FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21545

FusionGeneSummary for MED24_PPP1R1B

check button Fusion gene summary
Fusion gene informationFusion gene name: MED24_PPP1R1B
Fusion gene ID: 21545
HgeneTgene
Gene symbol

MED24

PPP1R1B

Gene ID

9862

84152

Gene namemediator complex subunit 24protein phosphatase 1 regulatory inhibitor subunit 1B
SynonymsARC100|CRSP100|CRSP4|DRIP100|MED5|THRAP4|TRAP100DARPP-32|DARPP32
Cytomap

17q21.1

17q12

Type of geneprotein-codingprotein-coding
Descriptionmediator of RNA polymerase II transcription subunit 24CRSP complex subunit 4activator-recruited cofactor 100 kDa componentcofactor required for Sp1 transcriptional activation subunit 4cofactor required for Sp1 transcriptional activation, subunit 4, 10protein phosphatase 1 regulatory subunit 1Bdopamine and cAMP-regulated neuronal phosphoprotein 32
Modification date2018052320180527
UniProtAcc

O75448

Q9UD71

Ensembl transtripts involved in fusion geneENST00000394126, ENST00000356271, 
ENST00000394128, ENST00000394127, 
ENST00000501516, ENST00000479829, 
ENST00000580825, ENST00000254079, 
ENST00000579000, ENST00000394265, 
ENST00000394267, 
Fusion gene scores* DoF score14 X 9 X 8=100810 X 5 X 11=550
# samples 1519
** MAII scorelog2(15/1008*10)=-2.74846123300404
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(19/550*10)=-1.53343220008107
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MED24 [Title/Abstract] AND PPP1R1B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMED24

GO:0006367

transcription initiation from RNA polymerase II promoter

12218053

HgeneMED24

GO:0030518

intracellular steroid hormone receptor signaling pathway

11867769

HgeneMED24

GO:0030521

androgen receptor signaling pathway

12218053

HgeneMED24

GO:0045893

positive regulation of transcription, DNA-templated

10198638

TgenePPP1R1B

GO:0032515

negative regulation of phosphoprotein phosphatase activity

10807923


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDHNSCTCGA-DQ-7589-01AMED24chr17

38182409

-PPP1R1Bchr17

37791860

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000394126ENST00000580825MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000394126ENST00000254079MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000394126ENST00000579000MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000394126ENST00000394265MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000394126ENST00000394267MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000356271ENST00000580825MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000356271ENST00000254079MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000356271ENST00000579000MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000356271ENST00000394265MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000356271ENST00000394267MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000394128ENST00000580825MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000394128ENST00000254079MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000394128ENST00000579000MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000394128ENST00000394265MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000394128ENST00000394267MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
In-frameENST00000394127ENST00000580825MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
In-frameENST00000394127ENST00000254079MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
In-frameENST00000394127ENST00000579000MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
In-frameENST00000394127ENST00000394265MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
In-frameENST00000394127ENST00000394267MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000501516ENST00000580825MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000501516ENST00000254079MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000501516ENST00000579000MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000501516ENST00000394265MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
Frame-shitENST00000501516ENST00000394267MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
intron-3CDSENST00000479829ENST00000580825MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
intron-3CDSENST00000479829ENST00000254079MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
intron-3CDSENST00000479829ENST00000579000MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
intron-3CDSENST00000479829ENST00000394265MED24chr17

38182409

-PPP1R1Bchr17

37791860

+
intron-3CDSENST00000479829ENST00000394267MED24chr17

38182409

-PPP1R1Bchr17

37791860

+

Top

FusionProtFeatures for MED24_PPP1R1B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MED24

O75448

PPP1R1B

Q9UD71

Component of the Mediator complex, a coactivatorinvolved in the regulated transcription of nearly all RNApolymerase II-dependent genes. Mediator functions as a bridge toconvey information from gene-specific regulatory proteins to thebasal RNA polymerase II transcription machinery. Mediator isrecruited to promoters by direct interactions with regulatoryproteins and serves as a scaffold for the assembly of a functionalpreinitiation complex with RNA polymerase II and the generaltranscription factors. {ECO:0000269|PubMed:12218053,ECO:0000269|PubMed:16595664}. Inhibitor of protein-phosphatase 1.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for MED24_PPP1R1B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000580825_chr17_37791860_+_705aa
MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKTAISSQFDDFSRDLCVQALLDIMDM
FCDRLSCHGKAEECIGLCRALLSALHWLLRCTAASAERLREGLEAGTPAAGEKQLAMCLQRLEKTLSSTKNRALLHIAKLEEASSWTAIE
HSLLKLGEILANLSNPQLRSQAEQCGTLIRSIPTMLSVHAEQMHKTGFPTVHAVILLEGTMNLTGETQSLVEQLTMVKRMQHIPTPLFVL
EIWKACFVGLIESPEGTEELKWTAFTFLKIPQVLVKLKKYSHGDKDFTEDVNCAFEFLLKLTPLLDKADQRCNCDCTNFLLQECGKQGLL
SEASVNNLMAKRKADREHAPQQKSGENANIQPNIQLILRAEPTVTNILKTMDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKS
FARKFINLNEFTTTGSEESTKPASVRALLFDISFLMLCHVAQTTGSEVILSESRTGAEVPFFETWMQTCMPEEGKILNPDHPCFRPDSTK
VESLVALLNNSSEMKLVQMKWHEACLSISAAILEILNAWENGVLAFESIQKITDNIKGKVCSLAVCAVAWLVAHVRMLGLDEREKSLQMI

>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000254079_chr17_37791860_+_705aa
MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKTAISSQFDDFSRDLCVQALLDIMDM
FCDRLSCHGKAEECIGLCRALLSALHWLLRCTAASAERLREGLEAGTPAAGEKQLAMCLQRLEKTLSSTKNRALLHIAKLEEASSWTAIE
HSLLKLGEILANLSNPQLRSQAEQCGTLIRSIPTMLSVHAEQMHKTGFPTVHAVILLEGTMNLTGETQSLVEQLTMVKRMQHIPTPLFVL
EIWKACFVGLIESPEGTEELKWTAFTFLKIPQVLVKLKKYSHGDKDFTEDVNCAFEFLLKLTPLLDKADQRCNCDCTNFLLQECGKQGLL
SEASVNNLMAKRKADREHAPQQKSGENANIQPNIQLILRAEPTVTNILKTMDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKS
FARKFINLNEFTTTGSEESTKPASVRALLFDISFLMLCHVAQTTGSEVILSESRTGAEVPFFETWMQTCMPEEGKILNPDHPCFRPDSTK
VESLVALLNNSSEMKLVQMKWHEACLSISAAILEILNAWENGVLAFESIQKITDNIKGKVCSLAVCAVAWLVAHVRMLGLDEREKSLQMI

>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000579000_chr17_37791860_+_705aa
MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKTAISSQFDDFSRDLCVQALLDIMDM
FCDRLSCHGKAEECIGLCRALLSALHWLLRCTAASAERLREGLEAGTPAAGEKQLAMCLQRLEKTLSSTKNRALLHIAKLEEASSWTAIE
HSLLKLGEILANLSNPQLRSQAEQCGTLIRSIPTMLSVHAEQMHKTGFPTVHAVILLEGTMNLTGETQSLVEQLTMVKRMQHIPTPLFVL
EIWKACFVGLIESPEGTEELKWTAFTFLKIPQVLVKLKKYSHGDKDFTEDVNCAFEFLLKLTPLLDKADQRCNCDCTNFLLQECGKQGLL
SEASVNNLMAKRKADREHAPQQKSGENANIQPNIQLILRAEPTVTNILKTMDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKS
FARKFINLNEFTTTGSEESTKPASVRALLFDISFLMLCHVAQTTGSEVILSESRTGAEVPFFETWMQTCMPEEGKILNPDHPCFRPDSTK
VESLVALLNNSSEMKLVQMKWHEACLSISAAILEILNAWENGVLAFESIQKITDNIKGKVCSLAVCAVAWLVAHVRMLGLDEREKSLQMI

