FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21985

FusionGeneSummary for MIPEP_MYO16

check button Fusion gene summary
Fusion gene informationFusion gene name: MIPEP_MYO16
Fusion gene ID: 21985
HgeneTgene
Gene symbol

MIPEP

MYO16

Gene ID

4285

23026

Gene namemitochondrial intermediate peptidasemyosin XVI
SynonymsCOXPD31|HMIP|MIPMYAP3|MYR8|Myo16b|NYAP3|PPP1R107
Cytomap

13q12.12

13q33.3

Type of geneprotein-codingprotein-coding
Descriptionmitochondrial intermediate peptidaseunconventional myosin-XVIMYO16 variant proteinmyosin heavy chain Myr 8neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 3neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adaptor 3protein phosphatase 1, regulatory subunit 10
Modification date2018052320180519
UniProtAcc

Q99797

Q9Y6X6

Ensembl transtripts involved in fusion geneENST00000382172, ENST00000469167, 
ENST00000356711, ENST00000251041, 
ENST00000357550, ENST00000457511, 
ENST00000467639, 
Fusion gene scores* DoF score5 X 5 X 4=10010 X 8 X 9=720
# samples 510
** MAII scorelog2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/720*10)=-2.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MIPEP [Title/Abstract] AND MYO16 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCOADTCGA-DM-A28F-01AMIPEPchr13

24380089

-MYO16chr13

109507791

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000382172ENST00000356711MIPEPchr13

24380089

-MYO16chr13

109507791

+
In-frameENST00000382172ENST00000251041MIPEPchr13

24380089

-MYO16chr13

109507791

+
In-frameENST00000382172ENST00000357550MIPEPchr13

24380089

-MYO16chr13

109507791

+
5CDS-intronENST00000382172ENST00000457511MIPEPchr13

24380089

-MYO16chr13

109507791

+
5CDS-intronENST00000382172ENST00000467639MIPEPchr13

24380089

-MYO16chr13

109507791

+
intron-3CDSENST00000469167ENST00000356711MIPEPchr13

24380089

-MYO16chr13

109507791

+
intron-3CDSENST00000469167ENST00000251041MIPEPchr13

24380089

-MYO16chr13

109507791

+
intron-3CDSENST00000469167ENST00000357550MIPEPchr13

24380089

-MYO16chr13

109507791

+
intron-intronENST00000469167ENST00000457511MIPEPchr13

24380089

-MYO16chr13

109507791

+
intron-intronENST00000469167ENST00000467639MIPEPchr13

24380089

-MYO16chr13

109507791

+

Top

FusionProtFeatures for MIPEP_MYO16


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MIPEP

Q99797

MYO16

Q9Y6X6

Cleaves proteins, imported into the mitochondrion, totheir mature size.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMYO16chr13:24380089chr13:109507791ENST00000251041+8241389_1671394941Compositional biasPro-rich
TgeneMYO16chr13:24380089chr13:109507791ENST00000356711+9351389_16713941859Compositional biasPro-rich
TgeneMYO16chr13:24380089chr13:109507791ENST00000357550+8341389_16713941859Compositional biasPro-rich
TgeneMYO16chr13:24380089chr13:109507791ENST00000251041+8241147_1176394941DomainIQ
TgeneMYO16chr13:24380089chr13:109507791ENST00000251041+824401_1145394941DomainMyosin motor
TgeneMYO16chr13:24380089chr13:109507791ENST00000356711+9351147_11763941859DomainIQ
TgeneMYO16chr13:24380089chr13:109507791ENST00000356711+935401_11453941859DomainMyosin motor
TgeneMYO16chr13:24380089chr13:109507791ENST00000357550+8341147_11763941859DomainIQ
TgeneMYO16chr13:24380089chr13:109507791ENST00000357550+834401_11453941859DomainMyosin motor
TgeneMYO16chr13:24380089chr13:109507791ENST00000251041+824497_504394941Nucleotide bindingATP
TgeneMYO16chr13:24380089chr13:109507791ENST00000356711+935497_5043941859Nucleotide bindingATP
TgeneMYO16chr13:24380089chr13:109507791ENST00000357550+834497_5043941859Nucleotide bindingATP
TgeneMYO16chr13:24380089chr13:109507791ENST00000251041+8241111_1377394941RegionInvolved in CYFIP1- and NCKAP1-binding
TgeneMYO16chr13:24380089chr13:109507791ENST00000356711+9351111_13773941859RegionInvolved in CYFIP1- and NCKAP1-binding
TgeneMYO16chr13:24380089chr13:109507791ENST00000357550+8341111_13773941859RegionInvolved in CYFIP1- and NCKAP1-binding

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMYO16chr13:24380089chr13:109507791ENST00000251041+824125_154394941RepeatANK 3
TgeneMYO16chr13:24380089chr13:109507791ENST00000251041+824158_189394941RepeatANK 4
TgeneMYO16chr13:24380089chr13:109507791ENST00000251041+824191_217394941RepeatANK 5
TgeneMYO16chr13:24380089chr13:109507791ENST00000251041+824221_250394941RepeatANK 6
TgeneMYO16chr13:24380089chr13:109507791ENST00000251041+824254_283394941RepeatANK 7
TgeneMYO16chr13:24380089chr13:109507791ENST00000251041+82459_88394941RepeatANK 1
TgeneMYO16chr13:24380089chr13:109507791ENST00000251041+82492_121394941RepeatANK 2
TgeneMYO16chr13:24380089chr13:109507791ENST00000356711+935125_1543941859RepeatANK 3
TgeneMYO16chr13:24380089chr13:109507791ENST00000356711+935158_1893941859RepeatANK 4
TgeneMYO16chr13:24380089chr13:109507791ENST00000356711+935191_2173941859RepeatANK 5
TgeneMYO16chr13:24380089chr13:109507791ENST00000356711+935221_2503941859RepeatANK 6
TgeneMYO16chr13:24380089chr13:109507791ENST00000356711+935254_2833941859RepeatANK 7
TgeneMYO16chr13:24380089chr13:109507791ENST00000356711+93559_883941859RepeatANK 1
TgeneMYO16chr13:24380089chr13:109507791ENST00000356711+93592_1213941859RepeatANK 2
TgeneMYO16chr13:24380089chr13:109507791ENST00000357550+834125_1543941859RepeatANK 3
TgeneMYO16chr13:24380089chr13:109507791ENST00000357550+834158_1893941859RepeatANK 4
TgeneMYO16chr13:24380089chr13:109507791ENST00000357550+834191_2173941859RepeatANK 5
TgeneMYO16chr13:24380089chr13:109507791ENST00000357550+834221_2503941859RepeatANK 6
TgeneMYO16chr13:24380089chr13:109507791ENST00000357550+834254_2833941859RepeatANK 7
TgeneMYO16chr13:24380089chr13:109507791ENST00000357550+83459_883941859RepeatANK 1
TgeneMYO16chr13:24380089chr13:109507791ENST00000357550+83492_1213941859RepeatANK 2


Top

FusionGeneSequence for MIPEP_MYO16


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MIPEP_ENST00000382172_chr13_24380089_-_MYO16_ENST00000356711_chr13_109507791_+_2081aa
MLCVGRLGGLGARAAALPPRRAGRGSLEAGIRARRVSTSWSPVGAAFNVKPQGSRLDLFGERRGLFGVPELSAPEGFHIAQEKALRKTEL
LVDRACSTPPGPQTVLIFDELSDSLCRVADLADFVKIAHPEPAFREAAEEACRSIGTMVEKLNTNVDLTQSLQKLLADKKLVDSLDPETR
RVAELFMFDFEISGIHLDKEKRKRAVDLNVKILDLSSTFLMGTNFPNKIEKHLLPEHIRRNFTSAGDHIIIDGLHAESPDDLVREAATKI
FLTPNAGQLKCLEELLSSRDLLAKLVGTSTFSHRALQGTIAKNPETVMQFLEKLSDKLSERTLKDFEMIRGMKMKLNPQNSEVMPWDPPY
YSGVIRAERTNIEPSLTCPFFSLGACMEGLNILLNRLLGISLTAEQPAKGEVWSEDVRKLAVVHESEGLLGYIYCDFFQRADKPHQDCHF
TIRGGRLKEDGDTQLPVVVLMLNLPRSSRSSPTLLTPSMMENLFHEMGHAMHSMLGRTRYQHVTGTRCPTDFAEVPSILMEYFANDTRVV
NQFARHTQTGQPLPKNMVSRLCESKKVCAAADMQLQVFTATLDQIYHGKHPLRNSTTDILKETQEKFTGLPTVPNTVKLMPPAPNDDLAT
LSELNDGSLLTEIQKRFGNNQITTFIGDILLLVNPYKELPITSSMVSQLTFSSSGKLCSSLPPHLFSCVERAFHQLFREQRPQCFILSGE
RGSGKSEASKQIIRHLTCRAGASRATLDSRFKHVVCILEAFGHAKTTLNDLSSCFIKTFELQFCERKQQLTGARITTTLLEKSRLVSQPL
GQSNFLIFYLLMDGLSAEEKTGLHLNNLCAHRTLNQTIQDDASTGERSLNREKLAVLKRALNVVGFSSLEVENLFVILAAILHLGDIRFT
ALNEGNSAFVSDLQLLEQVAGMLQVSTDELASALTTDIQTFKGDMIIRRHTIQIAEFFRDLLAKSLYSRLFSFLVNTMNSCLHSQDEQKS
MQTLDIGILDIFGFEEFQKNEFEQLCVNMTNEKMHHTINEVLFLHEQVECVQEGVTMETATSPGNQNGVLDFFFQKPSGFLTLLDEESQM
IWSVESNFPKKLQSLLESSNTNAVYSPMKDGNGNVALKDHGTAFTIMHYAGRVMTDVVGAIEKNKDSLSQNLLFVMKTSENVVINHLFQS
KLSQTGSLVSATPSFKFRGHKSALLSKKMTASSIIGENKNTLELSKLLKKKGTSTFLQRLERGDPVTIASQLRKSLMDIIGKLQKCTPHF
IHCIRPNNSKLPDTFDNFYVSAQLQTIGVLEMVKIFRTGYPVRLSFSDFLSRTKPLADTFLREKKEQSAAERCRLVLQQCKLQGWQMGVR
KVFLKYWHADQLNDLCLQLQRKIITCQKVIRGFLARQHLLQRISIRQQEVTSINSFLQNTEDMGLKTYDALVIQNASDIARENDRLRSEM
NAPYHKEKLEVRNMQEEGSKRTDDKSGPRHFHPSSMSVCAAVDGLGQCLVGPSIWSPSLHSVFSMDDSSSLPSPRKQPPPKPKRDPNTRL
SASTEAVSACLSAAREAANEALARPRPHSDDYSTMKKIPPRKPKRSPNTKLSGSYEEISGSRPGDARPAGAPGAAARVLTPGTPQCALPP
AAPPGDEDDSEPVYIEMLGHAARPDSPDPGESVYEEMKCCLPDDGGPGAGSFLLHGASPPLLHRAPEDEAAGPPGDACDIPPPFPNLLPH
RPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSSPLSPQYSKSQKGDGDRPASPGLALFNGSGRASPPSTPPPPPP
PPGPPPAPYRPCAHLAFPPEPAPVNAGKAGPSAEAPKVHPKPNSAPVAGPCSSFPKIPTSPVKATRADARKAGSSASPPAPYSPPSSRPL
SSPLDELASLFNSGRSVLRKSAAGRKIREAEGFETNMNISSRDDPSTSEITSETQDRNANNHGIQLSNSLSSAITAENGNSISNGLPEED
GYSRLSISGTGTSTFQRHRDSHTTQVIHQLRLSENESVALQELLDWRRKLCEEGQDWQQILHHAEPRVPPPPPCKKPSLLKKPEGASCNR

