FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 21228

FusionGeneSummary for MBP_CBLN2

check button Fusion gene summary
Fusion gene informationFusion gene name: MBP_CBLN2
Fusion gene ID: 21228
HgeneTgene
Gene symbol

MBP

CBLN2

Gene ID

5553

147381

Gene nameproteoglycan 2, pro eosinophil major basic proteincerebellin 2 precursor
SynonymsBMPG|MBP|MBP1|proMBP-
Cytomap

11q12.1

18q22.3

Type of geneprotein-codingprotein-coding
Descriptionbone marrow proteoglycaneosinophil granule major basic proteineosinophil major basic proteinnatural killer cell activatorproteoglycan 2 preproproteinproteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein)cerebellin-2
Modification date2018051920180329
UniProtAcc

P02686

Q8IUK8

Ensembl transtripts involved in fusion geneENST00000382582, ENST00000355994, 
ENST00000397875, ENST00000397866, 
ENST00000397865, ENST00000527041, 
ENST00000359645, ENST00000528160, 
ENST00000397869, ENST00000354542, 
ENST00000526111, ENST00000580402, 
ENST00000579129, ENST00000578193, 
ENST00000397863, ENST00000397860, 
ENST00000487778, 
ENST00000581073, 
ENST00000585159, ENST00000269503, 
ENST00000584764, ENST00000583651, 
Fusion gene scores* DoF score13 X 13 X 3=5072 X 3 X 2=12
# samples 152
** MAII scorelog2(15/507*10)=-1.75702324650746
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/12*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: MBP [Title/Abstract] AND CBLN2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCECTCGA-AJ-A2QM-01AMBPchr18

74817167

-CBLN2chr18

70206007

-
TCGALDUCECTCGA-AJ-A2QM-01AMBPchr18

74817167

-CBLN2chr18

70219871

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000382582ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000382582ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000382582ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000382582ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-5UTRENST00000382582ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000355994ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000355994ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000355994ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000355994ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
5CDS-5UTRENST00000355994ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397875ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397875ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397875ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397875ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-5UTRENST00000397875ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397866ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397866ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397866ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397866ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-5UTRENST00000397866ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397865ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397865ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397865ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397865ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-5UTRENST00000397865ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000527041ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000527041ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000527041ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000527041ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-5UTRENST00000527041ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000359645ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000359645ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000359645ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000359645ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-5UTRENST00000359645ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000528160ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000528160ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000528160ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000528160ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-5UTRENST00000528160ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397869ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397869ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397869ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000397869ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-5UTRENST00000397869ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000354542ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000354542ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000354542ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000354542ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-5UTRENST00000354542ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000526111ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000526111ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000526111ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000526111ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-5UTRENST00000526111ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
In-frameENST00000580402ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
In-frameENST00000580402ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
In-frameENST00000580402ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
In-frameENST00000580402ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
5CDS-5UTRENST00000580402ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000579129ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000579129ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000579129ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000579129ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
5CDS-5UTRENST00000579129ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000578193ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000578193ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000578193ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-3CDSENST00000578193ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-5UTRENST00000578193ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000397863ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000397863ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000397863ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000397863ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
5CDS-5UTRENST00000397863ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000397860ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000397860ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000397860ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
Frame-shitENST00000397860ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
5CDS-5UTRENST00000397860ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
5UTR-3CDSENST00000487778ENST00000581073MBPchr18

74817167

-CBLN2chr18

70206007

-
5UTR-3CDSENST00000487778ENST00000585159MBPchr18

74817167

-CBLN2chr18

70206007

-
5UTR-3CDSENST00000487778ENST00000269503MBPchr18

74817167

-CBLN2chr18

70206007

-
5UTR-3CDSENST00000487778ENST00000584764MBPchr18

74817167

-CBLN2chr18

70206007

-
5UTR-5UTRENST00000487778ENST00000583651MBPchr18

74817167

-CBLN2chr18

70206007

-
intron-intronENST00000382582ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000382582ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000382582ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000382582ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000382582ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000355994ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000355994ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000355994ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000355994ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000355994ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397875ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397875ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397875ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397875ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397875ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397866ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397866ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397866ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397866ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397866ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397865ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397865ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397865ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397865ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397865ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000527041ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000527041ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000527041ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000527041ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000527041ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000359645ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000359645ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000359645ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000359645ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000359645ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000528160ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000528160ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000528160ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000528160ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000528160ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397869ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397869ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397869ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397869ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000397869ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000354542ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000354542ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000354542ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000354542ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000354542ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000526111ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000526111ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000526111ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000526111ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000526111ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000580402ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000580402ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000580402ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000580402ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000580402ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000579129ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000579129ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000579129ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000579129ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000579129ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000578193ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000578193ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000578193ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000578193ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
intron-intronENST00000578193ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000397863ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000397863ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000397863ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000397863ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000397863ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000397860ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000397860ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000397860ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000397860ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
5CDS-intronENST00000397860ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-
5UTR-intronENST00000487778ENST00000581073MBPchr18

