_+_1877nt
AGCCGAGCAGCCTGGCAACGGCGGTGGCGCCCGGAGCCCGAGAGTTTCCAGGATGGCTTCTGCATCAACTTCTAAATATAATTCACACTC
CTTGGAGAATGAGTCTATTAAGAGGACGTCTCGAGATGGAGTCAATCGAGATCTCACTGAGGCTGTTCCTCGACTTCCAGGAGAAACACT
AATCACTGGATTCTTCTCTAATACTTGATGTTCCTCTGGGTGTGATCTCGAGAATTGAAAAAATGGGAGGCGCGACAAGTAGAGGAGAAA
ATTCCTATGGTCTAGATATTACTTGTAAAGACATGAGAAACCTGAGGTTCGCTTTGAAACAGGAAGGCCACAGCAGAAGAGATATGTTTG
AGATCCTCACGAGATACGCGTTTCCCCTGGCTCACAGTCTGGAAGATGTAGATTCCTTCATGAAACAGCCTGGGAATGAGACTGCAGATA
CAGTATTAAAGAAGCTGGATGAACAGTACCAGAAGTATAAGTTTATGGAACTCAACCTTGCTCAAAAGAAAAGAAGGCTAAAAGGTCAGA
TTCCTGAAATTAAACAGACTTTGGAAATTCTAAAATACATGCAGAAGAAAAAAGAGTCCACCAACTCAATGGAGACCAGATTCTTGCTGG
CAGATAACCTGTATTGCAAAGCTTCAGTTCCTCCTACCGATAAAATGTGTCTGTGGTTGGGGGCTAATGTAATGCTTGAATATGATATTG
ATGAAGCTCAGGCATTGTTGGAAAAGAATTTATCGACTGCCACAAAGAATCTTGATTCCCTGGAGGAAGACCTTGACTTTCTTCGAGATC
AATTTACTACCACAGAAGTCAATATGGCCAGGGTTTATAATTGGGATGTAAAAAGAAGAAACAAGGATGACTCTACCAAGAACAAAGCAT
AATGCTGGCAATTAAAAATGTGGTTTAGTTTTCCAAACATGTTATCTTAAATACCCCTTTATCCTTACAGGTTGACATAACTTTGAATGT
TTTAACAGCAAGAATTTTAAGAAAAGATAAACACCATTTTATTTATTTATAAAAACAAAATTAGTTTCAAATATTTTTGACATTGTGATT
TTTTTTTCCACATTTCTCAGCAAAGCTAATGGTATTTTAATCATTATTTTTGCCTGTCATAAGAAAACTCTTAGCTGAAATGGCCGAAAA
CTGTGAGACATGCTATGGAAGCTGAATGCCGGACGCTAGCACAGTTTACTTTTTCCCTTTCTAATCGGCTGATGTTACTCTCACTTGATG
TGGTTAAACCATTTTAGAGGTAGAGAAGACAGACAGTTTGAATATTTGTAAACTTGTTTTTCTTTGGTATATTTAGGACTTAGTGGTCCT
CTGTTGCTATTGTCTTCTATAAGTGGAGTTTCATGACTTACTGCTTAACGAATAACTAACTACTATGATATTCTGGACATTTTAGGAAAT
GGTAATTTGCCTTGCTACACATTAAGAGGGCTATTAAGACTACATTTTTTCTAACCTCAGATAAGTGCAGTGTCTTTGCAATGCCAACAT
AAGGGAGATCTTGGCCAACGTGAAATAAAATTACTCATTCAAAACTCTGCCTAAGGTGATTTTGTAGTTCTTAACAGTTCTCCAGAGCAT
CTTGAACAGGAATATTAAGATAAATGTGAATCTGCAATGGCTGAAAAGAGTTGTGAGCTTTTTTATTCATGATAAAACCTTATAGGAATA
GTATAAAAAATCCCTGTGGAAAGCTACTAGTACATTGACCAGCGCTGGGTGATACAGATTCTGATAAAAACATAAATGTATTAGTTCATC

>In-frame_MTM1_ENST00000543350_chrX_149787612_+_VBP1_ENST00000535916_chrX_154448460_+_993nt
AGCCGAGCAGCCTGGCAACGGCGGTGGCGCCCGGAGCCCGAGAGTTTCCAGGATGGCTTCTGCATCAACTTCTAAATATAATTCACACTC
CTTGGAGAATGAGTCTATTAAGAGGACGTCTCGAGATGGAGTCAATCGAGATCTCACTGAGGCTGTTCCTCGACTTCCAGGAGAAACACT
AATCACTGGACATGAGAAACCTGAGGTTCGCTTTGAAACAGGAAGGCCACAGCAGAAGAGATATGTTTGAGATCCTCACGAGATACGCGT