>In-frame_MIPEP_ENST00000382172_chr13_24380089_-_MYO16_ENST00000251041_chr13_109507791_+_1163aa
MLCVGRLGGLGARAAALPPRRAGRGSLEAGIRARRVSTSWSPVGAAFNVKPQGSRLDLFGERRGLFGVPELSAPEGFHIAQEKALRKTEL
LVDRACSTPPGPQTVLIFDELSDSLCRVADLADFVKIAHPEPAFREAAEEACRSIGTMVEKLNTNVDLTQSLQKLLADKKLVDSLDPETR
RVAELFMFDFEISGIHLDKEKRKRAVDLNVKILDLSSTFLMGTNFPNKIEKHLLPEHIRRNFTSAGDHIIIDGLHAESPDDLVREAATKI
FLTPNAGQLKCLEELLSSRDLLAKLVGTSTFSHRALQGTIAKNPETVMQFLEKLSDKLSERTLKDFEMIRGMKMKLNPQNSEVMPWDPPY
YSGVIRAERTNIEPSLTCPFFSLGACMEGLNILLNRLLGISLTAEQPAKGEVWSEDVRKLAVVHESEGLLGYIYCDFFQRADKPHQDCHF
TIRGGRLKEDGDTQLPVVVLMLNLPRSSRSSPTLLTPSMMENLFHEMGHAMHSMLGRTRYQHVTGTRCPTDFAEVPSILMEYFANDTRVV
NQFARHTQTGQPLPKNMVSRLCESKKVCAAADMQLQVFTATLDQIYHGKHPLRNSTTDILKETQEKFTGLPTVPNTVKLMPPAPNDDLAT
LSELNDGSLLTEIQKRFGNNQITTFIGDILLLVNPYKELPITSSMVSQLTFSSSGKLCSSLPPHLFSCVERAFHQLFREQRPQCFILSGE
RGSGKSEASKQIIRHLTCRAGASRATLDSRFKHVVCILEAFGHAKTTLNDLSSCFIKTFELQFCERKQQLTGARITTTLLEKSRLVSQPL
GQSNFLIFYLLMDGLSAEEKTGLHLNNLCAHRTLNQTIQDDASTGERSLNREKLAVLKRALNVVGFSSLEVENLFVILAAILHLGDIRFT
ALNEGNSAFVSDLQLLEQVAGMLQVSTDELASALTTDIQTFKGDMIIRRHTIQIAEFFRDLLAKSLYSRLFSFLVNTMNSCLHSQDEQKS
MQTLDIGILDIFGFEEFQKNEFEQLCVNMTNEKMHHTINEVLFLHEQVECVQEGVTMETATSPGNQNGVLDFFFQKPSGFLTLLDEESQM

>In-frame_MIPEP_ENST00000382172_chr13_24380089_-_MYO16_ENST00000357550_chr13_109507791_+_2081aa
MLCVGRLGGLGARAAALPPRRAGRGSLEAGIRARRVSTSWSPVGAAFNVKPQGSRLDLFGERRGLFGVPELSAPEGFHIAQEKALRKTEL
LVDRACSTPPGPQTVLIFDELSDSLCRVADLADFVKIAHPEPAFREAAEEACRSIGTMVEKLNTNVDLTQSLQKLLADKKLVDSLDPETR
RVAELFMFDFEISGIHLDKEKRKRAVDLNVKILDLSSTFLMGTNFPNKIEKHLLPEHIRRNFTSAGDHIIIDGLHAESPDDLVREAATKI
FLTPNAGQLKCLEELLSSRDLLAKLVGTSTFSHRALQGTIAKNPETVMQFLEKLSDKLSERTLKDFEMIRGMKMKLNPQNSEVMPWDPPY
YSGVIRAERTNIEPSLTCPFFSLGACMEGLNILLNRLLGISLTAEQPAKGEVWSEDVRKLAVVHESEGLLGYIYCDFFQRADKPHQDCHF
TIRGGRLKEDGDTQLPVVVLMLNLPRSSRSSPTLLTPSMMENLFHEMGHAMHSMLGRTRYQHVTGTRCPTDFAEVPSILMEYFANDTRVV
NQFARHTQTGQPLPKNMVSRLCESKKVCAAADMQLQVFTATLDQIYHGKHPLRNSTTDILKETQEKFTGLPTVPNTVKLMPPAPNDDLAT
LSELNDGSLLTEIQKRFGNNQITTFIGDILLLVNPYKELPITSSMVSQLTFSSSGKLCSSLPPHLFSCVERAFHQLFREQRPQCFILSGE
RGSGKSEASKQIIRHLTCRAGASRATLDSRFKHVVCILEAFGHAKTTLNDLSSCFIKTFELQFCERKQQLTGARITTTLLEKSRLVSQPL
GQSNFLIFYLLMDGLSAEEKTGLHLNNLCAHRTLNQTIQDDASTGERSLNREKLAVLKRALNVVGFSSLEVENLFVILAAILHLGDIRFT
ALNEGNSAFVSDLQLLEQVAGMLQVSTDELASALTTDIQTFKGDMIIRRHTIQIAEFFRDLLAKSLYSRLFSFLVNTMNSCLHSQDEQKS
MQTLDIGILDIFGFEEFQKNEFEQLCVNMTNEKMHHTINEVLFLHEQVECVQEGVTMETATSPGNQNGVLDFFFQKPSGFLTLLDEESQM
IWSVESNFPKKLQSLLESSNTNAVYSPMKDGNGNVALKDHGTAFTIMHYAGRVMTDVVGAIEKNKDSLSQNLLFVMKTSENVVINHLFQS
KLSQTGSLVSATPSFKFRGHKSALLSKKMTASSIIGENKNTLELSKLLKKKGTSTFLQRLERGDPVTIASQLRKSLMDIIGKLQKCTPHF
IHCIRPNNSKLPDTFDNFYVSAQLQTIGVLEMVKIFRTGYPVRLSFSDFLSRTKPLADTFLREKKEQSAAERCRLVLQQCKLQGWQMGVR
KVFLKYWHADQLNDLCLQLQRKIITCQKVIRGFLARQHLLQRISIRQQEVTSINSFLQNTEDMGLKTYDALVIQNASDIARENDRLRSEM
NAPYHKEKLEVRNMQEEGSKRTDDKSGPRHFHPSSMSVCAAVDGLGQCLVGPSIWSPSLHSVFSMDDSSSLPSPRKQPPPKPKRDPNTRL
SASTEAVSACLSAAREAANEALARPRPHSDDYSTMKKIPPRKPKRSPNTKLSGSYEEISGSRPGDARPAGAPGAAARVLTPGTPQCALPP
AAPPGDEDDSEPVYIEMLGHAARPDSPDPGESVYEEMKCCLPDDGGPGAGSFLLHGASPPLLHRAPEDEAAGPPGDACDIPPPFPNLLPH
RPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSSPLSPQYSKSQKGDGDRPASPGLALFNGSGRASPPSTPPPPPP
PPGPPPAPYRPCAHLAFPPEPAPVNAGKAGPSAEAPKVHPKPNSAPVAGPCSSFPKIPTSPVKATRADARKAGSSASPPAPYSPPSSRPL
SSPLDELASLFNSGRSVLRKSAAGRKIREAEGFETNMNISSRDDPSTSEITSETQDRNANNHGIQLSNSLSSAITAENGNSISNGLPEED
GYSRLSISGTGTSTFQRHRDSHTTQVIHQLRLSENESVALQELLDWRRKLCEEGQDWQQILHHAEPRVPPPPPCKKPSLLKKPEGASCNR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MIPEP_ENST00000382172_chr13_24380089_-_MYO16_ENST00000356711_chr13_109507791_+_6243nt
ATGCTGTGCGTCGGAAGGCTGGGCGGCTTGGGAGCCAGAGCAGCAGCTCTGCCGCCCCGCCGGGCGGGCCGGGGAAGCCTCGAAGCCGGG
ATCCGGGCCCGAAGGGTCAGCACCAGCTGGTCTCCCGTGGGCGCCGCCTTCAATGTCAAGCCCCAGGGCAGCCGCTTGGACCTGTTCGGC
GAGCGCCGGGGTCTTTTTGGAGTTCCTGAGCTGAGTGCCCCAGAAGGATTTCATATTGCACAAGAAAAAGCCTTGAGAAAGACAGAATTG
CTTGTGGACCGTGCATGTTCCACCCCACCTGGGCCCCAGACCGTGCTGATCTTCGATGAGCTCTCGGATTCCTTATGCAGAGTGGCCGAC
TTGGCTGATTTTGTGAAAATCGCTCACCCTGAGCCAGCATTCAGAGAAGCTGCGGAAGAAGCTTGTAGAAGTATTGGCACCATGGTAGAG
AAGTTGAACACAAATGTGGATTTATATCAAAGTTTGCAAAAATTACTAGCTGATAAAAAACTTGTGGATTCCCTTGATCCAGAAACAAGG
CGAGTGGCTGAACTGTTTATGTTTGATTTTGAAATTAGTGGAATCCATCTAGACAAAGAAAAGCGTAAAAGAGCAGTGGACCTCAATGTT
AAAATCTTGGATTTGAGTAGTACATTTCTTATGGGAACCAATTTTCCCAACAAGATTGAGAAGCATCTCTTACCAGAACACATTCGTCGT
AACTTTACATCTGCTGGGGATCATATCATAATTGATGGTCTCCACGCAGAATCACCAGATGACTTGGTGCGAGAAGCTGCTTATAAAATT
TTTCTTTATCCCAATGCTGGTCAATTGAAATGTTTAGAAGAATTGCTCAGCAGCAGAGATCTTCTGGCAAAGTTGGTGGGGTATTCCACG
TTTTCTCACAGGGCTCTCCAAGGAACGATAGCTAAAAATCCAGAGACTGTCATGCAGTTCCTTGAAAAACTATCTGACAAACTTTCTGAA
AGAACTCTGAAAGATTTTGAGATGATACGAGGGATGAAAATGAAACTGAATCCTCAAAATTCCGAAGTAATGCCCTGGGACCCCCCTTAC
TACAGTGGTGTGATTCGTGCAGAAAGGTATAATATTGAGCCCAGCCTATATTGCCCGTTTTTCTCTCTTGGAGCATGCATGGAAGGCCTG
AATATTTTGCTTAACAGACTGTTGGGGATTTCATTATATGCAGAGCAGCCTGCAAAAGGAGAGGTGTGGAGCGAAGATGTCCGAAAACTG
GCTGTTGTTCATGAATCTGAAGGATTGTTGGGGTACATTTACTGTGATTTTTTTCAGCGAGCAGACAAACCACATCAGGATTGCCATTTC