>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000394265_chr17_37791860_+_705aa
MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKTAISSQFDDFSRDLCVQALLDIMDM
FCDRLSCHGKAEECIGLCRALLSALHWLLRCTAASAERLREGLEAGTPAAGEKQLAMCLQRLEKTLSSTKNRALLHIAKLEEASSWTAIE
HSLLKLGEILANLSNPQLRSQAEQCGTLIRSIPTMLSVHAEQMHKTGFPTVHAVILLEGTMNLTGETQSLVEQLTMVKRMQHIPTPLFVL
EIWKACFVGLIESPEGTEELKWTAFTFLKIPQVLVKLKKYSHGDKDFTEDVNCAFEFLLKLTPLLDKADQRCNCDCTNFLLQECGKQGLL
SEASVNNLMAKRKADREHAPQQKSGENANIQPNIQLILRAEPTVTNILKTMDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKS
FARKFINLNEFTTTGSEESTKPASVRALLFDISFLMLCHVAQTTGSEVILSESRTGAEVPFFETWMQTCMPEEGKILNPDHPCFRPDSTK
VESLVALLNNSSEMKLVQMKWHEACLSISAAILEILNAWENGVLAFESIQKITDNIKGKVCSLAVCAVAWLVAHVRMLGLDEREKSLQMI

>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000394267_chr17_37791860_+_705aa
MKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLADALLEQAMIGPSPNPLILSYLKTAISSQFDDFSRDLCVQALLDIMDM
FCDRLSCHGKAEECIGLCRALLSALHWLLRCTAASAERLREGLEAGTPAAGEKQLAMCLQRLEKTLSSTKNRALLHIAKLEEASSWTAIE
HSLLKLGEILANLSNPQLRSQAEQCGTLIRSIPTMLSVHAEQMHKTGFPTVHAVILLEGTMNLTGETQSLVEQLTMVKRMQHIPTPLFVL
EIWKACFVGLIESPEGTEELKWTAFTFLKIPQVLVKLKKYSHGDKDFTEDVNCAFEFLLKLTPLLDKADQRCNCDCTNFLLQECGKQGLL
SEASVNNLMAKRKADREHAPQQKSGENANIQPNIQLILRAEPTVTNILKTMDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKS
FARKFINLNEFTTTGSEESTKPASVRALLFDISFLMLCHVAQTTGSEVILSESRTGAEVPFFETWMQTCMPEEGKILNPDHPCFRPDSTK
VESLVALLNNSSEMKLVQMKWHEACLSISAAILEILNAWENGVLAFESIQKITDNIKGKVCSLAVCAVAWLVAHVRMLGLDEREKSLQMI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000580825_chr17_37791860_+_2116nt
ATGAAGGTGGTCAACCTGAAGCAAGCCATTTTGCAAGCCTGGAAGGAGCGCTGGAGTGACTACCAATGGGCAATCAACATGAAGAAATTC
TTTCCTAAAGGAGCCACCTGGGATATTCTCAACCTGGCAGATGCGTTACTAGAGCAGGCCATGATTGGACCATCCCCCAATCCTCTCATC
TTGTCCTACCTGAAGTATGCCATTAGTTCCCAGTTTGATGACTTTTCTCGGGACCTGTGTGTCCAGGCATTGCTGGACATCATGGACATG
TTTTGTGACCGTCTGAGCTGTCACGGCAAAGCAGAGGAATGCATCGGACTGTGCCGAGCCCTTCTTAGCGCCCTCCACTGGCTGCTGCGC
TGCACGGCAGCCTCTGCAGAGCGGCTGCGGGAGGGGCTGGAGGCCGGCACTCCAGCCGCTGGGGAGAAGCAGCTTGCCATGTGCCTTCAG
CGCCTGGAGAAAACCCTCAGCAGCACCAAGAACCGGGCCCTGCTGCACATCGCCAAACTAGAGGAGGCCTCTTCTTGGACTGCCATCGAG
CATTCTCTCTTGAAACTTGGAGAGATCCTGGCCAATCTCAGCAACCCGCAGCTCCGGAGTCAGGCCGAGCAGTGTGGCACCCTCATTAGG
AGCATCCCCACGATGCTGTCTGTGCATGCGGAGCAGATGCACAAGACCGGCTTCCCCACTGTCCACGCCGTGATCCTGCTCGAGGGCACC
ATGAACCTGACAGGCGAGACGCAGTCCCTGGTGGAGCAGCTGACGATGGTGAAGCGCATGCAGCATATCCCCACCCCACTTTTTGTCCTG
GAGATCTGGAAAGCTTGCTTCGTGGGGCTCATTGAGTCTCCCGAGGGTACGGAGGAGCTCAAGTGGACAGCTTTCACTTTCCTCAAGATT
CCACAGGTTTTGGTGAAGTTGAAGAAGTACTCTCATGGAGACAAGGACTTCACTGAGGATGTCAACTGTGCTTTTGAGTTCCTGCTGAAG
CTCACCCCCTTGTTGGACAAAGCTGACCAGCGCTGCAACTGTGACTGTACAAACTTCCTGCTCCAAGAATGTGGCAAGCAGGGGCTTCTG
TCTGAGGCCAGCGTCAACAACCTTATGGCTAAGCGCAAAGCGGACCGAGAGCACGCACCCCAGCAGAAATCGGGAGAGAATGCCAACATC
CAGCCCAACATCCAGCTGATCCTCCGGGCGGAGCCCACTGTCACAAACATCCTCAAGACGATGGATGCAGACCACTCTAAGTCACCGGAG
GGACTGCTGGGAGTCCTGGGCCACATGCTGTCCGGGAAGAGTCTGGACTTGCTGCTGGCTGCCGCCGCCGCCACTGGAAAGCTGAAATCC
TTCGCCCGGAAATTCATCAATTTGAATGAATTCACAACCTATGGCAGCGAAGAAAGCACCAAACCGGCCTCCGTCCGGGCCCTGCTGTTT
GACATCTCCTTCCTCATGCTGTGCCATGTGGCCCAGACCTATGGTTCAGAGGTGATTCTGTCCGAGTCGCGCACAGGAGCTGAGGTGCCC
TTCTTCGAGACCTGGATGCAGACCTGCATGCCTGAGGAGGGCAAGATCCTGAACCCTGACCACCCCTGCTTCCGCCCCGACTCCACCAAA
GTGGAGTCCCTGGTGGCCCTGCTCAACAACTCCTCGGAGATGAAGCTAGTGCAGATGAAGTGGCATGAGGCCTGTCTCAGCATCTCAGCC
GCCATCTTGGAAATCCTCAATGCCTGGGAGAATGGGGTCCTGGCCTTCGAGTCCATCCAGAAAATCACTGATAACATCAAAGGGAAGGTA
TGCAGTCTGGCGGTGTGTGCTGTGGCTTGGCTTGTGGCCCACGTCCGGATGCTGGGGCTGGATGAGCGTGAGAAGTCGCTGCAGATGATC
CGCCAGCTGGCAGGGCCACTGTTTAGTGAGAACACCCTGCAGTTCTACAATGAGAGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGA
AGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCC

>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000254079_chr17_37791860_+_2116nt
ATGAAGGTGGTCAACCTGAAGCAAGCCATTTTGCAAGCCTGGAAGGAGCGCTGGAGTGACTACCAATGGGCAATCAACATGAAGAAATTC
TTTCCTAAAGGAGCCACCTGGGATATTCTCAACCTGGCAGATGCGTTACTAGAGCAGGCCATGATTGGACCATCCCCCAATCCTCTCATC
TTGTCCTACCTGAAGTATGCCATTAGTTCCCAGTTTGATGACTTTTCTCGGGACCTGTGTGTCCAGGCATTGCTGGACATCATGGACATG
TTTTGTGACCGTCTGAGCTGTCACGGCAAAGCAGAGGAATGCATCGGACTGTGCCGAGCCCTTCTTAGCGCCCTCCACTGGCTGCTGCGC
TGCACGGCAGCCTCTGCAGAGCGGCTGCGGGAGGGGCTGGAGGCCGGCACTCCAGCCGCTGGGGAGAAGCAGCTTGCCATGTGCCTTCAG
CGCCTGGAGAAAACCCTCAGCAGCACCAAGAACCGGGCCCTGCTGCACATCGCCAAACTAGAGGAGGCCTCTTCTTGGACTGCCATCGAG
CATTCTCTCTTGAAACTTGGAGAGATCCTGGCCAATCTCAGCAACCCGCAGCTCCGGAGTCAGGCCGAGCAGTGTGGCACCCTCATTAGG
AGCATCCCCACGATGCTGTCTGTGCATGCGGAGCAGATGCACAAGACCGGCTTCCCCACTGTCCACGCCGTGATCCTGCTCGAGGGCACC
ATGAACCTGACAGGCGAGACGCAGTCCCTGGTGGAGCAGCTGACGATGGTGAAGCGCATGCAGCATATCCCCACCCCACTTTTTGTCCTG
GAGATCTGGAAAGCTTGCTTCGTGGGGCTCATTGAGTCTCCCGAGGGTACGGAGGAGCTCAAGTGGACAGCTTTCACTTTCCTCAAGATT
CCACAGGTTTTGGTGAAGTTGAAGAAGTACTCTCATGGAGACAAGGACTTCACTGAGGATGTCAACTGTGCTTTTGAGTTCCTGCTGAAG
CTCACCCCCTTGTTGGACAAAGCTGACCAGCGCTGCAACTGTGACTGTACAAACTTCCTGCTCCAAGAATGTGGCAAGCAGGGGCTTCTG
TCTGAGGCCAGCGTCAACAACCTTATGGCTAAGCGCAAAGCGGACCGAGAGCACGCACCCCAGCAGAAATCGGGAGAGAATGCCAACATC
CAGCCCAACATCCAGCTGATCCTCCGGGCGGAGCCCACTGTCACAAACATCCTCAAGACGATGGATGCAGACCACTCTAAGTCACCGGAG
GGACTGCTGGGAGTCCTGGGCCACATGCTGTCCGGGAAGAGTCTGGACTTGCTGCTGGCTGCCGCCGCCGCCACTGGAAAGCTGAAATCC
TTCGCCCGGAAATTCATCAATTTGAATGAATTCACAACCTATGGCAGCGAAGAAAGCACCAAACCGGCCTCCGTCCGGGCCCTGCTGTTT
GACATCTCCTTCCTCATGCTGTGCCATGTGGCCCAGACCTATGGTTCAGAGGTGATTCTGTCCGAGTCGCGCACAGGAGCTGAGGTGCCC
TTCTTCGAGACCTGGATGCAGACCTGCATGCCTGAGGAGGGCAAGATCCTGAACCCTGACCACCCCTGCTTCCGCCCCGACTCCACCAAA
GTGGAGTCCCTGGTGGCCCTGCTCAACAACTCCTCGGAGATGAAGCTAGTGCAGATGAAGTGGCATGAGGCCTGTCTCAGCATCTCAGCC
GCCATCTTGGAAATCCTCAATGCCTGGGAGAATGGGGTCCTGGCCTTCGAGTCCATCCAGAAAATCACTGATAACATCAAAGGGAAGGTA
TGCAGTCTGGCGGTGTGTGCTGTGGCTTGGCTTGTGGCCCACGTCCGGATGCTGGGGCTGGATGAGCGTGAGAAGTCGCTGCAGATGATC
CGCCAGCTGGCAGGGCCACTGTTTAGTGAGAACACCCTGCAGTTCTACAATGAGAGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGA
AGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCC

>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000579000_chr17_37791860_+_2116nt
ATGAAGGTGGTCAACCTGAAGCAAGCCATTTTGCAAGCCTGGAAGGAGCGCTGGAGTGACTACCAATGGGCAATCAACATGAAGAAATTC
TTTCCTAAAGGAGCCACCTGGGATATTCTCAACCTGGCAGATGCGTTACTAGAGCAGGCCATGATTGGACCATCCCCCAATCCTCTCATC
TTGTCCTACCTGAAGTATGCCATTAGTTCCCAGTTTGATGACTTTTCTCGGGACCTGTGTGTCCAGGCATTGCTGGACATCATGGACATG
TTTTGTGACCGTCTGAGCTGTCACGGCAAAGCAGAGGAATGCATCGGACTGTGCCGAGCCCTTCTTAGCGCCCTCCACTGGCTGCTGCGC
TGCACGGCAGCCTCTGCAGAGCGGCTGCGGGAGGGGCTGGAGGCCGGCACTCCAGCCGCTGGGGAGAAGCAGCTTGCCATGTGCCTTCAG
CGCCTGGAGAAAACCCTCAGCAGCACCAAGAACCGGGCCCTGCTGCACATCGCCAAACTAGAGGAGGCCTCTTCTTGGACTGCCATCGAG
CATTCTCTCTTGAAACTTGGAGAGATCCTGGCCAATCTCAGCAACCCGCAGCTCCGGAGTCAGGCCGAGCAGTGTGGCACCCTCATTAGG
AGCATCCCCACGATGCTGTCTGTGCATGCGGAGCAGATGCACAAGACCGGCTTCCCCACTGTCCACGCCGTGATCCTGCTCGAGGGCACC
ATGAACCTGACAGGCGAGACGCAGTCCCTGGTGGAGCAGCTGACGATGGTGAAGCGCATGCAGCATATCCCCACCCCACTTTTTGTCCTG
GAGATCTGGAAAGCTTGCTTCGTGGGGCTCATTGAGTCTCCCGAGGGTACGGAGGAGCTCAAGTGGACAGCTTTCACTTTCCTCAAGATT
CCACAGGTTTTGGTGAAGTTGAAGAAGTACTCTCATGGAGACAAGGACTTCACTGAGGATGTCAACTGTGCTTTTGAGTTCCTGCTGAAG
CTCACCCCCTTGTTGGACAAAGCTGACCAGCGCTGCAACTGTGACTGTACAAACTTCCTGCTCCAAGAATGTGGCAAGCAGGGGCTTCTG
TCTGAGGCCAGCGTCAACAACCTTATGGCTAAGCGCAAAGCGGACCGAGAGCACGCACCCCAGCAGAAATCGGGAGAGAATGCCAACATC
CAGCCCAACATCCAGCTGATCCTCCGGGCGGAGCCCACTGTCACAAACATCCTCAAGACGATGGATGCAGACCACTCTAAGTCACCGGAG
GGACTGCTGGGAGTCCTGGGCCACATGCTGTCCGGGAAGAGTCTGGACTTGCTGCTGGCTGCCGCCGCCGCCACTGGAAAGCTGAAATCC
TTCGCCCGGAAATTCATCAATTTGAATGAATTCACAACCTATGGCAGCGAAGAAAGCACCAAACCGGCCTCCGTCCGGGCCCTGCTGTTT
GACATCTCCTTCCTCATGCTGTGCCATGTGGCCCAGACCTATGGTTCAGAGGTGATTCTGTCCGAGTCGCGCACAGGAGCTGAGGTGCCC
TTCTTCGAGACCTGGATGCAGACCTGCATGCCTGAGGAGGGCAAGATCCTGAACCCTGACCACCCCTGCTTCCGCCCCGACTCCACCAAA
GTGGAGTCCCTGGTGGCCCTGCTCAACAACTCCTCGGAGATGAAGCTAGTGCAGATGAAGTGGCATGAGGCCTGTCTCAGCATCTCAGCC
GCCATCTTGGAAATCCTCAATGCCTGGGAGAATGGGGTCCTGGCCTTCGAGTCCATCCAGAAAATCACTGATAACATCAAAGGGAAGGTA
TGCAGTCTGGCGGTGTGTGCTGTGGCTTGGCTTGTGGCCCACGTCCGGATGCTGGGGCTGGATGAGCGTGAGAAGTCGCTGCAGATGATC
CGCCAGCTGGCAGGGCCACTGTTTAGTGAGAACACCCTGCAGTTCTACAATGAGAGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGA
AGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCC

>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000394265_chr17_37791860_+_2116nt
ATGAAGGTGGTCAACCTGAAGCAAGCCATTTTGCAAGCCTGGAAGGAGCGCTGGAGTGACTACCAATGGGCAATCAACATGAAGAAATTC
TTTCCTAAAGGAGCCACCTGGGATATTCTCAACCTGGCAGATGCGTTACTAGAGCAGGCCATGATTGGACCATCCCCCAATCCTCTCATC
TTGTCCTACCTGAAGTATGCCATTAGTTCCCAGTTTGATGACTTTTCTCGGGACCTGTGTGTCCAGGCATTGCTGGACATCATGGACATG
TTTTGTGACCGTCTGAGCTGTCACGGCAAAGCAGAGGAATGCATCGGACTGTGCCGAGCCCTTCTTAGCGCCCTCCACTGGCTGCTGCGC
TGCACGGCAGCCTCTGCAGAGCGGCTGCGGGAGGGGCTGGAGGCCGGCACTCCAGCCGCTGGGGAGAAGCAGCTTGCCATGTGCCTTCAG
CGCCTGGAGAAAACCCTCAGCAGCACCAAGAACCGGGCCCTGCTGCACATCGCCAAACTAGAGGAGGCCTCTTCTTGGACTGCCATCGAG
CATTCTCTCTTGAAACTTGGAGAGATCCTGGCCAATCTCAGCAACCCGCAGCTCCGGAGTCAGGCCGAGCAGTGTGGCACCCTCATTAGG
AGCATCCCCACGATGCTGTCTGTGCATGCGGAGCAGATGCACAAGACCGGCTTCCCCACTGTCCACGCCGTGATCCTGCTCGAGGGCACC
ATGAACCTGACAGGCGAGACGCAGTCCCTGGTGGAGCAGCTGACGATGGTGAAGCGCATGCAGCATATCCCCACCCCACTTTTTGTCCTG
GAGATCTGGAAAGCTTGCTTCGTGGGGCTCATTGAGTCTCCCGAGGGTACGGAGGAGCTCAAGTGGACAGCTTTCACTTTCCTCAAGATT
CCACAGGTTTTGGTGAAGTTGAAGAAGTACTCTCATGGAGACAAGGACTTCACTGAGGATGTCAACTGTGCTTTTGAGTTCCTGCTGAAG
CTCACCCCCTTGTTGGACAAAGCTGACCAGCGCTGCAACTGTGACTGTACAAACTTCCTGCTCCAAGAATGTGGCAAGCAGGGGCTTCTG
TCTGAGGCCAGCGTCAACAACCTTATGGCTAAGCGCAAAGCGGACCGAGAGCACGCACCCCAGCAGAAATCGGGAGAGAATGCCAACATC
CAGCCCAACATCCAGCTGATCCTCCGGGCGGAGCCCACTGTCACAAACATCCTCAAGACGATGGATGCAGACCACTCTAAGTCACCGGAG
GGACTGCTGGGAGTCCTGGGCCACATGCTGTCCGGGAAGAGTCTGGACTTGCTGCTGGCTGCCGCCGCCGCCACTGGAAAGCTGAAATCC
TTCGCCCGGAAATTCATCAATTTGAATGAATTCACAACCTATGGCAGCGAAGAAAGCACCAAACCGGCCTCCGTCCGGGCCCTGCTGTTT
GACATCTCCTTCCTCATGCTGTGCCATGTGGCCCAGACCTATGGTTCAGAGGTGATTCTGTCCGAGTCGCGCACAGGAGCTGAGGTGCCC
TTCTTCGAGACCTGGATGCAGACCTGCATGCCTGAGGAGGGCAAGATCCTGAACCCTGACCACCCCTGCTTCCGCCCCGACTCCACCAAA
GTGGAGTCCCTGGTGGCCCTGCTCAACAACTCCTCGGAGATGAAGCTAGTGCAGATGAAGTGGCATGAGGCCTGTCTCAGCATCTCAGCC
GCCATCTTGGAAATCCTCAATGCCTGGGAGAATGGGGTCCTGGCCTTCGAGTCCATCCAGAAAATCACTGATAACATCAAAGGGAAGGTA
TGCAGTCTGGCGGTGTGTGCTGTGGCTTGGCTTGTGGCCCACGTCCGGATGCTGGGGCTGGATGAGCGTGAGAAGTCGCTGCAGATGATC
CGCCAGCTGGCAGGGCCACTGTTTAGTGAGAACACCCTGCAGTTCTACAATGAGAGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGA
AGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCC

>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000394267_chr17_37791860_+_2116nt
ATGAAGGTGGTCAACCTGAAGCAAGCCATTTTGCAAGCCTGGAAGGAGCGCTGGAGTGACTACCAATGGGCAATCAACATGAAGAAATTC
TTTCCTAAAGGAGCCACCTGGGATATTCTCAACCTGGCAGATGCGTTACTAGAGCAGGCCATGATTGGACCATCCCCCAATCCTCTCATC
TTGTCCTACCTGAAGTATGCCATTAGTTCCCAGTTTGATGACTTTTCTCGGGACCTGTGTGTCCAGGCATTGCTGGACATCATGGACATG
TTTTGTGACCGTCTGAGCTGTCACGGCAAAGCAGAGGAATGCATCGGACTGTGCCGAGCCCTTCTTAGCGCCCTCCACTGGCTGCTGCGC
TGCACGGCAGCCTCTGCAGAGCGGCTGCGGGAGGGGCTGGAGGCCGGCACTCCAGCCGCTGGGGAGAAGCAGCTTGCCATGTGCCTTCAG
CGCCTGGAGAAAACCCTCAGCAGCACCAAGAACCGGGCCCTGCTGCACATCGCCAAACTAGAGGAGGCCTCTTCTTGGACTGCCATCGAG
CATTCTCTCTTGAAACTTGGAGAGATCCTGGCCAATCTCAGCAACCCGCAGCTCCGGAGTCAGGCCGAGCAGTGTGGCACCCTCATTAGG
AGCATCCCCACGATGCTGTCTGTGCATGCGGAGCAGATGCACAAGACCGGCTTCCCCACTGTCCACGCCGTGATCCTGCTCGAGGGCACC
ATGAACCTGACAGGCGAGACGCAGTCCCTGGTGGAGCAGCTGACGATGGTGAAGCGCATGCAGCATATCCCCACCCCACTTTTTGTCCTG
GAGATCTGGAAAGCTTGCTTCGTGGGGCTCATTGAGTCTCCCGAGGGTACGGAGGAGCTCAAGTGGACAGCTTTCACTTTCCTCAAGATT
CCACAGGTTTTGGTGAAGTTGAAGAAGTACTCTCATGGAGACAAGGACTTCACTGAGGATGTCAACTGTGCTTTTGAGTTCCTGCTGAAG
CTCACCCCCTTGTTGGACAAAGCTGACCAGCGCTGCAACTGTGACTGTACAAACTTCCTGCTCCAAGAATGTGGCAAGCAGGGGCTTCTG
TCTGAGGCCAGCGTCAACAACCTTATGGCTAAGCGCAAAGCGGACCGAGAGCACGCACCCCAGCAGAAATCGGGAGAGAATGCCAACATC
CAGCCCAACATCCAGCTGATCCTCCGGGCGGAGCCCACTGTCACAAACATCCTCAAGACGATGGATGCAGACCACTCTAAGTCACCGGAG
GGACTGCTGGGAGTCCTGGGCCACATGCTGTCCGGGAAGAGTCTGGACTTGCTGCTGGCTGCCGCCGCCGCCACTGGAAAGCTGAAATCC
TTCGCCCGGAAATTCATCAATTTGAATGAATTCACAACCTATGGCAGCGAAGAAAGCACCAAACCGGCCTCCGTCCGGGCCCTGCTGTTT
GACATCTCCTTCCTCATGCTGTGCCATGTGGCCCAGACCTATGGTTCAGAGGTGATTCTGTCCGAGTCGCGCACAGGAGCTGAGGTGCCC
TTCTTCGAGACCTGGATGCAGACCTGCATGCCTGAGGAGGGCAAGATCCTGAACCCTGACCACCCCTGCTTCCGCCCCGACTCCACCAAA
GTGGAGTCCCTGGTGGCCCTGCTCAACAACTCCTCGGAGATGAAGCTAGTGCAGATGAAGTGGCATGAGGCCTGTCTCAGCATCTCAGCC
GCCATCTTGGAAATCCTCAATGCCTGGGAGAATGGGGTCCTGGCCTTCGAGTCCATCCAGAAAATCACTGATAACATCAAAGGGAAGGTA
TGCAGTCTGGCGGTGTGTGCTGTGGCTTGGCTTGTGGCCCACGTCCGGATGCTGGGGCTGGATGAGCGTGAGAAGTCGCTGCAGATGATC
CGCCAGCTGGCAGGGCCACTGTTTAGTGAGAACACCCTGCAGTTCTACAATGAGAGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGA
AGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000580825_chr17_37791860_+_2355nt
AAGTGCCAAAATGGCGATGCCTACCACCTAGAACTGGATTGTGCGCTCCATTTCTTTCACCTCAAAGCTGGCCGCCACCGCTGCCACCTG
CTCAGAGTGAAATAATGAAGGTGGTCAACCTGAAGCAAGCCATTTTGCAAGCCTGGAAGGAGCGCTGGAGTGACTACCAATGGGCAATCA
ACATGAAGAAATTCTTTCCTAAAGGAGCCACCTGGGATATTCTCAACCTGGCAGATGCGTTACTAGAGCAGGCCATGATTGGACCATCCC
CCAATCCTCTCATCTTGTCCTACCTGAAGTATGCCATTAGTTCCCAGTTTGATGACTTTTCTCGGGACCTGTGTGTCCAGGCATTGCTGG
ACATCATGGACATGTTTTGTGACCGTCTGAGCTGTCACGGCAAAGCAGAGGAATGCATCGGACTGTGCCGAGCCCTTCTTAGCGCCCTCC
ACTGGCTGCTGCGCTGCACGGCAGCCTCTGCAGAGCGGCTGCGGGAGGGGCTGGAGGCCGGCACTCCAGCCGCTGGGGAGAAGCAGCTTG
CCATGTGCCTTCAGCGCCTGGAGAAAACCCTCAGCAGCACCAAGAACCGGGCCCTGCTGCACATCGCCAAACTAGAGGAGGCCTCTTCTT
GGACTGCCATCGAGCATTCTCTCTTGAAACTTGGAGAGATCCTGGCCAATCTCAGCAACCCGCAGCTCCGGAGTCAGGCCGAGCAGTGTG
GCACCCTCATTAGGAGCATCCCCACGATGCTGTCTGTGCATGCGGAGCAGATGCACAAGACCGGCTTCCCCACTGTCCACGCCGTGATCC
TGCTCGAGGGCACCATGAACCTGACAGGCGAGACGCAGTCCCTGGTGGAGCAGCTGACGATGGTGAAGCGCATGCAGCATATCCCCACCC
CACTTTTTGTCCTGGAGATCTGGAAAGCTTGCTTCGTGGGGCTCATTGAGTCTCCCGAGGGTACGGAGGAGCTCAAGTGGACAGCTTTCA
CTTTCCTCAAGATTCCACAGGTTTTGGTGAAGTTGAAGAAGTACTCTCATGGAGACAAGGACTTCACTGAGGATGTCAACTGTGCTTTTG
AGTTCCTGCTGAAGCTCACCCCCTTGTTGGACAAAGCTGACCAGCGCTGCAACTGTGACTGTACAAACTTCCTGCTCCAAGAATGTGGCA
AGCAGGGGCTTCTGTCTGAGGCCAGCGTCAACAACCTTATGGCTAAGCGCAAAGCGGACCGAGAGCACGCACCCCAGCAGAAATCGGGAG
AGAATGCCAACATCCAGCCCAACATCCAGCTGATCCTCCGGGCGGAGCCCACTGTCACAAACATCCTCAAGACGATGGATGCAGACCACT
CTAAGTCACCGGAGGGACTGCTGGGAGTCCTGGGCCACATGCTGTCCGGGAAGAGTCTGGACTTGCTGCTGGCTGCCGCCGCCGCCACTG
GAAAGCTGAAATCCTTCGCCCGGAAATTCATCAATTTGAATGAATTCACAACCTATGGCAGCGAAGAAAGCACCAAACCGGCCTCCGTCC
GGGCCCTGCTGTTTGACATCTCCTTCCTCATGCTGTGCCATGTGGCCCAGACCTATGGTTCAGAGGTGATTCTGTCCGAGTCGCGCACAG
GAGCTGAGGTGCCCTTCTTCGAGACCTGGATGCAGACCTGCATGCCTGAGGAGGGCAAGATCCTGAACCCTGACCACCCCTGCTTCCGCC
CCGACTCCACCAAAGTGGAGTCCCTGGTGGCCCTGCTCAACAACTCCTCGGAGATGAAGCTAGTGCAGATGAAGTGGCATGAGGCCTGTC
TCAGCATCTCAGCCGCCATCTTGGAAATCCTCAATGCCTGGGAGAATGGGGTCCTGGCCTTCGAGTCCATCCAGAAAATCACTGATAACA
TCAAAGGGAAGGTATGCAGTCTGGCGGTGTGTGCTGTGGCTTGGCTTGTGGCCCACGTCCGGATGCTGGGGCTGGATGAGCGTGAGAAGT
CGCTGCAGATGATCCGCCAGCTGGCAGGGCCACTGTTTAGTGAGAACACCCTGCAGTTCTACAATGAGAGCTGGGCAAAAGACAACCTGT
GGCCAGGGTCTGGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCA
GCACTAAGTGAGCCTGGGGAGGAACCTCAGCGCCCTTCCCCCTCTGAGCCTGGCACATAGGCACCCAGCCTGCATCTCCCAGGAGGAAGT
GGAGGGGACATCGCTGTTCCCCAGAAACCCACTCTATCCTCACCCTGTTTTGTGCTCTTCCCCTCGCCTGCTAGGGCTGCGGCTTCTGAC

>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000254079_chr17_37791860_+_2981nt
AAGTGCCAAAATGGCGATGCCTACCACCTAGAACTGGATTGTGCGCTCCATTTCTTTCACCTCAAAGCTGGCCGCCACCGCTGCCACCTG
CTCAGAGTGAAATAATGAAGGTGGTCAACCTGAAGCAAGCCATTTTGCAAGCCTGGAAGGAGCGCTGGAGTGACTACCAATGGGCAATCA
ACATGAAGAAATTCTTTCCTAAAGGAGCCACCTGGGATATTCTCAACCTGGCAGATGCGTTACTAGAGCAGGCCATGATTGGACCATCCC
CCAATCCTCTCATCTTGTCCTACCTGAAGTATGCCATTAGTTCCCAGTTTGATGACTTTTCTCGGGACCTGTGTGTCCAGGCATTGCTGG
ACATCATGGACATGTTTTGTGACCGTCTGAGCTGTCACGGCAAAGCAGAGGAATGCATCGGACTGTGCCGAGCCCTTCTTAGCGCCCTCC
ACTGGCTGCTGCGCTGCACGGCAGCCTCTGCAGAGCGGCTGCGGGAGGGGCTGGAGGCCGGCACTCCAGCCGCTGGGGAGAAGCAGCTTG
CCATGTGCCTTCAGCGCCTGGAGAAAACCCTCAGCAGCACCAAGAACCGGGCCCTGCTGCACATCGCCAAACTAGAGGAGGCCTCTTCTT
GGACTGCCATCGAGCATTCTCTCTTGAAACTTGGAGAGATCCTGGCCAATCTCAGCAACCCGCAGCTCCGGAGTCAGGCCGAGCAGTGTG
GCACCCTCATTAGGAGCATCCCCACGATGCTGTCTGTGCATGCGGAGCAGATGCACAAGACCGGCTTCCCCACTGTCCACGCCGTGATCC
TGCTCGAGGGCACCATGAACCTGACAGGCGAGACGCAGTCCCTGGTGGAGCAGCTGACGATGGTGAAGCGCATGCAGCATATCCCCACCC
CACTTTTTGTCCTGGAGATCTGGAAAGCTTGCTTCGTGGGGCTCATTGAGTCTCCCGAGGGTACGGAGGAGCTCAAGTGGACAGCTTTCA
CTTTCCTCAAGATTCCACAGGTTTTGGTGAAGTTGAAGAAGTACTCTCATGGAGACAAGGACTTCACTGAGGATGTCAACTGTGCTTTTG
AGTTCCTGCTGAAGCTCACCCCCTTGTTGGACAAAGCTGACCAGCGCTGCAACTGTGACTGTACAAACTTCCTGCTCCAAGAATGTGGCA
AGCAGGGGCTTCTGTCTGAGGCCAGCGTCAACAACCTTATGGCTAAGCGCAAAGCGGACCGAGAGCACGCACCCCAGCAGAAATCGGGAG
AGAATGCCAACATCCAGCCCAACATCCAGCTGATCCTCCGGGCGGAGCCCACTGTCACAAACATCCTCAAGACGATGGATGCAGACCACT
CTAAGTCACCGGAGGGACTGCTGGGAGTCCTGGGCCACATGCTGTCCGGGAAGAGTCTGGACTTGCTGCTGGCTGCCGCCGCCGCCACTG
GAAAGCTGAAATCCTTCGCCCGGAAATTCATCAATTTGAATGAATTCACAACCTATGGCAGCGAAGAAAGCACCAAACCGGCCTCCGTCC
GGGCCCTGCTGTTTGACATCTCCTTCCTCATGCTGTGCCATGTGGCCCAGACCTATGGTTCAGAGGTGATTCTGTCCGAGTCGCGCACAG
GAGCTGAGGTGCCCTTCTTCGAGACCTGGATGCAGACCTGCATGCCTGAGGAGGGCAAGATCCTGAACCCTGACCACCCCTGCTTCCGCC
CCGACTCCACCAAAGTGGAGTCCCTGGTGGCCCTGCTCAACAACTCCTCGGAGATGAAGCTAGTGCAGATGAAGTGGCATGAGGCCTGTC
TCAGCATCTCAGCCGCCATCTTGGAAATCCTCAATGCCTGGGAGAATGGGGTCCTGGCCTTCGAGTCCATCCAGAAAATCACTGATAACA
TCAAAGGGAAGGTATGCAGTCTGGCGGTGTGTGCTGTGGCTTGGCTTGTGGCCCACGTCCGGATGCTGGGGCTGGATGAGCGTGAGAAGT
CGCTGCAGATGATCCGCCAGCTGGCAGGGCCACTGTTTAGTGAGAACACCCTGCAGTTCTACAATGAGAGCTGGGCAAAAGACAACCTGT
GGCCAGGGTCTGGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCA
GCACTAAGTGAGCCTGGGGAGGAACCTCAGCGCCCTTCCCCCTCTGAGCCTGGCACATAGGCACCCAGCCTGCATCTCCCAGGAGGAAGT
GGAGGGGACATCGCTGTTCCCCAGAAACCCACTCTATCCTCACCCTGTTTTGTGCTCTTCCCCTCGCCTGCTAGGGCTGCGGCTTCTGAC
TTCTAGAAGACTAAGGCTGGTCTGTGTTTGCTTGTTTGCCCACCTTTGGCTGATACCCAGAGAACCTGGGCACTTGCTGCCTGATGCCCA
CCCCTGCCAGTCATTCCTCCATTCACCCAGCGGGAGGTGGGATGTGAGACAGCCCACATTGGAAAATCCAGAAAACCGGGAACAGGGATT
TGCCCTTCACAATTCTACTCCCCAGATCCTCTCCCCTGGACACAGGAGACCCACAGGGCAGGACCCTAAGATCTGGGGAAAGGAGGTCCT
GAGAACCTTGAGGTACCCTTAGATCCTTTTCTACCCACTTTCCTATGGAGGATTCCAAGTCACCACTTCTCTCACCGGCTTCTACCAGGG
TCCAGGACTAAGGCGTTTTTCTCCATAGCCTCAACATTTTGGGAATCTTCCCTTAATCACCCTTGCTCCTCCTGGGTGCCTGGAAGATGG
ACTGGCAGAGACCTCTTTGTTGCGTTTTGTGCTTTGATGCCAGGAATGCCGCCTAGTTTATGTCCCCGGTGGGGCACACAGCGGGGGGCG
CCAGGTTTTCCTTGTCCCCCAGCTGCTCTGCCCCTTTCCCCTTCTTCCCTGACTCCAGGCCTGAACCCCTCCCGTGCTGTAATAAATCTT