74817167

-CBLN2chr18

70219871

-
5UTR-intronENST00000487778ENST00000585159MBPchr18

74817167

-CBLN2chr18

70219871

-
5UTR-intronENST00000487778ENST00000269503MBPchr18

74817167

-CBLN2chr18

70219871

-
5UTR-intronENST00000487778ENST00000584764MBPchr18

74817167

-CBLN2chr18

70219871

-
5UTR-intronENST00000487778ENST00000583651MBPchr18

74817167

-CBLN2chr18

70219871

-

Top

FusionProtFeatures for MBP_CBLN2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MBP

P02686

CBLN2

Q8IUK8

May play role in synaptogenesis induction.{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for MBP_CBLN2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MBP_ENST00000580402_chr18_74817167_-_CBLN2_ENST00000581073_chr18_70206007_-_123aa
MGNHAGKRELNAEKASTVLVNIGNHFDLASSIFVAPRKGITSFSFHVVKVTNRQTIQVSLMQNGYPVISAFAGDQDVTREAASNGVLLLM

>In-frame_MBP_ENST00000580402_chr18_74817167_-_CBLN2_ENST00000585159_chr18_70206007_-_123aa
MGNHAGKRELNAEKASTVLVNIGNHFDLASSIFVAPRKGITSFSFHVVKVTNRQTIQVSLMQNGYPVISAFAGDQDVTREAASNGVLLLM

>In-frame_MBP_ENST00000580402_chr18_74817167_-_CBLN2_ENST00000269503_chr18_70206007_-_123aa
MGNHAGKRELNAEKASTVLVNIGNHFDLASSIFVAPRKGITSFSFHVVKVTNRQTIQVSLMQNGYPVISAFAGDQDVTREAASNGVLLLM

>In-frame_MBP_ENST00000580402_chr18_74817167_-_CBLN2_ENST00000584764_chr18_70206007_-_123aa
MGNHAGKRELNAEKASTVLVNIGNHFDLASSIFVAPRKGITSFSFHVVKVTNRQTIQVSLMQNGYPVISAFAGDQDVTREAASNGVLLLM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MBP_ENST00000580402_chr18_74817167_-_CBLN2_ENST00000581073_chr18_70206007_-_369nt
ATGGGAAACCACGCAGGCAAACGAGAATTAAATGCCGAGAAGGCCAGTACGGTATTAGTAAATATTGGCAACCACTTTGATCTTGCTTCC
AGTATATTTGTAGCACCGAGAAAAGGGATTTATAGCTTCAGCTTCCACGTGGTCAAAGTGTATAACAGACAAACCATCCAGGTCAGTTTA
ATGCAGAATGGCTACCCAGTGATCTCGGCCTTTGCAGGAGACCAGGATGTCACCAGAGAAGCTGCTAGCAATGGCGTGCTGCTGCTCATG
GAAAGGGAAGACAAAGTGCATCTCAAACTTGAGAGAGGCAACCTCATGGGGGGCTGGAAATACTCCACATTCTCGGGCTTCTTGGTGTTT

>In-frame_MBP_ENST00000580402_chr18_74817167_-_CBLN2_ENST00000585159_chr18_70206007_-_369nt
ATGGGAAACCACGCAGGCAAACGAGAATTAAATGCCGAGAAGGCCAGTACGGTATTAGTAAATATTGGCAACCACTTTGATCTTGCTTCC
AGTATATTTGTAGCACCGAGAAAAGGGATTTATAGCTTCAGCTTCCACGTGGTCAAAGTGTATAACAGACAAACCATCCAGGTCAGTTTA
ATGCAGAATGGCTACCCAGTGATCTCGGCCTTTGCAGGAGACCAGGATGTCACCAGAGAAGCTGCTAGCAATGGCGTGCTGCTGCTCATG
GAAAGGGAAGACAAAGTGCATCTCAAACTTGAGAGAGGCAACCTCATGGGGGGCTGGAAATACTCCACATTCTCGGGCTTCTTGGTGTTT