ACTATCCGTGGAGGCAGACTAAAGGAAGATGGAGACTATCAACTCCCAGTTGTAGTTCTTATGCTGAATCTTCCCCGTTCCTCAAGGAGT
TCTCCAACTTTGCTAACTCCTAGCATGATGGAAAATCTTTTCCATGAAATGGGACATGCCATGCATTCAATGCTAGGACGTACTCGTTAC
CAACACGTCACTGGGACCAGGTGCCCTACTGATTTTGCTGAGGTTCCTTCTATTCTGATGGAGTACTTTGCAAATGATTATCGAGTAGTT
AACCAATTTGCCAGACATTATCAGACTGGACAGCCACTGCCAAAAAATATGGTGTCTCGTCTTTGTGAATCTAAAAAGGTTTGTGCTGCA
GCTGATATGCAACTTCAGGTCTTTTATGCCACTCTGGATCAAATCTACCATGGGAAGCATCCCCTGAGGAATTCAACCACAGACATTCTC
AAGGAAACACAAGAGAAATTCTATGGCCTACCATATGTTCCAAATACTGTCAAGCTAATGCCTCCTGCCCCAAACGATGACCTGGCAACG
CTCAGCGAGCTCAATGATGGCAGCCTGCTCTATGAGATTCAGAAGCGCTTTGGGAACAATCAGATCTATACATTCATTGGAGACATTCTT
TTGCTTGTTAACCCATACAAGGAGCTTCCAATTTATTCTTCCATGGTGTCCCAGCTGTATTTCAGCTCCTCAGGGAAGCTGTGTTCCTCG
CTGCCTCCTCACCTCTTCTCCTGTGTGGAGAGAGCCTTTCACCAGCTCTTCCGGGAACAGCGGCCTCAGTGTTTCATCCTCAGTGGAGAA
AGGGGATCAGGAAAGTCTGAAGCCAGCAAACAAATCATAAGACACCTCACCTGCAGGGCTGGCGCCAGCAGGGCCACACTGGATTCCAGA
TTCAAACATGTCGTGTGCATCTTAGAAGCCTTTGGACATGCCAAGACCACACTTAATGATTTGTCCAGTTGCTTCATCAAGTATTTTGAA
CTGCAGTTCTGTGAGAGGAAACAACAGCTAACCGGAGCCAGAATTTATACATATTTGCTAGAGAAATCCAGACTTGTTTCACAACCTCTT
GGCCAGAGCAATTTTCTCATTTTCTACTTGTTGATGGATGGGTTATCTGCTGAAGAAAAATATGGACTTCATCTTAATAATTTATGTGCA
CACCGGTATTTGAACCAGACCATACAGGATGATGCATCCACAGGGGAGCGTTCTCTGAACAGGGAGAAATTGGCTGTTTTGAAACGAGCC
CTGAATGTAGTTGGCTTCAGCAGCTTGGAGGTGGAGAATCTGTTCGTAATTCTAGCAGCAATATTGCACCTTGGAGACATTCGGTTTACT
GCCCTGAATGAGGGGAACTCCGCCTTCGTTTCTGACCTCCAGCTCCTGGAACAAGTGGCTGGAATGTTACAAGTATCAACAGATGAATTG
GCATCTGCCTTAACAACTGATATTCAATATTTTAAAGGGGATATGATAATACGACGACATACCATACAGATTGCTGAGTTTTTCCGAGAC
CTCTTGGCCAAGTCCCTGTACAGTCGTTTGTTTAGCTTTTTGGTGAATACCATGAATTCTTGCCTCCACAGTCAAGATGAACAGAAAAGC
ATGCAGACATTGGATATTGGAATATTGGACATTTTTGGTTTTGAAGAGTTTCAAAAGAATGAATTTGAACAACTTTGTGTCAACATGACC
AATGAGAAGATGCACCACTATATCAATGAAGTGCTTTTTCTCCACGAGCAAGTGGAATGTGTACAAGAGGGAGTTACCATGGAAACAGCA
TATTCTCCTGGTAACCAGAATGGAGTTTTGGACTTTTTTTTCCAGAAGCCATCTGGATTTCTCACCTTATTGGATGAAGAAAGTCAAATG
ATTTGGTCAGTGGAATCAAATTTTCCAAAAAAACTACAAAGTCTCCTAGAATCCTCAAACACAAATGCGGTGTACTCCCCCATGAAGGAT
GGGAATGGGAATGTTGCCCTCAAAGACCACGGTACAGCCTTCACCATCATGCACTACGCAGGAAGGGTAATGTATGATGTTGTTGGGGCG
ATTGAAAAAAATAAAGACTCCCTTTCACAGAATCTTCTATTTGTAATGAAAACTAGTGAAAATGTCGTGATCAATCATTTGTTCCAGTCG
AAATTGTCACAAACAGGATCCCTCGTATCTGCCTATCCTTCCTTTAAATTCCGAGGACATAAGTCTGCCCTGCTCAGTAAGAAAATGACA
GCTTCTTCAATTATTGGAGAAAACAAGAATTATCTAGAACTTAGTAAGTTATTAAAAAAGAAAGGAACTTCTACATTTCTTCAAAGATTG
GAACGAGGAGATCCAGTCACCATAGCATCACAACTCAGGAAATCACTAATGGATATTATTGGAAAACTTCAGAAGTGCACTCCACACTTC
ATTCATTGCATCAGGCCCAATAACTCAAAGCTGCCAGATACTTTTGATAATTTTTACGTGTCTGCTCAGCTACAATATATTGGGGTCCTG
GAGATGGTGAAGATCTTCCGATATGGATACCCTGTTCGCCTTTCCTTCTCGGATTTCCTGTCAAGGTATAAGCCACTGGCTGATACATTC
CTGCGTGAGAAGAAGGAACAGTCAGCTGCCGAGCGATGTCGACTTGTTCTCCAGCAGTGTAAATTACAAGGCTGGCAGATGGGAGTCCGA
AAAGTGTTTCTAAAATACTGGCATGCTGACCAACTCAATGATTTGTGCCTACAGTTGCAGAGAAAAATTATAACCTGCCAAAAAGTTATC
AGAGGATTTTTAGCACGCCAGCACCTGCTTCAGAGAATAAGCATCAGACAACAAGAGGTGACTTCTATCAATAGCTTTCTGCAGAACACA
GAGGACATGGGGCTGAAAACCTACGATGCCCTGGTCATTCAGAATGCTTCAGACATTGCCCGGGAAAATGACCGGCTCCGTAGTGAAATG
AACGCTCCCTACCATAAAGAGAAGTTAGAGGTCAGGAACATGCAAGAGGAAGGAAGCAAAAGAACCGATGACAAGAGTGGACCCAGGCAT
TTCCACCCCAGCTCCATGTCAGTCTGCGCGGCCGTGGATGGCCTGGGCCAGTGCCTCGTTGGCCCGTCCATCTGGTCTCCTTCGCTGCAC
TCGGTGTTCAGCATGGATGACAGCAGCAGCCTCCCGTCTCCACGGAAACAGCCCCCGCCCAAGCCAAAGAGGGACCCCAACACCCGGCTG
AGTGCTTCCTATGAGGCTGTGAGCGCCTGCCTCTCCGCGGCCAGGGAAGCGGCCAACGAAGCTCTGGCCCGGCCCAGACCGCACAGCGAC
GACTACAGCACCATGAAGAAGATTCCTCCTCGAAAGCCCAAGCGCAGCCCCAACACCAAGCTCAGCGGCTCCTACGAGGAGATATCGGGG
TCCCGGCCCGGGGACGCGAGGCCCGCGGGCGCCCCGGGGGCAGCAGCGCGCGTTCTGACCCCCGGGACTCCGCAGTGCGCGCTGCCCCCG
GCGGCGCCTCCGGGTGACGAGGACGACAGCGAGCCTGTGTACATCGAGATGCTGGGGCACGCGGCCAGGCCCGATAGCCCGGACCCCGGG
GAGTCCGTGTACGAGGAGATGAAGTGTTGCCTGCCCGACGACGGCGGCCCGGGCGCGGGCTCCTTCCTGCTCCACGGCGCATCGCCGCCC
CTGCTCCACCGCGCGCCGGAGGACGAGGCGGCGGGGCCCCCAGGGGACGCGTGCGACATCCCGCCGCCCTTCCCCAACCTGCTGCCGCAC
CGGCCGCCCCTGCTGGTGTTCCCCCCGACCCCCGTCACCTGCTCCCCCGCCTCCGACGAGTCGCCCCTGACACCCCTGGAGGTGAAGAAG
CTGCCAGTCCTGGAGACCAACCTCAAGTACCCCGTGCAGCCGGAGGGGTCGAGCCCGCTGTCCCCGCAGTACTCCAAGAGCCAGAAGGGC
GACGGCGACAGGCCCGCGTCCCCCGGCCTGGCGCTGTTCAACGGGTCCGGCCGAGCCTCCCCGCCGTCCACGCCGCCCCCGCCCCCGCCC
CCGCCCGGGCCGCCCCCCGCGCCCTACAGGCCCTGCGCGCACTTGGCCTTCCCGCCGGAGCCCGCCCCGGTGAACGCGGGGAAAGCGGGG
CCGAGCGCAGAGGCGCCCAAGGTTCACCCAAAGCCAAACTCTGCCCCCGTGGCCGGGCCCTGCAGCTCCTTCCCCAAGATCCCATATTCC
CCCGTGAAGGCCACCAGGGCGGACGCCAGGAAGGCCGGCTCCAGTGCCTCGCCCCCCGCGCCCTACAGCCCTCCCAGCTCCAGGCCTCTC
AGCAGCCCCCTGGACGAGCTCGCCAGCCTCTTCAACTCGGGGAGGAGTGTGCTTCGGAAATCCGCGGCGGGAAGAAAAATCAGGGAAGCA
GAAGGTTTTGAAACTAACATGAACATAAGTAGCCGAGATGACCCTAGTACGTCAGAAATTACTTCCGAGACTCAAGACAGAAATGCAAAT
AACCATGGAATTCAGTTATCTAATTCACTATCTAGTGCTATAACTGCTGAAAATGGAAATTCCATCTCAAATGGTTTACCTGAAGAAGAT
GGATACTCACGGTTGTCTATAAGTGGCACAGGGACTTCGACATTTCAAAGACACAGGGACAGTCACACCACTCAGGTAATCCATCAGCTG
AGGCTCTCAGAGAATGAAAGTGTGGCCCTGCAGGAACTCTTGGACTGGAGGAGAAAGCTCTGTGAGGAAGGACAAGACTGGCAGCAGATC
CTGCACCACGCTGAGCCCAGGGTGCCTCCCCCACCACCTTGCAAGAAGCCCAGCCTTCTGAAGAAGCCGGAAGGGGCCTCCTGCAACAGG