TTCCCCTGGCTCACAGTCTGGAAGATGTAGATTCCTTCATGAAACAGCCTGGGAATGAGACTGCAGATACAGTATTAAAGAAGCTGGATG
AACAGTACCAGAAGTATAAGTTTATGGAACTCAACCTTGCTCAAAAGAAAAGAAGGCTAAAAGGTCAGATTCCTGAAATTAAACAGACTT
TGGAAATTCTAAAATACATGCAGAAGAAAAAAGAGTCCACCAACTCAATGGAGACCAGATTCTTGCTGGCAGATAACCTGTATTGCAAAG
CTTCAGTTCCTCCTACCGATAAAATGTGTCTGTGGTTGGGGGCTAATGTAATGCTTGAATATGATATTGATGAAGCTCAGGCATTGTTGG
AAAAGAATTTATCGACTGCCACAAAGAATCTTGATTCCCTGGAGGAAGACCTTGACTTTCTTCGAGATCAATTTACTACCACAGAAGTCA
ATATGGCCAGGGTTTATAATTGGGATGTAAAAAGAAGAAACAAGGATGACTCTACCAAGAACAAAGCATAATGCTGGCAATTAAAAATGT
GGTTTAGTTTTCCAAACATGTTATCTTAAATACCCCTTTATCCTTACAGGTTGACATAACTTTGAATGTTTTAACAGCAAGAATTTTAAG
AAAAGATAAACACCATTTTATTTATTTATAAAAACAAAATTAGTTTCAAATATTTTTGACATTGTGATTTTTTTTTCCACATTTCTCAGC

>In-frame_MTM1_ENST00000543350_chrX_149787612_+_VBP1_ENST00000286428_chrX_154448460_+_1766nt
AGCCGAGCAGCCTGGCAACGGCGGTGGCGCCCGGAGCCCGAGAGTTTCCAGGATGGCTTCTGCATCAACTTCTAAATATAATTCACACTC
CTTGGAGAATGAGTCTATTAAGAGGACGTCTCGAGATGGAGTCAATCGAGATCTCACTGAGGCTGTTCCTCGACTTCCAGGAGAAACACT
AATCACTGGACATGAGAAACCTGAGGTTCGCTTTGAAACAGGAAGGCCACAGCAGAAGAGATATGTTTGAGATCCTCACGAGATACGCGT
TTCCCCTGGCTCACAGTCTGGAAGATGTAGATTCCTTCATGAAACAGCCTGGGAATGAGACTGCAGATACAGTATTAAAGAAGCTGGATG
AACAGTACCAGAAGTATAAGTTTATGGAACTCAACCTTGCTCAAAAGAAAAGAAGGCTAAAAGGTCAGATTCCTGAAATTAAACAGACTT
TGGAAATTCTAAAATACATGCAGAAGAAAAAAGAGTCCACCAACTCAATGGAGACCAGATTCTTGCTGGCAGATAACCTGTATTGCAAAG
CTTCAGTTCCTCCTACCGATAAAATGTGTCTGTGGTTGGGGGCTAATGTAATGCTTGAATATGATATTGATGAAGCTCAGGCATTGTTGG
AAAAGAATTTATCGACTGCCACAAAGAATCTTGATTCCCTGGAGGAAGACCTTGACTTTCTTCGAGATCAATTTACTACCACAGAAGTCA
ATATGGCCAGGGTTTATAATTGGGATGTAAAAAGAAGAAACAAGGATGACTCTACCAAGAACAAAGCATAATGCTGGCAATTAAAAATGT
GGTTTAGTTTTCCAAACATGTTATCTTAAATACCCCTTTATCCTTACAGGTTGACATAACTTTGAATGTTTTAACAGCAAGAATTTTAAG
AAAAGATAAACACCATTTTATTTATTTATAAAAACAAAATTAGTTTCAAATATTTTTGACATTGTGATTTTTTTTTCCACATTTCTCAGC
AAAGCTAATGGTATTTTAATCATTATTTTTGCCTGTCATAAGAAAACTCTTAGCTGAAATGGCCGAAAACTGTGAGACATGCTATGGAAG
CTGAATGCCGGACGCTAGCACAGTTTACTTTTTCCCTTTCTAATCGGCTGATGTTACTCTCACTTGATGTGGTTAAACCATTTTAGAGGT
AGAGAAGACAGACAGTTTGAATATTTGTAAACTTGTTTTTCTTTGGTATATTTAGGACTTAGTGGTCCTCTGTTGCTATTGTCTTCTATA
AGTGGAGTTTCATGACTTACTGCTTAACGAATAACTAACTACTATGATATTCTGGACATTTTAGGAAATGGTAATTTGCCTTGCTACACA
TTAAGAGGGCTATTAAGACTACATTTTTTCTAACCTCAGATAAGTGCAGTGTCTTTGCAATGCCAACATAAGGGAGATCTTGGCCAACGT