>In-frame_MBP_ENST00000580402_chr18_74817167_-_CBLN2_ENST00000269503_chr18_70206007_-_369nt
ATGGGAAACCACGCAGGCAAACGAGAATTAAATGCCGAGAAGGCCAGTACGGTATTAGTAAATATTGGCAACCACTTTGATCTTGCTTCC
AGTATATTTGTAGCACCGAGAAAAGGGATTTATAGCTTCAGCTTCCACGTGGTCAAAGTGTATAACAGACAAACCATCCAGGTCAGTTTA
ATGCAGAATGGCTACCCAGTGATCTCGGCCTTTGCAGGAGACCAGGATGTCACCAGAGAAGCTGCTAGCAATGGCGTGCTGCTGCTCATG
GAAAGGGAAGACAAAGTGCATCTCAAACTTGAGAGAGGCAACCTCATGGGGGGCTGGAAATACTCCACATTCTCGGGCTTCTTGGTGTTT

>In-frame_MBP_ENST00000580402_chr18_74817167_-_CBLN2_ENST00000584764_chr18_70206007_-_369nt
ATGGGAAACCACGCAGGCAAACGAGAATTAAATGCCGAGAAGGCCAGTACGGTATTAGTAAATATTGGCAACCACTTTGATCTTGCTTCC
AGTATATTTGTAGCACCGAGAAAAGGGATTTATAGCTTCAGCTTCCACGTGGTCAAAGTGTATAACAGACAAACCATCCAGGTCAGTTTA
ATGCAGAATGGCTACCCAGTGATCTCGGCCTTTGCAGGAGACCAGGATGTCACCAGAGAAGCTGCTAGCAATGGCGTGCTGCTGCTCATG
GAAAGGGAAGACAAAGTGCATCTCAAACTTGAGAGAGGCAACCTCATGGGGGGCTGGAAATACTCCACATTCTCGGGCTTCTTGGTGTTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_MBP_ENST00000580402_chr18_74817167_-_CBLN2_ENST00000581073_chr18_70206007_-_395nt
ATGGGAAACCACGCAGGCAAACGAGAATTAAATGCCGAGAAGGCCAGTACGGTATTAGTAAATATTGGCAACCACTTTGATCTTGCTTCC
AGTATATTTGTAGCACCGAGAAAAGGGATTTATAGCTTCAGCTTCCACGTGGTCAAAGTGTATAACAGACAAACCATCCAGGTCAGTTTA
ATGCAGAATGGCTACCCAGTGATCTCGGCCTTTGCAGGAGACCAGGATGTCACCAGAGAAGCTGCTAGCAATGGCGTGCTGCTGCTCATG
GAAAGGGAAGACAAAGTGCATCTCAAACTTGAGAGAGGCAACCTCATGGGGGGCTGGAAATACTCCACATTCTCGGGCTTCTTGGTGTTT