>In-frame_MIPEP_ENST00000382172_chr13_24380089_-_MYO16_ENST00000251041_chr13_109507791_+_3489nt
ATGCTGTGCGTCGGAAGGCTGGGCGGCTTGGGAGCCAGAGCAGCAGCTCTGCCGCCCCGCCGGGCGGGCCGGGGAAGCCTCGAAGCCGGG
ATCCGGGCCCGAAGGGTCAGCACCAGCTGGTCTCCCGTGGGCGCCGCCTTCAATGTCAAGCCCCAGGGCAGCCGCTTGGACCTGTTCGGC
GAGCGCCGGGGTCTTTTTGGAGTTCCTGAGCTGAGTGCCCCAGAAGGATTTCATATTGCACAAGAAAAAGCCTTGAGAAAGACAGAATTG
CTTGTGGACCGTGCATGTTCCACCCCACCTGGGCCCCAGACCGTGCTGATCTTCGATGAGCTCTCGGATTCCTTATGCAGAGTGGCCGAC
TTGGCTGATTTTGTGAAAATCGCTCACCCTGAGCCAGCATTCAGAGAAGCTGCGGAAGAAGCTTGTAGAAGTATTGGCACCATGGTAGAG
AAGTTGAACACAAATGTGGATTTATATCAAAGTTTGCAAAAATTACTAGCTGATAAAAAACTTGTGGATTCCCTTGATCCAGAAACAAGG
CGAGTGGCTGAACTGTTTATGTTTGATTTTGAAATTAGTGGAATCCATCTAGACAAAGAAAAGCGTAAAAGAGCAGTGGACCTCAATGTT
AAAATCTTGGATTTGAGTAGTACATTTCTTATGGGAACCAATTTTCCCAACAAGATTGAGAAGCATCTCTTACCAGAACACATTCGTCGT
AACTTTACATCTGCTGGGGATCATATCATAATTGATGGTCTCCACGCAGAATCACCAGATGACTTGGTGCGAGAAGCTGCTTATAAAATT
TTTCTTTATCCCAATGCTGGTCAATTGAAATGTTTAGAAGAATTGCTCAGCAGCAGAGATCTTCTGGCAAAGTTGGTGGGGTATTCCACG
TTTTCTCACAGGGCTCTCCAAGGAACGATAGCTAAAAATCCAGAGACTGTCATGCAGTTCCTTGAAAAACTATCTGACAAACTTTCTGAA
AGAACTCTGAAAGATTTTGAGATGATACGAGGGATGAAAATGAAACTGAATCCTCAAAATTCCGAAGTAATGCCCTGGGACCCCCCTTAC
TACAGTGGTGTGATTCGTGCAGAAAGGTATAATATTGAGCCCAGCCTATATTGCCCGTTTTTCTCTCTTGGAGCATGCATGGAAGGCCTG
AATATTTTGCTTAACAGACTGTTGGGGATTTCATTATATGCAGAGCAGCCTGCAAAAGGAGAGGTGTGGAGCGAAGATGTCCGAAAACTG
GCTGTTGTTCATGAATCTGAAGGATTGTTGGGGTACATTTACTGTGATTTTTTTCAGCGAGCAGACAAACCACATCAGGATTGCCATTTC
ACTATCCGTGGAGGCAGACTAAAGGAAGATGGAGACTATCAACTCCCAGTTGTAGTTCTTATGCTGAATCTTCCCCGTTCCTCAAGGAGT
TCTCCAACTTTGCTAACTCCTAGCATGATGGAAAATCTTTTCCATGAAATGGGACATGCCATGCATTCAATGCTAGGACGTACTCGTTAC
CAACACGTCACTGGGACCAGGTGCCCTACTGATTTTGCTGAGGTTCCTTCTATTCTGATGGAGTACTTTGCAAATGATTATCGAGTAGTT
AACCAATTTGCCAGACATTATCAGACTGGACAGCCACTGCCAAAAAATATGGTGTCTCGTCTTTGTGAATCTAAAAAGGTTTGTGCTGCA
GCTGATATGCAACTTCAGGTCTTTTATGCCACTCTGGATCAAATCTACCATGGGAAGCATCCCCTGAGGAATTCAACCACAGACATTCTC
AAGGAAACACAAGAGAAATTCTATGGCCTACCATATGTTCCAAATACTGTCAAGCTAATGCCTCCTGCCCCAAACGATGACCTGGCAACG
CTCAGCGAGCTCAATGATGGCAGCCTGCTCTATGAGATTCAGAAGCGCTTTGGGAACAATCAGATCTATACATTCATTGGAGACATTCTT
TTGCTTGTTAACCCATACAAGGAGCTTCCAATTTATTCTTCCATGGTGTCCCAGCTGTATTTCAGCTCCTCAGGGAAGCTGTGTTCCTCG
CTGCCTCCTCACCTCTTCTCCTGTGTGGAGAGAGCCTTTCACCAGCTCTTCCGGGAACAGCGGCCTCAGTGTTTCATCCTCAGTGGAGAA
AGGGGATCAGGAAAGTCTGAAGCCAGCAAACAAATCATAAGACACCTCACCTGCAGGGCTGGCGCCAGCAGGGCCACACTGGATTCCAGA
TTCAAACATGTCGTGTGCATCTTAGAAGCCTTTGGACATGCCAAGACCACACTTAATGATTTGTCCAGTTGCTTCATCAAGTATTTTGAA
CTGCAGTTCTGTGAGAGGAAACAACAGCTAACCGGAGCCAGAATTTATACATATTTGCTAGAGAAATCCAGACTTGTTTCACAACCTCTT
GGCCAGAGCAATTTTCTCATTTTCTACTTGTTGATGGATGGGTTATCTGCTGAAGAAAAATATGGACTTCATCTTAATAATTTATGTGCA
CACCGGTATTTGAACCAGACCATACAGGATGATGCATCCACAGGGGAGCGTTCTCTGAACAGGGAGAAATTGGCTGTTTTGAAACGAGCC
CTGAATGTAGTTGGCTTCAGCAGCTTGGAGGTGGAGAATCTGTTCGTAATTCTAGCAGCAATATTGCACCTTGGAGACATTCGGTTTACT
GCCCTGAATGAGGGGAACTCCGCCTTCGTTTCTGACCTCCAGCTCCTGGAACAAGTGGCTGGAATGTTACAAGTATCAACAGATGAATTG
GCATCTGCCTTAACAACTGATATTCAATATTTTAAAGGGGATATGATAATACGACGACATACCATACAGATTGCTGAGTTTTTCCGAGAC
CTCTTGGCCAAGTCCCTGTACAGTCGTTTGTTTAGCTTTTTGGTGAATACCATGAATTCTTGCCTCCACAGTCAAGATGAACAGAAAAGC
ATGCAGACATTGGATATTGGAATATTGGACATTTTTGGTTTTGAAGAGTTTCAAAAGAATGAATTTGAACAACTTTGTGTCAACATGACC
AATGAGAAGATGCACCACTATATCAATGAAGTGCTTTTTCTCCACGAGCAAGTGGAATGTGTACAAGAGGGAGTTACCATGGAAACAGCA
TATTCTCCTGGTAACCAGAATGGAGTTTTGGACTTTTTTTTCCAGAAGCCATCTGGATTTCTCACCTTATTGGATGAAGAAAGTCAAATG
ATTTGGTCAGTGGAATCAAATTTTCCAAAAAAACTACAAAGTCTCCTAGAATCCTCAAACACAAATGCGGTGTACTCCCCCATGAAGGAT
GGGAATGGGAATGTTGCCCTCAAAGACCACGGTACAGCCTTCACCATCATGCACTACGCAGGAAGGGTAATGTATGATGTTGTTGGGGCG