>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000579000_chr17_37791860_+_2977nt
AAGTGCCAAAATGGCGATGCCTACCACCTAGAACTGGATTGTGCGCTCCATTTCTTTCACCTCAAAGCTGGCCGCCACCGCTGCCACCTG
CTCAGAGTGAAATAATGAAGGTGGTCAACCTGAAGCAAGCCATTTTGCAAGCCTGGAAGGAGCGCTGGAGTGACTACCAATGGGCAATCA
ACATGAAGAAATTCTTTCCTAAAGGAGCCACCTGGGATATTCTCAACCTGGCAGATGCGTTACTAGAGCAGGCCATGATTGGACCATCCC
CCAATCCTCTCATCTTGTCCTACCTGAAGTATGCCATTAGTTCCCAGTTTGATGACTTTTCTCGGGACCTGTGTGTCCAGGCATTGCTGG
ACATCATGGACATGTTTTGTGACCGTCTGAGCTGTCACGGCAAAGCAGAGGAATGCATCGGACTGTGCCGAGCCCTTCTTAGCGCCCTCC
ACTGGCTGCTGCGCTGCACGGCAGCCTCTGCAGAGCGGCTGCGGGAGGGGCTGGAGGCCGGCACTCCAGCCGCTGGGGAGAAGCAGCTTG
CCATGTGCCTTCAGCGCCTGGAGAAAACCCTCAGCAGCACCAAGAACCGGGCCCTGCTGCACATCGCCAAACTAGAGGAGGCCTCTTCTT
GGACTGCCATCGAGCATTCTCTCTTGAAACTTGGAGAGATCCTGGCCAATCTCAGCAACCCGCAGCTCCGGAGTCAGGCCGAGCAGTGTG
GCACCCTCATTAGGAGCATCCCCACGATGCTGTCTGTGCATGCGGAGCAGATGCACAAGACCGGCTTCCCCACTGTCCACGCCGTGATCC
TGCTCGAGGGCACCATGAACCTGACAGGCGAGACGCAGTCCCTGGTGGAGCAGCTGACGATGGTGAAGCGCATGCAGCATATCCCCACCC
CACTTTTTGTCCTGGAGATCTGGAAAGCTTGCTTCGTGGGGCTCATTGAGTCTCCCGAGGGTACGGAGGAGCTCAAGTGGACAGCTTTCA
CTTTCCTCAAGATTCCACAGGTTTTGGTGAAGTTGAAGAAGTACTCTCATGGAGACAAGGACTTCACTGAGGATGTCAACTGTGCTTTTG
AGTTCCTGCTGAAGCTCACCCCCTTGTTGGACAAAGCTGACCAGCGCTGCAACTGTGACTGTACAAACTTCCTGCTCCAAGAATGTGGCA
AGCAGGGGCTTCTGTCTGAGGCCAGCGTCAACAACCTTATGGCTAAGCGCAAAGCGGACCGAGAGCACGCACCCCAGCAGAAATCGGGAG
AGAATGCCAACATCCAGCCCAACATCCAGCTGATCCTCCGGGCGGAGCCCACTGTCACAAACATCCTCAAGACGATGGATGCAGACCACT
CTAAGTCACCGGAGGGACTGCTGGGAGTCCTGGGCCACATGCTGTCCGGGAAGAGTCTGGACTTGCTGCTGGCTGCCGCCGCCGCCACTG
GAAAGCTGAAATCCTTCGCCCGGAAATTCATCAATTTGAATGAATTCACAACCTATGGCAGCGAAGAAAGCACCAAACCGGCCTCCGTCC
GGGCCCTGCTGTTTGACATCTCCTTCCTCATGCTGTGCCATGTGGCCCAGACCTATGGTTCAGAGGTGATTCTGTCCGAGTCGCGCACAG
GAGCTGAGGTGCCCTTCTTCGAGACCTGGATGCAGACCTGCATGCCTGAGGAGGGCAAGATCCTGAACCCTGACCACCCCTGCTTCCGCC
CCGACTCCACCAAAGTGGAGTCCCTGGTGGCCCTGCTCAACAACTCCTCGGAGATGAAGCTAGTGCAGATGAAGTGGCATGAGGCCTGTC
TCAGCATCTCAGCCGCCATCTTGGAAATCCTCAATGCCTGGGAGAATGGGGTCCTGGCCTTCGAGTCCATCCAGAAAATCACTGATAACA
TCAAAGGGAAGGTATGCAGTCTGGCGGTGTGTGCTGTGGCTTGGCTTGTGGCCCACGTCCGGATGCTGGGGCTGGATGAGCGTGAGAAGT
CGCTGCAGATGATCCGCCAGCTGGCAGGGCCACTGTTTAGTGAGAACACCCTGCAGTTCTACAATGAGAGCTGGGCAAAAGACAACCTGT
GGCCAGGGTCTGGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCA
GCACTAAGTGAGCCTGGGGAGGAACCTCAGCGCCCTTCCCCCTCTGAGCCTGGCACATAGGCACCCAGCCTGCATCTCCCAGGAGGAAGT
GGAGGGGACATCGCTGTTCCCCAGAAACCCACTCTATCCTCACCCTGTTTTGTGCTCTTCCCCTCGCCTGCTAGGGCTGCGGCTTCTGAC
TTCTAGAAGACTAAGGCTGGTCTGTGTTTGCTTGTTTGCCCACCTTTGGCTGATACCCAGAGAACCTGGGCACTTGCTGCCTGATGCCCA
CCCCTGCCAGTCATTCCTCCATTCACCCAGCGGGAGGTGGGATGTGAGACAGCCCACATTGGAAAATCCAGAAAACCGGGAACAGGGATT
TGCCCTTCACAATTCTACTCCCCAGATCCTCTCCCCTGGACACAGGAGACCCACAGGGCAGGACCCTAAGATCTGGGGAAAGGAGGTCCT
GAGAACCTTGAGGTACCCTTAGATCCTTTTCTACCCACTTTCCTATGGAGGATTCCAAGTCACCACTTCTCTCACCGGCTTCTACCAGGG
TCCAGGACTAAGGCGTTTTTCTCCATAGCCTCAACATTTTGGGAATCTTCCCTTAATCACCCTTGCTCCTCCTGGGTGCCTGGAAGATGG
ACTGGCAGAGACCTCTTTGTTGCGTTTTGTGCTTTGATGCCAGGAATGCCGCCTAGTTTATGTCCCCGGTGGGGCACACAGCGGGGGGCG
CCAGGTTTTCCTTGTCCCCCAGCTGCTCTGCCCCTTTCCCCTTCTTCCCTGACTCCAGGCCTGAACCCCTCCCGTGCTGTAATAAATCTT