>In-frame_MBP_ENST00000580402_chr18_74817167_-_CBLN2_ENST00000585159_chr18_70206007_-_1865nt
ATGGGAAACCACGCAGGCAAACGAGAATTAAATGCCGAGAAGGCCAGTACGGTATTAGTAAATATTGGCAACCACTTTGATCTTGCTTCC
AGTATATTTGTAGCACCGAGAAAAGGGATTTATAGCTTCAGCTTCCACGTGGTCAAAGTGTATAACAGACAAACCATCCAGGTCAGTTTA
ATGCAGAATGGCTACCCAGTGATCTCGGCCTTTGCAGGAGACCAGGATGTCACCAGAGAAGCTGCTAGCAATGGCGTGCTGCTGCTCATG
GAAAGGGAAGACAAAGTGCATCTCAAACTTGAGAGAGGCAACCTCATGGGGGGCTGGAAATACTCCACATTCTCGGGCTTCTTGGTGTTT
CCTCTATAAACACAGAGCCCCCTAGATGGTGGGGGAATGGCAAACTGGACCCAGGACTCCGCCCTTTAAAACACCCTGAACTTACTGGAA
TTGGACACCTTGTTTCCAACCTCCGTCAGACTGTTGCAGTAGAAGAATGATTTCCTTTGAAACCTCCAGTACTTTTGTTTTTGTTTTTTG
GAATACTGACAATTCCTCGGGAACCTGGCCTCTAATTAGTTTTAGATGACAAGGTCTTAAGGAGAAATGAAATTATCGATTTGAGCAATT
TGTACCTGTGATTGTAAAGTCAATATCGGATTTTATTGTTGGGACCATGGACCTCTTTTGTTTGTATGTTGTATTGTCGTCCCAACGGAA
GGAGAGCTCCTGACTCCAGGATGGGCTGCAGGTTGCAGTCAGGGCTTGAAGTAGGAGCCCAGCAAAGAACCACCTGCTGGACAGTCCTTG
ACATGTGTTCTGTGTGTGTCTGTATAGCCTTAAGAAAAAGAATGGCTTCACTTTCATTCTGTATTCTTCCCCCCACCATGTGGCTGGGAG
GACTTGGGAGGGGGATGGGGACATTGGGAACCTGTCAAGAAGTGCTTTATCCAGAGAAGCAAATTTTGCACGATTGGACTGCAATTTTTG
TTTTGTATTGTTTGTGTTTTTTCTTGAAAAGCTTTACTTTTCTTTCCACACTCAGCTCTCCCTCCTCAACCCCACTTTTATTTTTCTTGC
TGGGGTTGAGGAGAGAAAATATAGAATTCCTGGATAAGACCAAACAAAACAAAACATTAAAATACCTGTATGTTTTGTTTTAGACGAGAC
CAAACTAAACAAAAAGTATCTGTTTATCAAAGTAAAAGTAACACAATGGACAATTCTGCTTATTCTCTCAAAGAGATTCTAAGATGCACC
TTTAGAACTATTAATAGCAACCTGCATTTTTTTTTAATTTATACTTCAGAATCCTTTAAGAACCTGGTGTTCCTGAGTGGTCCTGAATCA
TATAAGTTGGTAATGGAAGCTGTAATGACCAAGTCCCCTAAACATACTATGTCTTTGCCACGTGTGCTGTGACTTCTCTGTGGGTGATTT
AATTTATTTGGATCCACCTCTGAGTGAGCGCACAGTGATCAGGTGCTTCAAAGCCAACAGACCAGCTCCTCTTCCTCCGGATCCTCTTTT
GATCTGCCCAGGAAAGGGATGCATTGACACTCTCCTGCATGCACCTGGCGAGAAGCCACCTGAAAGTCACTGTGGTTAAAGATATTGGTG
GAGGTACCCCAGGAGCACTGTTACAAATCCTTCTTGTTTTGGCATCTCGTACAACATTATTAAGACACAGCTGAGAGTTGATGGGTGTGT
AATGCATATGCCAAGGAAATGTCACTAATCCCAAAGCAATCAAAAAGGAGACCTCAAACCAGATGTTAATTTGTTCTTTGTGTAACAATG

>In-frame_MBP_ENST00000580402_chr18_74817167_-_CBLN2_ENST00000269503_chr18_70206007_-_1865nt
ATGGGAAACCACGCAGGCAAACGAGAATTAAATGCCGAGAAGGCCAGTACGGTATTAGTAAATATTGGCAACCACTTTGATCTTGCTTCC
AGTATATTTGTAGCACCGAGAAAAGGGATTTATAGCTTCAGCTTCCACGTGGTCAAAGTGTATAACAGACAAACCATCCAGGTCAGTTTA
ATGCAGAATGGCTACCCAGTGATCTCGGCCTTTGCAGGAGACCAGGATGTCACCAGAGAAGCTGCTAGCAATGGCGTGCTGCTGCTCATG
GAAAGGGAAGACAAAGTGCATCTCAAACTTGAGAGAGGCAACCTCATGGGGGGCTGGAAATACTCCACATTCTCGGGCTTCTTGGTGTTT
CCTCTATAAACACAGAGCCCCCTAGATGGTGGGGGAATGGCAAACTGGACCCAGGACTCCGCCCTTTAAAACACCCTGAACTTACTGGAA
TTGGACACCTTGTTTCCAACCTCCGTCAGACTGTTGCAGTAGAAGAATGATTTCCTTTGAAACCTCCAGTACTTTTGTTTTTGTTTTTTG
GAATACTGACAATTCCTCGGGAACCTGGCCTCTAATTAGTTTTAGATGACAAGGTCTTAAGGAGAAATGAAATTATCGATTTGAGCAATT
TGTACCTGTGATTGTAAAGTCAATATCGGATTTTATTGTTGGGACCATGGACCTCTTTTGTTTGTATGTTGTATTGTCGTCCCAACGGAA
GGAGAGCTCCTGACTCCAGGATGGGCTGCAGGTTGCAGTCAGGGCTTGAAGTAGGAGCCCAGCAAAGAACCACCTGCTGGACAGTCCTTG
ACATGTGTTCTGTGTGTGTCTGTATAGCCTTAAGAAAAAGAATGGCTTCACTTTCATTCTGTATTCTTCCCCCCACCATGTGGCTGGGAG
GACTTGGGAGGGGGATGGGGACATTGGGAACCTGTCAAGAAGTGCTTTATCCAGAGAAGCAAATTTTGCACGATTGGACTGCAATTTTTG
TTTTGTATTGTTTGTGTTTTTTCTTGAAAAGCTTTACTTTTCTTTCCACACTCAGCTCTCCCTCCTCAACCCCACTTTTATTTTTCTTGC
TGGGGTTGAGGAGAGAAAATATAGAATTCCTGGATAAGACCAAACAAAACAAAACATTAAAATACCTGTATGTTTTGTTTTAGACGAGAC
CAAACTAAACAAAAAGTATCTGTTTATCAAAGTAAAAGTAACACAATGGACAATTCTGCTTATTCTCTCAAAGAGATTCTAAGATGCACC
TTTAGAACTATTAATAGCAACCTGCATTTTTTTTTAATTTATACTTCAGAATCCTTTAAGAACCTGGTGTTCCTGAGTGGTCCTGAATCA
TATAAGTTGGTAATGGAAGCTGTAATGACCAAGTCCCCTAAACATACTATGTCTTTGCCACGTGTGCTGTGACTTCTCTGTGGGTGATTT
AATTTATTTGGATCCACCTCTGAGTGAGCGCACAGTGATCAGGTGCTTCAAAGCCAACAGACCAGCTCCTCTTCCTCCGGATCCTCTTTT
GATCTGCCCAGGAAAGGGATGCATTGACACTCTCCTGCATGCACCTGGCGAGAAGCCACCTGAAAGTCACTGTGGTTAAAGATATTGGTG
GAGGTACCCCAGGAGCACTGTTACAAATCCTTCTTGTTTTGGCATCTCGTACAACATTATTAAGACACAGCTGAGAGTTGATGGGTGTGT
AATGCATATGCCAAGGAAATGTCACTAATCCCAAAGCAATCAAAAAGGAGACCTCAAACCAGATGTTAATTTGTTCTTTGTGTAACAATG