>In-frame_MIPEP_ENST00000382172_chr13_24380089_-_MYO16_ENST00000357550_chr13_109507791_+_6243nt
ATGCTGTGCGTCGGAAGGCTGGGCGGCTTGGGAGCCAGAGCAGCAGCTCTGCCGCCCCGCCGGGCGGGCCGGGGAAGCCTCGAAGCCGGG
ATCCGGGCCCGAAGGGTCAGCACCAGCTGGTCTCCCGTGGGCGCCGCCTTCAATGTCAAGCCCCAGGGCAGCCGCTTGGACCTGTTCGGC
GAGCGCCGGGGTCTTTTTGGAGTTCCTGAGCTGAGTGCCCCAGAAGGATTTCATATTGCACAAGAAAAAGCCTTGAGAAAGACAGAATTG
CTTGTGGACCGTGCATGTTCCACCCCACCTGGGCCCCAGACCGTGCTGATCTTCGATGAGCTCTCGGATTCCTTATGCAGAGTGGCCGAC
TTGGCTGATTTTGTGAAAATCGCTCACCCTGAGCCAGCATTCAGAGAAGCTGCGGAAGAAGCTTGTAGAAGTATTGGCACCATGGTAGAG
AAGTTGAACACAAATGTGGATTTATATCAAAGTTTGCAAAAATTACTAGCTGATAAAAAACTTGTGGATTCCCTTGATCCAGAAACAAGG
CGAGTGGCTGAACTGTTTATGTTTGATTTTGAAATTAGTGGAATCCATCTAGACAAAGAAAAGCGTAAAAGAGCAGTGGACCTCAATGTT
AAAATCTTGGATTTGAGTAGTACATTTCTTATGGGAACCAATTTTCCCAACAAGATTGAGAAGCATCTCTTACCAGAACACATTCGTCGT
AACTTTACATCTGCTGGGGATCATATCATAATTGATGGTCTCCACGCAGAATCACCAGATGACTTGGTGCGAGAAGCTGCTTATAAAATT
TTTCTTTATCCCAATGCTGGTCAATTGAAATGTTTAGAAGAATTGCTCAGCAGCAGAGATCTTCTGGCAAAGTTGGTGGGGTATTCCACG
TTTTCTCACAGGGCTCTCCAAGGAACGATAGCTAAAAATCCAGAGACTGTCATGCAGTTCCTTGAAAAACTATCTGACAAACTTTCTGAA
AGAACTCTGAAAGATTTTGAGATGATACGAGGGATGAAAATGAAACTGAATCCTCAAAATTCCGAAGTAATGCCCTGGGACCCCCCTTAC
TACAGTGGTGTGATTCGTGCAGAAAGGTATAATATTGAGCCCAGCCTATATTGCCCGTTTTTCTCTCTTGGAGCATGCATGGAAGGCCTG
AATATTTTGCTTAACAGACTGTTGGGGATTTCATTATATGCAGAGCAGCCTGCAAAAGGAGAGGTGTGGAGCGAAGATGTCCGAAAACTG
GCTGTTGTTCATGAATCTGAAGGATTGTTGGGGTACATTTACTGTGATTTTTTTCAGCGAGCAGACAAACCACATCAGGATTGCCATTTC
ACTATCCGTGGAGGCAGACTAAAGGAAGATGGAGACTATCAACTCCCAGTTGTAGTTCTTATGCTGAATCTTCCCCGTTCCTCAAGGAGT
TCTCCAACTTTGCTAACTCCTAGCATGATGGAAAATCTTTTCCATGAAATGGGACATGCCATGCATTCAATGCTAGGACGTACTCGTTAC
CAACACGTCACTGGGACCAGGTGCCCTACTGATTTTGCTGAGGTTCCTTCTATTCTGATGGAGTACTTTGCAAATGATTATCGAGTAGTT
AACCAATTTGCCAGACATTATCAGACTGGACAGCCACTGCCAAAAAATATGGTGTCTCGTCTTTGTGAATCTAAAAAGGTTTGTGCTGCA
GCTGATATGCAACTTCAGGTCTTTTATGCCACTCTGGATCAAATCTACCATGGGAAGCATCCCCTGAGGAATTCAACCACAGACATTCTC
AAGGAAACACAAGAGAAATTCTATGGCCTACCATATGTTCCAAATACTGTCAAGCTAATGCCTCCTGCCCCAAACGATGACCTGGCAACG
CTCAGCGAGCTCAATGATGGCAGCCTGCTCTATGAGATTCAGAAGCGCTTTGGGAACAATCAGATCTATACATTCATTGGAGACATTCTT
TTGCTTGTTAACCCATACAAGGAGCTTCCAATTTATTCTTCCATGGTGTCCCAGCTGTATTTCAGCTCCTCAGGGAAGCTGTGTTCCTCG
CTGCCTCCTCACCTCTTCTCCTGTGTGGAGAGAGCCTTTCACCAGCTCTTCCGGGAACAGCGGCCTCAGTGTTTCATCCTCAGTGGAGAA
AGGGGATCAGGAAAGTCTGAAGCCAGCAAACAAATCATAAGACACCTCACCTGCAGGGCTGGCGCCAGCAGGGCCACACTGGATTCCAGA
TTCAAACATGTCGTGTGCATCTTAGAAGCCTTTGGACATGCCAAGACCACACTTAATGATTTGTCCAGTTGCTTCATCAAGTATTTTGAA
CTGCAGTTCTGTGAGAGGAAACAACAGCTAACCGGAGCCAGAATTTATACATATTTGCTAGAGAAATCCAGACTTGTTTCACAACCTCTT
GGCCAGAGCAATTTTCTCATTTTCTACTTGTTGATGGATGGGTTATCTGCTGAAGAAAAATATGGACTTCATCTTAATAATTTATGTGCA
CACCGGTATTTGAACCAGACCATACAGGATGATGCATCCACAGGGGAGCGTTCTCTGAACAGGGAGAAATTGGCTGTTTTGAAACGAGCC
CTGAATGTAGTTGGCTTCAGCAGCTTGGAGGTGGAGAATCTGTTCGTAATTCTAGCAGCAATATTGCACCTTGGAGACATTCGGTTTACT
GCCCTGAATGAGGGGAACTCCGCCTTCGTTTCTGACCTCCAGCTCCTGGAACAAGTGGCTGGAATGTTACAAGTATCAACAGATGAATTG
GCATCTGCCTTAACAACTGATATTCAATATTTTAAAGGGGATATGATAATACGACGACATACCATACAGATTGCTGAGTTTTTCCGAGAC
CTCTTGGCCAAGTCCCTGTACAGTCGTTTGTTTAGCTTTTTGGTGAATACCATGAATTCTTGCCTCCACAGTCAAGATGAACAGAAAAGC
ATGCAGACATTGGATATTGGAATATTGGACATTTTTGGTTTTGAAGAGTTTCAAAAGAATGAATTTGAACAACTTTGTGTCAACATGACC
AATGAGAAGATGCACCACTATATCAATGAAGTGCTTTTTCTCCACGAGCAAGTGGAATGTGTACAAGAGGGAGTTACCATGGAAACAGCA
TATTCTCCTGGTAACCAGAATGGAGTTTTGGACTTTTTTTTCCAGAAGCCATCTGGATTTCTCACCTTATTGGATGAAGAAAGTCAAATG
ATTTGGTCAGTGGAATCAAATTTTCCAAAAAAACTACAAAGTCTCCTAGAATCCTCAAACACAAATGCGGTGTACTCCCCCATGAAGGAT
GGGAATGGGAATGTTGCCCTCAAAGACCACGGTACAGCCTTCACCATCATGCACTACGCAGGAAGGGTAATGTATGATGTTGTTGGGGCG
ATTGAAAAAAATAAAGACTCCCTTTCACAGAATCTTCTATTTGTAATGAAAACTAGTGAAAATGTCGTGATCAATCATTTGTTCCAGTCG
AAATTGTCACAAACAGGATCCCTCGTATCTGCCTATCCTTCCTTTAAATTCCGAGGACATAAGTCTGCCCTGCTCAGTAAGAAAATGACA
GCTTCTTCAATTATTGGAGAAAACAAGAATTATCTAGAACTTAGTAAGTTATTAAAAAAGAAAGGAACTTCTACATTTCTTCAAAGATTG
GAACGAGGAGATCCAGTCACCATAGCATCACAACTCAGGAAATCACTAATGGATATTATTGGAAAACTTCAGAAGTGCACTCCACACTTC
ATTCATTGCATCAGGCCCAATAACTCAAAGCTGCCAGATACTTTTGATAATTTTTACGTGTCTGCTCAGCTACAATATATTGGGGTCCTG
GAGATGGTGAAGATCTTCCGATATGGATACCCTGTTCGCCTTTCCTTCTCGGATTTCCTGTCAAGGTATAAGCCACTGGCTGATACATTC
CTGCGTGAGAAGAAGGAACAGTCAGCTGCCGAGCGATGTCGACTTGTTCTCCAGCAGTGTAAATTACAAGGCTGGCAGATGGGAGTCCGA
AAAGTGTTTCTAAAATACTGGCATGCTGACCAACTCAATGATTTGTGCCTACAGTTGCAGAGAAAAATTATAACCTGCCAAAAAGTTATC
AGAGGATTTTTAGCACGCCAGCACCTGCTTCAGAGAATAAGCATCAGACAACAAGAGGTGACTTCTATCAATAGCTTTCTGCAGAACACA
GAGGACATGGGGCTGAAAACCTACGATGCCCTGGTCATTCAGAATGCTTCAGACATTGCCCGGGAAAATGACCGGCTCCGTAGTGAAATG
AACGCTCCCTACCATAAAGAGAAGTTAGAGGTCAGGAACATGCAAGAGGAAGGAAGCAAAAGAACCGATGACAAGAGTGGACCCAGGCAT
TTCCACCCCAGCTCCATGTCAGTCTGCGCGGCCGTGGATGGCCTGGGCCAGTGCCTCGTTGGCCCGTCCATCTGGTCTCCTTCGCTGCAC
TCGGTGTTCAGCATGGATGACAGCAGCAGCCTCCCGTCTCCACGGAAACAGCCCCCGCCCAAGCCAAAGAGGGACCCCAACACCCGGCTG
AGTGCTTCCTATGAGGCTGTGAGCGCCTGCCTCTCCGCGGCCAGGGAAGCGGCCAACGAAGCTCTGGCCCGGCCCAGACCGCACAGCGAC
GACTACAGCACCATGAAGAAGATTCCTCCTCGAAAGCCCAAGCGCAGCCCCAACACCAAGCTCAGCGGCTCCTACGAGGAGATATCGGGG
TCCCGGCCCGGGGACGCGAGGCCCGCGGGCGCCCCGGGGGCAGCAGCGCGCGTTCTGACCCCCGGGACTCCGCAGTGCGCGCTGCCCCCG
GCGGCGCCTCCGGGTGACGAGGACGACAGCGAGCCTGTGTACATCGAGATGCTGGGGCACGCGGCCAGGCCCGATAGCCCGGACCCCGGG
GAGTCCGTGTACGAGGAGATGAAGTGTTGCCTGCCCGACGACGGCGGCCCGGGCGCGGGCTCCTTCCTGCTCCACGGCGCATCGCCGCCC
CTGCTCCACCGCGCGCCGGAGGACGAGGCGGCGGGGCCCCCAGGGGACGCGTGCGACATCCCGCCGCCCTTCCCCAACCTGCTGCCGCAC
CGGCCGCCCCTGCTGGTGTTCCCCCCGACCCCCGTCACCTGCTCCCCCGCCTCCGACGAGTCGCCCCTGACACCCCTGGAGGTGAAGAAG
CTGCCAGTCCTGGAGACCAACCTCAAGTACCCCGTGCAGCCGGAGGGGTCGAGCCCGCTGTCCCCGCAGTACTCCAAGAGCCAGAAGGGC
GACGGCGACAGGCCCGCGTCCCCCGGCCTGGCGCTGTTCAACGGGTCCGGCCGAGCCTCCCCGCCGTCCACGCCGCCCCCGCCCCCGCCC
CCGCCCGGGCCGCCCCCCGCGCCCTACAGGCCCTGCGCGCACTTGGCCTTCCCGCCGGAGCCCGCCCCGGTGAACGCGGGGAAAGCGGGG
CCGAGCGCAGAGGCGCCCAAGGTTCACCCAAAGCCAAACTCTGCCCCCGTGGCCGGGCCCTGCAGCTCCTTCCCCAAGATCCCATATTCC
CCCGTGAAGGCCACCAGGGCGGACGCCAGGAAGGCCGGCTCCAGTGCCTCGCCCCCCGCGCCCTACAGCCCTCCCAGCTCCAGGCCTCTC
AGCAGCCCCCTGGACGAGCTCGCCAGCCTCTTCAACTCGGGGAGGAGTGTGCTTCGGAAATCCGCGGCGGGAAGAAAAATCAGGGAAGCA
GAAGGTTTTGAAACTAACATGAACATAAGTAGCCGAGATGACCCTAGTACGTCAGAAATTACTTCCGAGACTCAAGACAGAAATGCAAAT
AACCATGGAATTCAGTTATCTAATTCACTATCTAGTGCTATAACTGCTGAAAATGGAAATTCCATCTCAAATGGTTTACCTGAAGAAGAT
GGATACTCACGGTTGTCTATAAGTGGCACAGGGACTTCGACATTTCAAAGACACAGGGACAGTCACACCACTCAGGTAATCCATCAGCTG
AGGCTCTCAGAGAATGAAAGTGTGGCCCTGCAGGAACTCTTGGACTGGAGGAGAAAGCTCTGTGAGGAAGGACAAGACTGGCAGCAGATC
CTGCACCACGCTGAGCCCAGGGTGCCTCCCCCACCACCTTGCAAGAAGCCCAGCCTTCTGAAGAAGCCGGAAGGGGCCTCCTGCAACAGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_MIPEP_ENST00000382172_chr13_24380089_-_MYO16_ENST00000356711_chr13_109507791_+_7513nt
CGGCGTGGGCTGCTGCCTTGGAAACGCGGAGCGCGCGCTCCCAGCGAAAGCAGCAGGGCAGGGATCTGCGTTGGAGGAAGGGACTGCTCT
GGTGCTAGAATGCTGTGCGTCGGAAGGCTGGGCGGCTTGGGAGCCAGAGCAGCAGCTCTGCCGCCCCGCCGGGCGGGCCGGGGAAGCCTC
GAAGCCGGGATCCGGGCCCGAAGGGTCAGCACCAGCTGGTCTCCCGTGGGCGCCGCCTTCAATGTCAAGCCCCAGGGCAGCCGCTTGGAC
CTGTTCGGCGAGCGCCGGGGTCTTTTTGGAGTTCCTGAGCTGAGTGCCCCAGAAGGATTTCATATTGCACAAGAAAAAGCCTTGAGAAAG
ACAGAATTGCTTGTGGACCGTGCATGTTCCACCCCACCTGGGCCCCAGACCGTGCTGATCTTCGATGAGCTCTCGGATTCCTTATGCAGA
GTGGCCGACTTGGCTGATTTTGTGAAAATCGCTCACCCTGAGCCAGCATTCAGAGAAGCTGCGGAAGAAGCTTGTAGAAGTATTGGCACC