GAAATAAAATTACTCATTCAAAACTCTGCCTAAGGTGATTTTGTAGTTCTTAACAGTTCTCCAGAGCATCTTGAACAGGAATATTAAGAT
AAATGTGAATCTGCAATGGCTGAAAAGAGTTGTGAGCTTTTTTATTCATGATAAAACCTTATAGGAATAGTATAAAAAATCCCTGTGGAA
AGCTACTAGTACATTGACCAGCGCTGGGTGATACAGATTCTGATAAAAACATAAATGTATTAGTTCATCTCCATGTAGTAAAAAGTATAC

>In-frame_MTM1_ENST00000413012_chrX_149787612_+_VBP1_ENST00000535916_chrX_154448460_+_1066nt
GGTGGCGCCCGGAGCCCGAGAGTTTCCAGGATGGCTTCTGCATCAACTTCTAAATATAATTCACACTCCTTGGAGAATGAGTCTATTAAG
AGGACGTCTCGAGATGGAGTCAATCGAGATCTCACTGAGGCTGTTCCTCGACTTCCAGGAGAAACACTAATCACTGACAAAGAAGTTATT
TACATATGTCCTTTCAATGGCCCCATTAAGGGAAGAGTTTACATCACAAATTATCGTCTTTATTTAAGAAGTTTGGAAACGGACATGAGA
AACCTGAGGTTCGCTTTGAAACAGGAAGGCCACAGCAGAAGAGATATGTTTGAGATCCTCACGAGATACGCGTTTCCCCTGGCTCACAGT
CTGGAAGATGTAGATTCCTTCATGAAACAGCCTGGGAATGAGACTGCAGATACAGTATTAAAGAAGCTGGATGAACAGTACCAGAAGTAT
AAGTTTATGGAACTCAACCTTGCTCAAAAGAAAAGAAGGCTAAAAGGTCAGATTCCTGAAATTAAACAGACTTTGGAAATTCTAAAATAC
ATGCAGAAGAAAAAAGAGTCCACCAACTCAATGGAGACCAGATTCTTGCTGGCAGATAACCTGTATTGCAAAGCTTCAGTTCCTCCTACC
GATAAAATGTGTCTGTGGTTGGGGGCTAATGTAATGCTTGAATATGATATTGATGAAGCTCAGGCATTGTTGGAAAAGAATTTATCGACT
GCCACAAAGAATCTTGATTCCCTGGAGGAAGACCTTGACTTTCTTCGAGATCAATTTACTACCACAGAAGTCAATATGGCCAGGGTTTAT
AATTGGGATGTAAAAAGAAGAAACAAGGATGACTCTACCAAGAACAAAGCATAATGCTGGCAATTAAAAATGTGGTTTAGTTTTCCAAAC
ATGTTATCTTAAATACCCCTTTATCCTTACAGGTTGACATAACTTTGAATGTTTTAACAGCAAGAATTTTAAGAAAAGATAAACACCATT

>In-frame_MTM1_ENST00000413012_chrX_149787612_+_VBP1_ENST00000286428_chrX_154448460_+_1839nt
GGTGGCGCCCGGAGCCCGAGAGTTTCCAGGATGGCTTCTGCATCAACTTCTAAATATAATTCACACTCCTTGGAGAATGAGTCTATTAAG
AGGACGTCTCGAGATGGAGTCAATCGAGATCTCACTGAGGCTGTTCCTCGACTTCCAGGAGAAACACTAATCACTGACAAAGAAGTTATT
TACATATGTCCTTTCAATGGCCCCATTAAGGGAAGAGTTTACATCACAAATTATCGTCTTTATTTAAGAAGTTTGGAAACGGACATGAGA
AACCTGAGGTTCGCTTTGAAACAGGAAGGCCACAGCAGAAGAGATATGTTTGAGATCCTCACGAGATACGCGTTTCCCCTGGCTCACAGT
CTGGAAGATGTAGATTCCTTCATGAAACAGCCTGGGAATGAGACTGCAGATACAGTATTAAAGAAGCTGGATGAACAGTACCAGAAGTAT
AAGTTTATGGAACTCAACCTTGCTCAAAAGAAAAGAAGGCTAAAAGGTCAGATTCCTGAAATTAAACAGACTTTGGAAATTCTAAAATAC
ATGCAGAAGAAAAAAGAGTCCACCAACTCAATGGAGACCAGATTCTTGCTGGCAGATAACCTGTATTGCAAAGCTTCAGTTCCTCCTACC
GATAAAATGTGTCTGTGGTTGGGGGCTAATGTAATGCTTGAATATGATATTGATGAAGCTCAGGCATTGTTGGAAAAGAATTTATCGACT