>In-frame_MBP_ENST00000580402_chr18_74817167_-_CBLN2_ENST00000584764_chr18_70206007_-_525nt
ATGGGAAACCACGCAGGCAAACGAGAATTAAATGCCGAGAAGGCCAGTACGGTATTAGTAAATATTGGCAACCACTTTGATCTTGCTTCC
AGTATATTTGTAGCACCGAGAAAAGGGATTTATAGCTTCAGCTTCCACGTGGTCAAAGTGTATAACAGACAAACCATCCAGGTCAGTTTA
ATGCAGAATGGCTACCCAGTGATCTCGGCCTTTGCAGGAGACCAGGATGTCACCAGAGAAGCTGCTAGCAATGGCGTGCTGCTGCTCATG
GAAAGGGAAGACAAAGTGCATCTCAAACTTGAGAGAGGCAACCTCATGGGGGGCTGGAAATACTCCACATTCTCGGGCTTCTTGGTGTTT
CCTCTATAAACACAGAGCCCCCTAGATGGTGGGGGAATGGCAAACTGGACCCAGGACTCCGCCCTTTAAAACACCCTGAACTTACTGGAA


Top

FusionGenePPI for MBP_CBLN2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MBPTRPM7, PRMT5, STK39, HLA-DRA, PLP1, TSSK6, IRAK4, PRKCA, PRKCI, PRKCZ, PPP2R5C, LIMK1, LIMK2, TBK1, IKBKE, STK3, APTX, ATN1, ATXN1, MAPK14, LRRK2, PRKDC, MAPK12, MAPK11, MAPK13, MAPK3, MAPK1, CDK1, CDK5, MAP3K5, TLK1, RPS6KA6, DDX58, MELK, CDK7, CDK8, CDK9, HIPK2, SQSTM1, PKN1, ULK1, PRKCB, MAP3K3, CTDSP1, ABL1, MUS81, RPS6KA5, MYH6, MAP3K1, MAPK8, CTDSPL, NLN, IDE, PTPRA, PRKCDCBLN2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MBP_CBLN2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MBP_CBLN2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMBPC0036341Schizophrenia4PSYGENET
HgeneMBPC0014072Experimental Autoimmune Encephalomyelitis3CTD_human
HgeneMBPC0001973Alcoholic Intoxication, Chronic1PSYGENET
HgeneMBPC0011303Demyelinating Diseases1CTD_human
HgeneMBPC0027873Neuromyelitis Optica1CTD_human
TgeneCBLN2C0020542Pulmonary Hypertension1CTD_human