ATGGTAGAGAAGTTGAACACAAATGTGGATTTATATCAAAGTTTGCAAAAATTACTAGCTGATAAAAAACTTGTGGATTCCCTTGATCCA
GAAACAAGGCGAGTGGCTGAACTGTTTATGTTTGATTTTGAAATTAGTGGAATCCATCTAGACAAAGAAAAGCGTAAAAGAGCAGTGGAC
CTCAATGTTAAAATCTTGGATTTGAGTAGTACATTTCTTATGGGAACCAATTTTCCCAACAAGATTGAGAAGCATCTCTTACCAGAACAC
ATTCGTCGTAACTTTACATCTGCTGGGGATCATATCATAATTGATGGTCTCCACGCAGAATCACCAGATGACTTGGTGCGAGAAGCTGCT
TATAAAATTTTTCTTTATCCCAATGCTGGTCAATTGAAATGTTTAGAAGAATTGCTCAGCAGCAGAGATCTTCTGGCAAAGTTGGTGGGG
TATTCCACGTTTTCTCACAGGGCTCTCCAAGGAACGATAGCTAAAAATCCAGAGACTGTCATGCAGTTCCTTGAAAAACTATCTGACAAA
CTTTCTGAAAGAACTCTGAAAGATTTTGAGATGATACGAGGGATGAAAATGAAACTGAATCCTCAAAATTCCGAAGTAATGCCCTGGGAC
CCCCCTTACTACAGTGGTGTGATTCGTGCAGAAAGGTATAATATTGAGCCCAGCCTATATTGCCCGTTTTTCTCTCTTGGAGCATGCATG
GAAGGCCTGAATATTTTGCTTAACAGACTGTTGGGGATTTCATTATATGCAGAGCAGCCTGCAAAAGGAGAGGTGTGGAGCGAAGATGTC
CGAAAACTGGCTGTTGTTCATGAATCTGAAGGATTGTTGGGGTACATTTACTGTGATTTTTTTCAGCGAGCAGACAAACCACATCAGGAT
TGCCATTTCACTATCCGTGGAGGCAGACTAAAGGAAGATGGAGACTATCAACTCCCAGTTGTAGTTCTTATGCTGAATCTTCCCCGTTCC
TCAAGGAGTTCTCCAACTTTGCTAACTCCTAGCATGATGGAAAATCTTTTCCATGAAATGGGACATGCCATGCATTCAATGCTAGGACGT
ACTCGTTACCAACACGTCACTGGGACCAGGTGCCCTACTGATTTTGCTGAGGTTCCTTCTATTCTGATGGAGTACTTTGCAAATGATTAT
CGAGTAGTTAACCAATTTGCCAGACATTATCAGACTGGACAGCCACTGCCAAAAAATATGGTGTCTCGTCTTTGTGAATCTAAAAAGGTT
TGTGCTGCAGCTGATATGCAACTTCAGGTCTTTTATGCCACTCTGGATCAAATCTACCATGGGAAGCATCCCCTGAGGAATTCAACCACA
GACATTCTCAAGGAAACACAAGAGAAATTCTATGGCCTACCATATGTTCCAAATACTGTCAAGCTAATGCCTCCTGCCCCAAACGATGAC
CTGGCAACGCTCAGCGAGCTCAATGATGGCAGCCTGCTCTATGAGATTCAGAAGCGCTTTGGGAACAATCAGATCTATACATTCATTGGA
GACATTCTTTTGCTTGTTAACCCATACAAGGAGCTTCCAATTTATTCTTCCATGGTGTCCCAGCTGTATTTCAGCTCCTCAGGGAAGCTG
TGTTCCTCGCTGCCTCCTCACCTCTTCTCCTGTGTGGAGAGAGCCTTTCACCAGCTCTTCCGGGAACAGCGGCCTCAGTGTTTCATCCTC
AGTGGAGAAAGGGGATCAGGAAAGTCTGAAGCCAGCAAACAAATCATAAGACACCTCACCTGCAGGGCTGGCGCCAGCAGGGCCACACTG
GATTCCAGATTCAAACATGTCGTGTGCATCTTAGAAGCCTTTGGACATGCCAAGACCACACTTAATGATTTGTCCAGTTGCTTCATCAAG
TATTTTGAACTGCAGTTCTGTGAGAGGAAACAACAGCTAACCGGAGCCAGAATTTATACATATTTGCTAGAGAAATCCAGACTTGTTTCA
CAACCTCTTGGCCAGAGCAATTTTCTCATTTTCTACTTGTTGATGGATGGGTTATCTGCTGAAGAAAAATATGGACTTCATCTTAATAAT
TTATGTGCACACCGGTATTTGAACCAGACCATACAGGATGATGCATCCACAGGGGAGCGTTCTCTGAACAGGGAGAAATTGGCTGTTTTG
AAACGAGCCCTGAATGTAGTTGGCTTCAGCAGCTTGGAGGTGGAGAATCTGTTCGTAATTCTAGCAGCAATATTGCACCTTGGAGACATT
CGGTTTACTGCCCTGAATGAGGGGAACTCCGCCTTCGTTTCTGACCTCCAGCTCCTGGAACAAGTGGCTGGAATGTTACAAGTATCAACA
GATGAATTGGCATCTGCCTTAACAACTGATATTCAATATTTTAAAGGGGATATGATAATACGACGACATACCATACAGATTGCTGAGTTT
TTCCGAGACCTCTTGGCCAAGTCCCTGTACAGTCGTTTGTTTAGCTTTTTGGTGAATACCATGAATTCTTGCCTCCACAGTCAAGATGAA
CAGAAAAGCATGCAGACATTGGATATTGGAATATTGGACATTTTTGGTTTTGAAGAGTTTCAAAAGAATGAATTTGAACAACTTTGTGTC
AACATGACCAATGAGAAGATGCACCACTATATCAATGAAGTGCTTTTTCTCCACGAGCAAGTGGAATGTGTACAAGAGGGAGTTACCATG
GAAACAGCATATTCTCCTGGTAACCAGAATGGAGTTTTGGACTTTTTTTTCCAGAAGCCATCTGGATTTCTCACCTTATTGGATGAAGAA
AGTCAAATGATTTGGTCAGTGGAATCAAATTTTCCAAAAAAACTACAAAGTCTCCTAGAATCCTCAAACACAAATGCGGTGTACTCCCCC
ATGAAGGATGGGAATGGGAATGTTGCCCTCAAAGACCACGGTACAGCCTTCACCATCATGCACTACGCAGGAAGGGTAATGTATGATGTT
GTTGGGGCGATTGAAAAAAATAAAGACTCCCTTTCACAGAATCTTCTATTTGTAATGAAAACTAGTGAAAATGTCGTGATCAATCATTTG
TTCCAGTCGAAATTGTCACAAACAGGATCCCTCGTATCTGCCTATCCTTCCTTTAAATTCCGAGGACATAAGTCTGCCCTGCTCAGTAAG
AAAATGACAGCTTCTTCAATTATTGGAGAAAACAAGAATTATCTAGAACTTAGTAAGTTATTAAAAAAGAAAGGAACTTCTACATTTCTT
CAAAGATTGGAACGAGGAGATCCAGTCACCATAGCATCACAACTCAGGAAATCACTAATGGATATTATTGGAAAACTTCAGAAGTGCACT
CCACACTTCATTCATTGCATCAGGCCCAATAACTCAAAGCTGCCAGATACTTTTGATAATTTTTACGTGTCTGCTCAGCTACAATATATT
GGGGTCCTGGAGATGGTGAAGATCTTCCGATATGGATACCCTGTTCGCCTTTCCTTCTCGGATTTCCTGTCAAGGTATAAGCCACTGGCT
GATACATTCCTGCGTGAGAAGAAGGAACAGTCAGCTGCCGAGCGATGTCGACTTGTTCTCCAGCAGTGTAAATTACAAGGCTGGCAGATG
GGAGTCCGAAAAGTGTTTCTAAAATACTGGCATGCTGACCAACTCAATGATTTGTGCCTACAGTTGCAGAGAAAAATTATAACCTGCCAA
AAAGTTATCAGAGGATTTTTAGCACGCCAGCACCTGCTTCAGAGAATAAGCATCAGACAACAAGAGGTGACTTCTATCAATAGCTTTCTG
CAGAACACAGAGGACATGGGGCTGAAAACCTACGATGCCCTGGTCATTCAGAATGCTTCAGACATTGCCCGGGAAAATGACCGGCTCCGT
AGTGAAATGAACGCTCCCTACCATAAAGAGAAGTTAGAGGTCAGGAACATGCAAGAGGAAGGAAGCAAAAGAACCGATGACAAGAGTGGA
CCCAGGCATTTCCACCCCAGCTCCATGTCAGTCTGCGCGGCCGTGGATGGCCTGGGCCAGTGCCTCGTTGGCCCGTCCATCTGGTCTCCT
TCGCTGCACTCGGTGTTCAGCATGGATGACAGCAGCAGCCTCCCGTCTCCACGGAAACAGCCCCCGCCCAAGCCAAAGAGGGACCCCAAC
ACCCGGCTGAGTGCTTCCTATGAGGCTGTGAGCGCCTGCCTCTCCGCGGCCAGGGAAGCGGCCAACGAAGCTCTGGCCCGGCCCAGACCG
CACAGCGACGACTACAGCACCATGAAGAAGATTCCTCCTCGAAAGCCCAAGCGCAGCCCCAACACCAAGCTCAGCGGCTCCTACGAGGAG
ATATCGGGGTCCCGGCCCGGGGACGCGAGGCCCGCGGGCGCCCCGGGGGCAGCAGCGCGCGTTCTGACCCCCGGGACTCCGCAGTGCGCG
CTGCCCCCGGCGGCGCCTCCGGGTGACGAGGACGACAGCGAGCCTGTGTACATCGAGATGCTGGGGCACGCGGCCAGGCCCGATAGCCCG
GACCCCGGGGAGTCCGTGTACGAGGAGATGAAGTGTTGCCTGCCCGACGACGGCGGCCCGGGCGCGGGCTCCTTCCTGCTCCACGGCGCA
TCGCCGCCCCTGCTCCACCGCGCGCCGGAGGACGAGGCGGCGGGGCCCCCAGGGGACGCGTGCGACATCCCGCCGCCCTTCCCCAACCTG
CTGCCGCACCGGCCGCCCCTGCTGGTGTTCCCCCCGACCCCCGTCACCTGCTCCCCCGCCTCCGACGAGTCGCCCCTGACACCCCTGGAG
GTGAAGAAGCTGCCAGTCCTGGAGACCAACCTCAAGTACCCCGTGCAGCCGGAGGGGTCGAGCCCGCTGTCCCCGCAGTACTCCAAGAGC
CAGAAGGGCGACGGCGACAGGCCCGCGTCCCCCGGCCTGGCGCTGTTCAACGGGTCCGGCCGAGCCTCCCCGCCGTCCACGCCGCCCCCG
CCCCCGCCCCCGCCCGGGCCGCCCCCCGCGCCCTACAGGCCCTGCGCGCACTTGGCCTTCCCGCCGGAGCCCGCCCCGGTGAACGCGGGG
AAAGCGGGGCCGAGCGCAGAGGCGCCCAAGGTTCACCCAAAGCCAAACTCTGCCCCCGTGGCCGGGCCCTGCAGCTCCTTCCCCAAGATC
CCATATTCCCCCGTGAAGGCCACCAGGGCGGACGCCAGGAAGGCCGGCTCCAGTGCCTCGCCCCCCGCGCCCTACAGCCCTCCCAGCTCC
AGGCCTCTCAGCAGCCCCCTGGACGAGCTCGCCAGCCTCTTCAACTCGGGGAGGAGTGTGCTTCGGAAATCCGCGGCGGGAAGAAAAATC
AGGGAAGCAGAAGGTTTTGAAACTAACATGAACATAAGTAGCCGAGATGACCCTAGTACGTCAGAAATTACTTCCGAGACTCAAGACAGA
AATGCAAATAACCATGGAATTCAGTTATCTAATTCACTATCTAGTGCTATAACTGCTGAAAATGGAAATTCCATCTCAAATGGTTTACCT
GAAGAAGATGGATACTCACGGTTGTCTATAAGTGGCACAGGGACTTCGACATTTCAAAGACACAGGGACAGTCACACCACTCAGGTAATC
CATCAGCTGAGGCTCTCAGAGAATGAAAGTGTGGCCCTGCAGGAACTCTTGGACTGGAGGAGAAAGCTCTGTGAGGAAGGACAAGACTGG
CAGCAGATCCTGCACCACGCTGAGCCCAGGGTGCCTCCCCCACCACCTTGCAAGAAGCCCAGCCTTCTGAAGAAGCCGGAAGGGGCCTCC
TGCAACAGGCTGCCGTCTGAGCTCTGGGACACCACCATTTGATGTGGCCTGAACTGCAGACTTACAAAATAGAACTGCCTACTGATTCCG
GGCTGCAACAACAGAAGGCTGCCTTCTGACATGCGCTGGGGCTTCTCTCCACGCATTTAGACAAAAAAAGCACAGGACACAGACACTAAA
TATATGAGATCCCGTGTGTGTGTGTGTGTGTTTGTGTGTGTGTGTGTGGGTTCTTTCTTATCCATCTCGTGGTGATACACTCTGATTTTC
AAGCTCCTCATTTACGGCTCTGTGCTACCCCTAGGTAGCAAGAGAGAGGCTGGGAAAAGTGTGGACGTGGCCAGAGCGAGAGAGTAGCGG
AGGAAAGGAGCAATCCATGCACACTCTGTACAGTTGTTTTTCTACGGTTCAACAGTCTGTTTATTGTACTTCCAATGGTTTTATTATAAT
ACAGTATACGGGACATATATTTTATTTCTTTGTAGCTACTTGTGTTTTATTGGTATTATAAACCTGATAATTATTTACATGTTTATTACT
GTAATTTTATAAATTTATGCAATTGGTGGTGCTTCCTTTCTTCAAAATACAGATTTTAAAAAATCATTTCTAGATTATTTTTTTCCTCCA
CAGTCCTTTTTTTTCACCTAACGCACCTAAATCTTGAAACTACATTGTTGTTTTAGCTTCGCCAGTGTCACCCCTTGCAAAACTATGAAT
TGAGCCCCATGTTTTAGGTGTTACTCATGGATGAGGAGGCTGTTCTTTCCTATGCCCTGTATTTCTGGATAAGTGGATTGTGTACCCTTT
AGTTAAATTTCACCTCCCGACTTCAGCATAGATCACAGGAAATCACATGGCACACGGTTAAACACGTATGGCTTCAAATCCATAGCCGGT
GGTGTAAAATGATCATATTCATTCAAAGGCCTACACAGTACAAATGAGCACGCTGCCATGTACTGGTTTGAGCAGTAGGGGCTGCATCGC
ACAGCGCTCGTCCCCCGGGACTTACACTGCATGATTCCCTCACTGTATATCCTCAACCCTCCCATAATGCAAGGCCTTGTTCATTGATGT
GCTTTCGTCGGCTGTCGGAAAGTTCTGAGCAGTGGCTCCAGACCACCTTGTCTTGCTACTTGGAACTTTTTATTCATACCAGCCTTTGAA