GCCACAAAGAATCTTGATTCCCTGGAGGAAGACCTTGACTTTCTTCGAGATCAATTTACTACCACAGAAGTCAATATGGCCAGGGTTTAT
AATTGGGATGTAAAAAGAAGAAACAAGGATGACTCTACCAAGAACAAAGCATAATGCTGGCAATTAAAAATGTGGTTTAGTTTTCCAAAC
ATGTTATCTTAAATACCCCTTTATCCTTACAGGTTGACATAACTTTGAATGTTTTAACAGCAAGAATTTTAAGAAAAGATAAACACCATT
TTATTTATTTATAAAAACAAAATTAGTTTCAAATATTTTTGACATTGTGATTTTTTTTTCCACATTTCTCAGCAAAGCTAATGGTATTTT
AATCATTATTTTTGCCTGTCATAAGAAAACTCTTAGCTGAAATGGCCGAAAACTGTGAGACATGCTATGGAAGCTGAATGCCGGACGCTA
GCACAGTTTACTTTTTCCCTTTCTAATCGGCTGATGTTACTCTCACTTGATGTGGTTAAACCATTTTAGAGGTAGAGAAGACAGACAGTT
TGAATATTTGTAAACTTGTTTTTCTTTGGTATATTTAGGACTTAGTGGTCCTCTGTTGCTATTGTCTTCTATAAGTGGAGTTTCATGACT
TACTGCTTAACGAATAACTAACTACTATGATATTCTGGACATTTTAGGAAATGGTAATTTGCCTTGCTACACATTAAGAGGGCTATTAAG
ACTACATTTTTTCTAACCTCAGATAAGTGCAGTGTCTTTGCAATGCCAACATAAGGGAGATCTTGGCCAACGTGAAATAAAATTACTCAT
TCAAAACTCTGCCTAAGGTGATTTTGTAGTTCTTAACAGTTCTCCAGAGCATCTTGAACAGGAATATTAAGATAAATGTGAATCTGCAAT
GGCTGAAAAGAGTTGTGAGCTTTTTTATTCATGATAAAACCTTATAGGAATAGTATAAAAAATCCCTGTGGAAAGCTACTAGTACATTGA
CCAGCGCTGGGTGATACAGATTCTGATAAAAACATAAATGTATTAGTTCATCTCCATGTAGTAAAAAGTATACTTATACAATGTTTTGTA


Top

FusionGenePPI for MTM1_VBP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MTM1KBTBD7, KMT2A, BIN1, CUL4A, HLA-C, KIAA1468, KRT2, KRT5, SNX17, MTMR11, MTM1, MTFR1, SAMM50, CALU, CIAO1, STIP1, RCN1, SNX6, VBP1, TARBP2, CCT8L1P, AKR7A2, NDUFA9, OXA1L, SOAT1, STOML2, IMMT, ILK, SCO2, MTMR10, TRIML2, TUBA3CVBP1VHL, PFDN2, MSH4, PAN2, PRPF4, PPP2CB, TUBA3E, XRCC6, PIK3R3, FBXW8, MKNK2, PFDN4, PFDN5, PFDN6, KARS, EPRS, GARS, NUBP2, NAB2, IARS, DARS, CLNS1A, QARS, TRMT1, PSMC2, METTL21B, HDAC1, VCP, MAPK7, SSB, TNPO1, UBQLN2, ANP32A, ARPC1B, ARPC4, PPP3CA, RABGGTA, TTLL12, FKBP6, PNMA1, UBL7, DCAF5, PEX7, CBS, FLNA, TXNDC12, DCUN1D1, FLNB, GOLPH3, PFDN1, RNASEH2B, SEC24B, XPNPEP1, BTRC, EWSR1, POC1A, POC1B, ANAPC15, PTPN21, DUSP16, DUSP8, DUSP9, MTM1, PHKB, COPRS, CCDC101, SUPT6H, PDRG1, STK26, GSPT1, GNB2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MTM1_VBP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MTM1_VBP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMTM1C0410203X-linked centronuclear myopathy13CTD_human;ORPHANET;UNIPROT
HgeneMTM1C0752282Congenital Structural Myopathy1CTD_human