>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000394265_chr17_37791860_+_2980nt
AAGTGCCAAAATGGCGATGCCTACCACCTAGAACTGGATTGTGCGCTCCATTTCTTTCACCTCAAAGCTGGCCGCCACCGCTGCCACCTG
CTCAGAGTGAAATAATGAAGGTGGTCAACCTGAAGCAAGCCATTTTGCAAGCCTGGAAGGAGCGCTGGAGTGACTACCAATGGGCAATCA
ACATGAAGAAATTCTTTCCTAAAGGAGCCACCTGGGATATTCTCAACCTGGCAGATGCGTTACTAGAGCAGGCCATGATTGGACCATCCC
CCAATCCTCTCATCTTGTCCTACCTGAAGTATGCCATTAGTTCCCAGTTTGATGACTTTTCTCGGGACCTGTGTGTCCAGGCATTGCTGG
ACATCATGGACATGTTTTGTGACCGTCTGAGCTGTCACGGCAAAGCAGAGGAATGCATCGGACTGTGCCGAGCCCTTCTTAGCGCCCTCC
ACTGGCTGCTGCGCTGCACGGCAGCCTCTGCAGAGCGGCTGCGGGAGGGGCTGGAGGCCGGCACTCCAGCCGCTGGGGAGAAGCAGCTTG
CCATGTGCCTTCAGCGCCTGGAGAAAACCCTCAGCAGCACCAAGAACCGGGCCCTGCTGCACATCGCCAAACTAGAGGAGGCCTCTTCTT
GGACTGCCATCGAGCATTCTCTCTTGAAACTTGGAGAGATCCTGGCCAATCTCAGCAACCCGCAGCTCCGGAGTCAGGCCGAGCAGTGTG
GCACCCTCATTAGGAGCATCCCCACGATGCTGTCTGTGCATGCGGAGCAGATGCACAAGACCGGCTTCCCCACTGTCCACGCCGTGATCC
TGCTCGAGGGCACCATGAACCTGACAGGCGAGACGCAGTCCCTGGTGGAGCAGCTGACGATGGTGAAGCGCATGCAGCATATCCCCACCC
CACTTTTTGTCCTGGAGATCTGGAAAGCTTGCTTCGTGGGGCTCATTGAGTCTCCCGAGGGTACGGAGGAGCTCAAGTGGACAGCTTTCA
CTTTCCTCAAGATTCCACAGGTTTTGGTGAAGTTGAAGAAGTACTCTCATGGAGACAAGGACTTCACTGAGGATGTCAACTGTGCTTTTG
AGTTCCTGCTGAAGCTCACCCCCTTGTTGGACAAAGCTGACCAGCGCTGCAACTGTGACTGTACAAACTTCCTGCTCCAAGAATGTGGCA
AGCAGGGGCTTCTGTCTGAGGCCAGCGTCAACAACCTTATGGCTAAGCGCAAAGCGGACCGAGAGCACGCACCCCAGCAGAAATCGGGAG
AGAATGCCAACATCCAGCCCAACATCCAGCTGATCCTCCGGGCGGAGCCCACTGTCACAAACATCCTCAAGACGATGGATGCAGACCACT
CTAAGTCACCGGAGGGACTGCTGGGAGTCCTGGGCCACATGCTGTCCGGGAAGAGTCTGGACTTGCTGCTGGCTGCCGCCGCCGCCACTG
GAAAGCTGAAATCCTTCGCCCGGAAATTCATCAATTTGAATGAATTCACAACCTATGGCAGCGAAGAAAGCACCAAACCGGCCTCCGTCC
GGGCCCTGCTGTTTGACATCTCCTTCCTCATGCTGTGCCATGTGGCCCAGACCTATGGTTCAGAGGTGATTCTGTCCGAGTCGCGCACAG
GAGCTGAGGTGCCCTTCTTCGAGACCTGGATGCAGACCTGCATGCCTGAGGAGGGCAAGATCCTGAACCCTGACCACCCCTGCTTCCGCC
CCGACTCCACCAAAGTGGAGTCCCTGGTGGCCCTGCTCAACAACTCCTCGGAGATGAAGCTAGTGCAGATGAAGTGGCATGAGGCCTGTC
TCAGCATCTCAGCCGCCATCTTGGAAATCCTCAATGCCTGGGAGAATGGGGTCCTGGCCTTCGAGTCCATCCAGAAAATCACTGATAACA
TCAAAGGGAAGGTATGCAGTCTGGCGGTGTGTGCTGTGGCTTGGCTTGTGGCCCACGTCCGGATGCTGGGGCTGGATGAGCGTGAGAAGT
CGCTGCAGATGATCCGCCAGCTGGCAGGGCCACTGTTTAGTGAGAACACCCTGCAGTTCTACAATGAGAGCTGGGCAAAAGACAACCTGT
GGCCAGGGTCTGGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCA
GCACTAAGTGAGCCTGGGGAGGAACCTCAGCGCCCTTCCCCCTCTGAGCCTGGCACATAGGCACCCAGCCTGCATCTCCCAGGAGGAAGT
GGAGGGGACATCGCTGTTCCCCAGAAACCCACTCTATCCTCACCCTGTTTTGTGCTCTTCCCCTCGCCTGCTAGGGCTGCGGCTTCTGAC
TTCTAGAAGACTAAGGCTGGTCTGTGTTTGCTTGTTTGCCCACCTTTGGCTGATACCCAGAGAACCTGGGCACTTGCTGCCTGATGCCCA
CCCCTGCCAGTCATTCCTCCATTCACCCAGCGGGAGGTGGGATGTGAGACAGCCCACATTGGAAAATCCAGAAAACCGGGAACAGGGATT
TGCCCTTCACAATTCTACTCCCCAGATCCTCTCCCCTGGACACAGGAGACCCACAGGGCAGGACCCTAAGATCTGGGGAAAGGAGGTCCT
GAGAACCTTGAGGTACCCTTAGATCCTTTTCTACCCACTTTCCTATGGAGGATTCCAAGTCACCACTTCTCTCACCGGCTTCTACCAGGG
TCCAGGACTAAGGCGTTTTTCTCCATAGCCTCAACATTTTGGGAATCTTCCCTTAATCACCCTTGCTCCTCCTGGGTGCCTGGAAGATGG
ACTGGCAGAGACCTCTTTGTTGCGTTTTGTGCTTTGATGCCAGGAATGCCGCCTAGTTTATGTCCCCGGTGGGGCACACAGCGGGGGGCG
CCAGGTTTTCCTTGTCCCCCAGCTGCTCTGCCCCTTTCCCCTTCTTCCCTGACTCCAGGCCTGAACCCCTCCCGTGCTGTAATAAATCTT