>In-frame_MIPEP_ENST00000382172_chr13_24380089_-_MYO16_ENST00000251041_chr13_109507791_+_4216nt
CGGCGTGGGCTGCTGCCTTGGAAACGCGGAGCGCGCGCTCCCAGCGAAAGCAGCAGGGCAGGGATCTGCGTTGGAGGAAGGGACTGCTCT
GGTGCTAGAATGCTGTGCGTCGGAAGGCTGGGCGGCTTGGGAGCCAGAGCAGCAGCTCTGCCGCCCCGCCGGGCGGGCCGGGGAAGCCTC
GAAGCCGGGATCCGGGCCCGAAGGGTCAGCACCAGCTGGTCTCCCGTGGGCGCCGCCTTCAATGTCAAGCCCCAGGGCAGCCGCTTGGAC
CTGTTCGGCGAGCGCCGGGGTCTTTTTGGAGTTCCTGAGCTGAGTGCCCCAGAAGGATTTCATATTGCACAAGAAAAAGCCTTGAGAAAG
ACAGAATTGCTTGTGGACCGTGCATGTTCCACCCCACCTGGGCCCCAGACCGTGCTGATCTTCGATGAGCTCTCGGATTCCTTATGCAGA
GTGGCCGACTTGGCTGATTTTGTGAAAATCGCTCACCCTGAGCCAGCATTCAGAGAAGCTGCGGAAGAAGCTTGTAGAAGTATTGGCACC
ATGGTAGAGAAGTTGAACACAAATGTGGATTTATATCAAAGTTTGCAAAAATTACTAGCTGATAAAAAACTTGTGGATTCCCTTGATCCA
GAAACAAGGCGAGTGGCTGAACTGTTTATGTTTGATTTTGAAATTAGTGGAATCCATCTAGACAAAGAAAAGCGTAAAAGAGCAGTGGAC
CTCAATGTTAAAATCTTGGATTTGAGTAGTACATTTCTTATGGGAACCAATTTTCCCAACAAGATTGAGAAGCATCTCTTACCAGAACAC
ATTCGTCGTAACTTTACATCTGCTGGGGATCATATCATAATTGATGGTCTCCACGCAGAATCACCAGATGACTTGGTGCGAGAAGCTGCT
TATAAAATTTTTCTTTATCCCAATGCTGGTCAATTGAAATGTTTAGAAGAATTGCTCAGCAGCAGAGATCTTCTGGCAAAGTTGGTGGGG
TATTCCACGTTTTCTCACAGGGCTCTCCAAGGAACGATAGCTAAAAATCCAGAGACTGTCATGCAGTTCCTTGAAAAACTATCTGACAAA
CTTTCTGAAAGAACTCTGAAAGATTTTGAGATGATACGAGGGATGAAAATGAAACTGAATCCTCAAAATTCCGAAGTAATGCCCTGGGAC
CCCCCTTACTACAGTGGTGTGATTCGTGCAGAAAGGTATAATATTGAGCCCAGCCTATATTGCCCGTTTTTCTCTCTTGGAGCATGCATG
GAAGGCCTGAATATTTTGCTTAACAGACTGTTGGGGATTTCATTATATGCAGAGCAGCCTGCAAAAGGAGAGGTGTGGAGCGAAGATGTC
CGAAAACTGGCTGTTGTTCATGAATCTGAAGGATTGTTGGGGTACATTTACTGTGATTTTTTTCAGCGAGCAGACAAACCACATCAGGAT
TGCCATTTCACTATCCGTGGAGGCAGACTAAAGGAAGATGGAGACTATCAACTCCCAGTTGTAGTTCTTATGCTGAATCTTCCCCGTTCC
TCAAGGAGTTCTCCAACTTTGCTAACTCCTAGCATGATGGAAAATCTTTTCCATGAAATGGGACATGCCATGCATTCAATGCTAGGACGT
ACTCGTTACCAACACGTCACTGGGACCAGGTGCCCTACTGATTTTGCTGAGGTTCCTTCTATTCTGATGGAGTACTTTGCAAATGATTAT
CGAGTAGTTAACCAATTTGCCAGACATTATCAGACTGGACAGCCACTGCCAAAAAATATGGTGTCTCGTCTTTGTGAATCTAAAAAGGTT
TGTGCTGCAGCTGATATGCAACTTCAGGTCTTTTATGCCACTCTGGATCAAATCTACCATGGGAAGCATCCCCTGAGGAATTCAACCACA
GACATTCTCAAGGAAACACAAGAGAAATTCTATGGCCTACCATATGTTCCAAATACTGTCAAGCTAATGCCTCCTGCCCCAAACGATGAC
CTGGCAACGCTCAGCGAGCTCAATGATGGCAGCCTGCTCTATGAGATTCAGAAGCGCTTTGGGAACAATCAGATCTATACATTCATTGGA
GACATTCTTTTGCTTGTTAACCCATACAAGGAGCTTCCAATTTATTCTTCCATGGTGTCCCAGCTGTATTTCAGCTCCTCAGGGAAGCTG
TGTTCCTCGCTGCCTCCTCACCTCTTCTCCTGTGTGGAGAGAGCCTTTCACCAGCTCTTCCGGGAACAGCGGCCTCAGTGTTTCATCCTC
AGTGGAGAAAGGGGATCAGGAAAGTCTGAAGCCAGCAAACAAATCATAAGACACCTCACCTGCAGGGCTGGCGCCAGCAGGGCCACACTG
GATTCCAGATTCAAACATGTCGTGTGCATCTTAGAAGCCTTTGGACATGCCAAGACCACACTTAATGATTTGTCCAGTTGCTTCATCAAG
TATTTTGAACTGCAGTTCTGTGAGAGGAAACAACAGCTAACCGGAGCCAGAATTTATACATATTTGCTAGAGAAATCCAGACTTGTTTCA
CAACCTCTTGGCCAGAGCAATTTTCTCATTTTCTACTTGTTGATGGATGGGTTATCTGCTGAAGAAAAATATGGACTTCATCTTAATAAT
TTATGTGCACACCGGTATTTGAACCAGACCATACAGGATGATGCATCCACAGGGGAGCGTTCTCTGAACAGGGAGAAATTGGCTGTTTTG
AAACGAGCCCTGAATGTAGTTGGCTTCAGCAGCTTGGAGGTGGAGAATCTGTTCGTAATTCTAGCAGCAATATTGCACCTTGGAGACATT
CGGTTTACTGCCCTGAATGAGGGGAACTCCGCCTTCGTTTCTGACCTCCAGCTCCTGGAACAAGTGGCTGGAATGTTACAAGTATCAACA
GATGAATTGGCATCTGCCTTAACAACTGATATTCAATATTTTAAAGGGGATATGATAATACGACGACATACCATACAGATTGCTGAGTTT
TTCCGAGACCTCTTGGCCAAGTCCCTGTACAGTCGTTTGTTTAGCTTTTTGGTGAATACCATGAATTCTTGCCTCCACAGTCAAGATGAA
CAGAAAAGCATGCAGACATTGGATATTGGAATATTGGACATTTTTGGTTTTGAAGAGTTTCAAAAGAATGAATTTGAACAACTTTGTGTC
AACATGACCAATGAGAAGATGCACCACTATATCAATGAAGTGCTTTTTCTCCACGAGCAAGTGGAATGTGTACAAGAGGGAGTTACCATG
GAAACAGCATATTCTCCTGGTAACCAGAATGGAGTTTTGGACTTTTTTTTCCAGAAGCCATCTGGATTTCTCACCTTATTGGATGAAGAA
AGTCAAATGATTTGGTCAGTGGAATCAAATTTTCCAAAAAAACTACAAAGTCTCCTAGAATCCTCAAACACAAATGCGGTGTACTCCCCC
ATGAAGGATGGGAATGGGAATGTTGCCCTCAAAGACCACGGTACAGCCTTCACCATCATGCACTACGCAGGAAGGGTAATGTATGATGTT
GTTGGGGCGATTGAAAAAAATAAAGACTCCCTTTCACAGAATCTTCTATTTGTAATGAAAAGAGGAAGGTGCTTCTGAGCAAAAGGACAG
AATTTACAATGTACCCTTTTGTATTTATACAGGAGGTGTCAGATTTTTTTTTTTGTAAAGGGCTAGAGAATAAATATTTTAGACCTTGTG
CACCATAAGATCCTTGTTGCAGTTACTCACCTCTGCTGTTATAATGTGAAAAACAGCTGTAGACAATACAAATGGATGTGACTGTATTCT
GATAAAATTTTATTTACAAAAACAGGCAGTGGGCCATGTTTGGCTCAGGAGCCATGATTGCTCACTCACTCTATCATAAAAGCAAAATAT
TTGTGGTTGCCATCATGTTTTATGAATCTGTGAAATACTTTGATGCTTGTACATATTTATTAAAAGCAAGTGTAATTCATAAATAATAAT
TTTTATTTGCAGGTACTTTGCTTATAGTATCTAATTCAATTTTCGTAGCATCAAAAAGCTCCCAGTTGAGGAAGATGGTGAGGTCTGTTG
TAGAATGTACACAAGCAGAGCTGAGTCTCTGAGACCACTAACCAGGTACAGTCAGGGAGCTTGGAGACAGCTCATAGAGACACACAGCAA

>In-frame_MIPEP_ENST00000382172_chr13_24380089_-_MYO16_ENST00000357550_chr13_109507791_+_7499nt
CGGCGTGGGCTGCTGCCTTGGAAACGCGGAGCGCGCGCTCCCAGCGAAAGCAGCAGGGCAGGGATCTGCGTTGGAGGAAGGGACTGCTCT
GGTGCTAGAATGCTGTGCGTCGGAAGGCTGGGCGGCTTGGGAGCCAGAGCAGCAGCTCTGCCGCCCCGCCGGGCGGGCCGGGGAAGCCTC
GAAGCCGGGATCCGGGCCCGAAGGGTCAGCACCAGCTGGTCTCCCGTGGGCGCCGCCTTCAATGTCAAGCCCCAGGGCAGCCGCTTGGAC
CTGTTCGGCGAGCGCCGGGGTCTTTTTGGAGTTCCTGAGCTGAGTGCCCCAGAAGGATTTCATATTGCACAAGAAAAAGCCTTGAGAAAG
ACAGAATTGCTTGTGGACCGTGCATGTTCCACCCCACCTGGGCCCCAGACCGTGCTGATCTTCGATGAGCTCTCGGATTCCTTATGCAGA
GTGGCCGACTTGGCTGATTTTGTGAAAATCGCTCACCCTGAGCCAGCATTCAGAGAAGCTGCGGAAGAAGCTTGTAGAAGTATTGGCACC
ATGGTAGAGAAGTTGAACACAAATGTGGATTTATATCAAAGTTTGCAAAAATTACTAGCTGATAAAAAACTTGTGGATTCCCTTGATCCA
GAAACAAGGCGAGTGGCTGAACTGTTTATGTTTGATTTTGAAATTAGTGGAATCCATCTAGACAAAGAAAAGCGTAAAAGAGCAGTGGAC
CTCAATGTTAAAATCTTGGATTTGAGTAGTACATTTCTTATGGGAACCAATTTTCCCAACAAGATTGAGAAGCATCTCTTACCAGAACAC
ATTCGTCGTAACTTTACATCTGCTGGGGATCATATCATAATTGATGGTCTCCACGCAGAATCACCAGATGACTTGGTGCGAGAAGCTGCT
TATAAAATTTTTCTTTATCCCAATGCTGGTCAATTGAAATGTTTAGAAGAATTGCTCAGCAGCAGAGATCTTCTGGCAAAGTTGGTGGGG
TATTCCACGTTTTCTCACAGGGCTCTCCAAGGAACGATAGCTAAAAATCCAGAGACTGTCATGCAGTTCCTTGAAAAACTATCTGACAAA
CTTTCTGAAAGAACTCTGAAAGATTTTGAGATGATACGAGGGATGAAAATGAAACTGAATCCTCAAAATTCCGAAGTAATGCCCTGGGAC
CCCCCTTACTACAGTGGTGTGATTCGTGCAGAAAGGTATAATATTGAGCCCAGCCTATATTGCCCGTTTTTCTCTCTTGGAGCATGCATG
GAAGGCCTGAATATTTTGCTTAACAGACTGTTGGGGATTTCATTATATGCAGAGCAGCCTGCAAAAGGAGAGGTGTGGAGCGAAGATGTC
CGAAAACTGGCTGTTGTTCATGAATCTGAAGGATTGTTGGGGTACATTTACTGTGATTTTTTTCAGCGAGCAGACAAACCACATCAGGAT
TGCCATTTCACTATCCGTGGAGGCAGACTAAAGGAAGATGGAGACTATCAACTCCCAGTTGTAGTTCTTATGCTGAATCTTCCCCGTTCC
TCAAGGAGTTCTCCAACTTTGCTAACTCCTAGCATGATGGAAAATCTTTTCCATGAAATGGGACATGCCATGCATTCAATGCTAGGACGT
ACTCGTTACCAACACGTCACTGGGACCAGGTGCCCTACTGATTTTGCTGAGGTTCCTTCTATTCTGATGGAGTACTTTGCAAATGATTAT
CGAGTAGTTAACCAATTTGCCAGACATTATCAGACTGGACAGCCACTGCCAAAAAATATGGTGTCTCGTCTTTGTGAATCTAAAAAGGTT
TGTGCTGCAGCTGATATGCAACTTCAGGTCTTTTATGCCACTCTGGATCAAATCTACCATGGGAAGCATCCCCTGAGGAATTCAACCACA
GACATTCTCAAGGAAACACAAGAGAAATTCTATGGCCTACCATATGTTCCAAATACTGTCAAGCTAATGCCTCCTGCCCCAAACGATGAC
CTGGCAACGCTCAGCGAGCTCAATGATGGCAGCCTGCTCTATGAGATTCAGAAGCGCTTTGGGAACAATCAGATCTATACATTCATTGGA
GACATTCTTTTGCTTGTTAACCCATACAAGGAGCTTCCAATTTATTCTTCCATGGTGTCCCAGCTGTATTTCAGCTCCTCAGGGAAGCTG
TGTTCCTCGCTGCCTCCTCACCTCTTCTCCTGTGTGGAGAGAGCCTTTCACCAGCTCTTCCGGGAACAGCGGCCTCAGTGTTTCATCCTC
AGTGGAGAAAGGGGATCAGGAAAGTCTGAAGCCAGCAAACAAATCATAAGACACCTCACCTGCAGGGCTGGCGCCAGCAGGGCCACACTG
GATTCCAGATTCAAACATGTCGTGTGCATCTTAGAAGCCTTTGGACATGCCAAGACCACACTTAATGATTTGTCCAGTTGCTTCATCAAG
TATTTTGAACTGCAGTTCTGTGAGAGGAAACAACAGCTAACCGGAGCCAGAATTTATACATATTTGCTAGAGAAATCCAGACTTGTTTCA
CAACCTCTTGGCCAGAGCAATTTTCTCATTTTCTACTTGTTGATGGATGGGTTATCTGCTGAAGAAAAATATGGACTTCATCTTAATAAT
TTATGTGCACACCGGTATTTGAACCAGACCATACAGGATGATGCATCCACAGGGGAGCGTTCTCTGAACAGGGAGAAATTGGCTGTTTTG
AAACGAGCCCTGAATGTAGTTGGCTTCAGCAGCTTGGAGGTGGAGAATCTGTTCGTAATTCTAGCAGCAATATTGCACCTTGGAGACATT
CGGTTTACTGCCCTGAATGAGGGGAACTCCGCCTTCGTTTCTGACCTCCAGCTCCTGGAACAAGTGGCTGGAATGTTACAAGTATCAACA
GATGAATTGGCATCTGCCTTAACAACTGATATTCAATATTTTAAAGGGGATATGATAATACGACGACATACCATACAGATTGCTGAGTTT
TTCCGAGACCTCTTGGCCAAGTCCCTGTACAGTCGTTTGTTTAGCTTTTTGGTGAATACCATGAATTCTTGCCTCCACAGTCAAGATGAA
CAGAAAAGCATGCAGACATTGGATATTGGAATATTGGACATTTTTGGTTTTGAAGAGTTTCAAAAGAATGAATTTGAACAACTTTGTGTC
AACATGACCAATGAGAAGATGCACCACTATATCAATGAAGTGCTTTTTCTCCACGAGCAAGTGGAATGTGTACAAGAGGGAGTTACCATG
GAAACAGCATATTCTCCTGGTAACCAGAATGGAGTTTTGGACTTTTTTTTCCAGAAGCCATCTGGATTTCTCACCTTATTGGATGAAGAA
AGTCAAATGATTTGGTCAGTGGAATCAAATTTTCCAAAAAAACTACAAAGTCTCCTAGAATCCTCAAACACAAATGCGGTGTACTCCCCC
ATGAAGGATGGGAATGGGAATGTTGCCCTCAAAGACCACGGTACAGCCTTCACCATCATGCACTACGCAGGAAGGGTAATGTATGATGTT
GTTGGGGCGATTGAAAAAAATAAAGACTCCCTTTCACAGAATCTTCTATTTGTAATGAAAACTAGTGAAAATGTCGTGATCAATCATTTG
TTCCAGTCGAAATTGTCACAAACAGGATCCCTCGTATCTGCCTATCCTTCCTTTAAATTCCGAGGACATAAGTCTGCCCTGCTCAGTAAG
AAAATGACAGCTTCTTCAATTATTGGAGAAAACAAGAATTATCTAGAACTTAGTAAGTTATTAAAAAAGAAAGGAACTTCTACATTTCTT
CAAAGATTGGAACGAGGAGATCCAGTCACCATAGCATCACAACTCAGGAAATCACTAATGGATATTATTGGAAAACTTCAGAAGTGCACT
CCACACTTCATTCATTGCATCAGGCCCAATAACTCAAAGCTGCCAGATACTTTTGATAATTTTTACGTGTCTGCTCAGCTACAATATATT
GGGGTCCTGGAGATGGTGAAGATCTTCCGATATGGATACCCTGTTCGCCTTTCCTTCTCGGATTTCCTGTCAAGGTATAAGCCACTGGCT
GATACATTCCTGCGTGAGAAGAAGGAACAGTCAGCTGCCGAGCGATGTCGACTTGTTCTCCAGCAGTGTAAATTACAAGGCTGGCAGATG
GGAGTCCGAAAAGTGTTTCTAAAATACTGGCATGCTGACCAACTCAATGATTTGTGCCTACAGTTGCAGAGAAAAATTATAACCTGCCAA
AAAGTTATCAGAGGATTTTTAGCACGCCAGCACCTGCTTCAGAGAATAAGCATCAGACAACAAGAGGTGACTTCTATCAATAGCTTTCTG
CAGAACACAGAGGACATGGGGCTGAAAACCTACGATGCCCTGGTCATTCAGAATGCTTCAGACATTGCCCGGGAAAATGACCGGCTCCGT
AGTGAAATGAACGCTCCCTACCATAAAGAGAAGTTAGAGGTCAGGAACATGCAAGAGGAAGGAAGCAAAAGAACCGATGACAAGAGTGGA
CCCAGGCATTTCCACCCCAGCTCCATGTCAGTCTGCGCGGCCGTGGATGGCCTGGGCCAGTGCCTCGTTGGCCCGTCCATCTGGTCTCCT
TCGCTGCACTCGGTGTTCAGCATGGATGACAGCAGCAGCCTCCCGTCTCCACGGAAACAGCCCCCGCCCAAGCCAAAGAGGGACCCCAAC
ACCCGGCTGAGTGCTTCCTATGAGGCTGTGAGCGCCTGCCTCTCCGCGGCCAGGGAAGCGGCCAACGAAGCTCTGGCCCGGCCCAGACCG
CACAGCGACGACTACAGCACCATGAAGAAGATTCCTCCTCGAAAGCCCAAGCGCAGCCCCAACACCAAGCTCAGCGGCTCCTACGAGGAG
ATATCGGGGTCCCGGCCCGGGGACGCGAGGCCCGCGGGCGCCCCGGGGGCAGCAGCGCGCGTTCTGACCCCCGGGACTCCGCAGTGCGCG
CTGCCCCCGGCGGCGCCTCCGGGTGACGAGGACGACAGCGAGCCTGTGTACATCGAGATGCTGGGGCACGCGGCCAGGCCCGATAGCCCG
GACCCCGGGGAGTCCGTGTACGAGGAGATGAAGTGTTGCCTGCCCGACGACGGCGGCCCGGGCGCGGGCTCCTTCCTGCTCCACGGCGCA
TCGCCGCCCCTGCTCCACCGCGCGCCGGAGGACGAGGCGGCGGGGCCCCCAGGGGACGCGTGCGACATCCCGCCGCCCTTCCCCAACCTG
CTGCCGCACCGGCCGCCCCTGCTGGTGTTCCCCCCGACCCCCGTCACCTGCTCCCCCGCCTCCGACGAGTCGCCCCTGACACCCCTGGAG
GTGAAGAAGCTGCCAGTCCTGGAGACCAACCTCAAGTACCCCGTGCAGCCGGAGGGGTCGAGCCCGCTGTCCCCGCAGTACTCCAAGAGC
CAGAAGGGCGACGGCGACAGGCCCGCGTCCCCCGGCCTGGCGCTGTTCAACGGGTCCGGCCGAGCCTCCCCGCCGTCCACGCCGCCCCCG
CCCCCGCCCCCGCCCGGGCCGCCCCCCGCGCCCTACAGGCCCTGCGCGCACTTGGCCTTCCCGCCGGAGCCCGCCCCGGTGAACGCGGGG
AAAGCGGGGCCGAGCGCAGAGGCGCCCAAGGTTCACCCAAAGCCAAACTCTGCCCCCGTGGCCGGGCCCTGCAGCTCCTTCCCCAAGATC
CCATATTCCCCCGTGAAGGCCACCAGGGCGGACGCCAGGAAGGCCGGCTCCAGTGCCTCGCCCCCCGCGCCCTACAGCCCTCCCAGCTCC
AGGCCTCTCAGCAGCCCCCTGGACGAGCTCGCCAGCCTCTTCAACTCGGGGAGGAGTGTGCTTCGGAAATCCGCGGCGGGAAGAAAAATC
AGGGAAGCAGAAGGTTTTGAAACTAACATGAACATAAGTAGCCGAGATGACCCTAGTACGTCAGAAATTACTTCCGAGACTCAAGACAGA
AATGCAAATAACCATGGAATTCAGTTATCTAATTCACTATCTAGTGCTATAACTGCTGAAAATGGAAATTCCATCTCAAATGGTTTACCT
GAAGAAGATGGATACTCACGGTTGTCTATAAGTGGCACAGGGACTTCGACATTTCAAAGACACAGGGACAGTCACACCACTCAGGTAATC
CATCAGCTGAGGCTCTCAGAGAATGAAAGTGTGGCCCTGCAGGAACTCTTGGACTGGAGGAGAAAGCTCTGTGAGGAAGGACAAGACTGG
CAGCAGATCCTGCACCACGCTGAGCCCAGGGTGCCTCCCCCACCACCTTGCAAGAAGCCCAGCCTTCTGAAGAAGCCGGAAGGGGCCTCC
TGCAACAGGCTGCCGTCTGAGCTCTGGGACACCACCATTTGATGTGGCCTGAACTGCAGACTTACAAAATAGAACTGCCTACTGATTCCG
GGCTGCAACAACAGAAGGCTGCCTTCTGACATGCGCTGGGGCTTCTCTCCACGCATTTAGACAAAAAAAGCACAGGACACAGACACTAAA
TATATGAGATCCCGTGTGTGTGTGTGTGTGTTTGTGTGTGTGTGTGTGGGTTCTTTCTTATCCATCTCGTGGTGATACACTCTGATTTTC
AAGCTCCTCATTTACGGCTCTGTGCTACCCCTAGGTAGCAAGAGAGAGGCTGGGAAAAGTGTGGACGTGGCCAGAGCGAGAGAGTAGCGG
AGGAAAGGAGCAATCCATGCACACTCTGTACAGTTGTTTTTCTACGGTTCAACAGTCTGTTTATTGTACTTCCAATGGTTTTATTATAAT
ACAGTATACGGGACATATATTTTATTTCTTTGTAGCTACTTGTGTTTTATTGGTATTATAAACCTGATAATTATTTACATGTTTATTACT
GTAATTTTATAAATTTATGCAATTGGTGGTGCTTCCTTTCTTCAAAATACAGATTTTAAAAAATCATTTCTAGATTATTTTTTTCCTCCA
CAGTCCTTTTTTTTCACCTAACGCACCTAAATCTTGAAACTACATTGTTGTTTTAGCTTCGCCAGTGTCACCCCTTGCAAAACTATGAAT
TGAGCCCCATGTTTTAGGTGTTACTCATGGATGAGGAGGCTGTTCTTTCCTATGCCCTGTATTTCTGGATAAGTGGATTGTGTACCCTTT
AGTTAAATTTCACCTCCCGACTTCAGCATAGATCACAGGAAATCACATGGCACACGGTTAAACACGTATGGCTTCAAATCCATAGCCGGT
GGTGTAAAATGATCATATTCATTCAAAGGCCTACACAGTACAAATGAGCACGCTGCCATGTACTGGTTTGAGCAGTAGGGGCTGCATCGC
ACAGCGCTCGTCCCCCGGGACTTACACTGCATGATTCCCTCACTGTATATCCTCAACCCTCCCATAATGCAAGGCCTTGTTCATTGATGT
GCTTTCGTCGGCTGTCGGAAAGTTCTGAGCAGTGGCTCCAGACCACCTTGTCTTGCTACTTGGAACTTTTTATTCATACCAGCCTTTGAA


Top

FusionGenePPI for MIPEP_MYO16


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MIPEPILK, MAPK6, CUL3, MYC, HTT, FOXS1, MRM1, LOC554223, NME4, PAK7, CISD3, CDC42SE1, MGME1, FOXRED2, WDTC1, DCTN1, SPINK2, INA, EXOC3L2, HSDL2, TMEM70, ADPGK, DEFA6, TRIM43, GRPRMYO16NRXN1, NCKAP1, CYFIP2, CYFIP1, PIK3R1, ARHGAP26, ACOT9


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MIPEP_MYO16


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MIPEP_MYO16


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneMYO16C0036341Schizophrenia1PSYGENET