>In-frame_MED24_ENST00000394127_chr17_38182409_-_PPP1R1B_ENST00000394267_chr17_37791860_+_2981nt
AAGTGCCAAAATGGCGATGCCTACCACCTAGAACTGGATTGTGCGCTCCATTTCTTTCACCTCAAAGCTGGCCGCCACCGCTGCCACCTG
CTCAGAGTGAAATAATGAAGGTGGTCAACCTGAAGCAAGCCATTTTGCAAGCCTGGAAGGAGCGCTGGAGTGACTACCAATGGGCAATCA
ACATGAAGAAATTCTTTCCTAAAGGAGCCACCTGGGATATTCTCAACCTGGCAGATGCGTTACTAGAGCAGGCCATGATTGGACCATCCC
CCAATCCTCTCATCTTGTCCTACCTGAAGTATGCCATTAGTTCCCAGTTTGATGACTTTTCTCGGGACCTGTGTGTCCAGGCATTGCTGG
ACATCATGGACATGTTTTGTGACCGTCTGAGCTGTCACGGCAAAGCAGAGGAATGCATCGGACTGTGCCGAGCCCTTCTTAGCGCCCTCC
ACTGGCTGCTGCGCTGCACGGCAGCCTCTGCAGAGCGGCTGCGGGAGGGGCTGGAGGCCGGCACTCCAGCCGCTGGGGAGAAGCAGCTTG
CCATGTGCCTTCAGCGCCTGGAGAAAACCCTCAGCAGCACCAAGAACCGGGCCCTGCTGCACATCGCCAAACTAGAGGAGGCCTCTTCTT
GGACTGCCATCGAGCATTCTCTCTTGAAACTTGGAGAGATCCTGGCCAATCTCAGCAACCCGCAGCTCCGGAGTCAGGCCGAGCAGTGTG
GCACCCTCATTAGGAGCATCCCCACGATGCTGTCTGTGCATGCGGAGCAGATGCACAAGACCGGCTTCCCCACTGTCCACGCCGTGATCC
TGCTCGAGGGCACCATGAACCTGACAGGCGAGACGCAGTCCCTGGTGGAGCAGCTGACGATGGTGAAGCGCATGCAGCATATCCCCACCC
CACTTTTTGTCCTGGAGATCTGGAAAGCTTGCTTCGTGGGGCTCATTGAGTCTCCCGAGGGTACGGAGGAGCTCAAGTGGACAGCTTTCA
CTTTCCTCAAGATTCCACAGGTTTTGGTGAAGTTGAAGAAGTACTCTCATGGAGACAAGGACTTCACTGAGGATGTCAACTGTGCTTTTG
AGTTCCTGCTGAAGCTCACCCCCTTGTTGGACAAAGCTGACCAGCGCTGCAACTGTGACTGTACAAACTTCCTGCTCCAAGAATGTGGCA
AGCAGGGGCTTCTGTCTGAGGCCAGCGTCAACAACCTTATGGCTAAGCGCAAAGCGGACCGAGAGCACGCACCCCAGCAGAAATCGGGAG
AGAATGCCAACATCCAGCCCAACATCCAGCTGATCCTCCGGGCGGAGCCCACTGTCACAAACATCCTCAAGACGATGGATGCAGACCACT
CTAAGTCACCGGAGGGACTGCTGGGAGTCCTGGGCCACATGCTGTCCGGGAAGAGTCTGGACTTGCTGCTGGCTGCCGCCGCCGCCACTG
GAAAGCTGAAATCCTTCGCCCGGAAATTCATCAATTTGAATGAATTCACAACCTATGGCAGCGAAGAAAGCACCAAACCGGCCTCCGTCC
GGGCCCTGCTGTTTGACATCTCCTTCCTCATGCTGTGCCATGTGGCCCAGACCTATGGTTCAGAGGTGATTCTGTCCGAGTCGCGCACAG
GAGCTGAGGTGCCCTTCTTCGAGACCTGGATGCAGACCTGCATGCCTGAGGAGGGCAAGATCCTGAACCCTGACCACCCCTGCTTCCGCC
CCGACTCCACCAAAGTGGAGTCCCTGGTGGCCCTGCTCAACAACTCCTCGGAGATGAAGCTAGTGCAGATGAAGTGGCATGAGGCCTGTC
TCAGCATCTCAGCCGCCATCTTGGAAATCCTCAATGCCTGGGAGAATGGGGTCCTGGCCTTCGAGTCCATCCAGAAAATCACTGATAACA
TCAAAGGGAAGGTATGCAGTCTGGCGGTGTGTGCTGTGGCTTGGCTTGTGGCCCACGTCCGGATGCTGGGGCTGGATGAGCGTGAGAAGT
CGCTGCAGATGATCCGCCAGCTGGCAGGGCCACTGTTTAGTGAGAACACCCTGCAGTTCTACAATGAGAGCTGGGCAAAAGACAACCTGT
GGCCAGGGTCTGGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCA
GCACTAAGTGAGCCTGGGGAGGAACCTCAGCGCCCTTCCCCCTCTGAGCCTGGCACATAGGCACCCAGCCTGCATCTCCCAGGAGGAAGT
GGAGGGGACATCGCTGTTCCCCAGAAACCCACTCTATCCTCACCCTGTTTTGTGCTCTTCCCCTCGCCTGCTAGGGCTGCGGCTTCTGAC
TTCTAGAAGACTAAGGCTGGTCTGTGTTTGCTTGTTTGCCCACCTTTGGCTGATACCCAGAGAACCTGGGCACTTGCTGCCTGATGCCCA
CCCCTGCCAGTCATTCCTCCATTCACCCAGCGGGAGGTGGGATGTGAGACAGCCCACATTGGAAAATCCAGAAAACCGGGAACAGGGATT
TGCCCTTCACAATTCTACTCCCCAGATCCTCTCCCCTGGACACAGGAGACCCACAGGGCAGGACCCTAAGATCTGGGGAAAGGAGGTCCT
GAGAACCTTGAGGTACCCTTAGATCCTTTTCTACCCACTTTCCTATGGAGGATTCCAAGTCACCACTTCTCTCACCGGCTTCTACCAGGG
TCCAGGACTAAGGCGTTTTTCTCCATAGCCTCAACATTTTGGGAATCTTCCCTTAATCACCCTTGCTCCTCCTGGGTGCCTGGAAGATGG
ACTGGCAGAGACCTCTTTGTTGCGTTTTGTGCTTTGATGCCAGGAATGCCGCCTAGTTTATGTCCCCGGTGGGGCACACAGCGGGGGGCG
CCAGGTTTTCCTTGTCCCCCAGCTGCTCTGCCCCTTTCCCCTTCTTCCCTGACTCCAGGCCTGAACCCCTCCCGTGCTGTAATAAATCTT


Top

FusionGenePPI for MED24_PPP1R1B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MED24MED10, MED9, MED29, MED19, MED28, MED26, CDK8, THRA, VDR, PPARA, PPARG, RXRA, MED1, HNF4A, ESR1, ESR2, MED30, BRD4, RPAP2, AR, PARP1, SMAD1, SMAD2, SMAD3, TRRAP, SREBF1, MED12, MED18, ZC3H13, TRIP4, OBFC1, QKI, TRA, MED14, GSK3B, TNFSF11, RPS6KA6, CTDP1, APP, MED13, MED8, MED16, MED17, MED4, MED11, MED21, MED22, PPP6R1, TFIP11, FBXW7, EPAS1, CDK19, MED7, CCNC, NR1I3, TCL1B, MED15, MED20, MED23, MED6, MED25, MED27, KPNB1, XRCC3, EMC2, PPP4R1, ZWINT, KIFAP3, MMGT1, SUCO, LMO2PPP1R1BDLGAP4, CSNK2A1, PPP1CC, PPP1CA, TFCP2, KLHL6, ACTBL2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MED24_PPP1R1B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MED24_PPP1R1B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePPP1R1BC0036341Schizophrenia5PSYGENET
TgenePPP1R1BC0005586Bipolar Disorder4PSYGENET
TgenePPP1R1BC0001973Alcoholic Intoxication, Chronic1PSYGENET
TgenePPP1R1BC0007370Catalepsy1CTD_human
TgenePPP1R1BC0011570Mental Depression1PSYGENET
TgenePPP1R1BC0011581Depressive disorder1PSYGENET
TgenePPP1R1BC0013384Dyskinetic syndrome1CTD_human