FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 20813

FusionGeneSummary for MAP2K4_NIPSNAP1

check button Fusion gene summary
Fusion gene informationFusion gene name: MAP2K4_NIPSNAP1
Fusion gene ID: 20813
HgeneTgene
Gene symbol

MAP2K4

NIPSNAP1

Gene ID

6416

8508

Gene namemitogen-activated protein kinase kinase 4nipsnap homolog 1
SynonymsJNKK|JNKK1|MAPKK4|MEK4|MKK4|PRKMK4|SAPKK-1|SAPKK1|SEK1|SERK1|SKK1-
Cytomap

17p12

22q12.2

Type of geneprotein-codingprotein-coding
Descriptiondual specificity mitogen-activated protein kinase kinase 4JNK-activated kinase 1JNK-activating kinase 1MAP kinase kinase 4MAPK/ERK kinase 4MAPKK 4MEK 4SAPK/ERK kinase 1c-Jun N-terminal kinase kinase 1stress-activated protein kinase kinase 1protein NipSnap homolog 14-nitrophenylphosphatase domain and non-neuronal SNAP25-like 1
Modification date2018052320180523
UniProtAcc

P45985

Q9BPW8

Ensembl transtripts involved in fusion geneENST00000353533, ENST00000415385, 
ENST00000581941, 
ENST00000216121, 
ENST00000494966, 
Fusion gene scores* DoF score6 X 4 X 5=1206 X 3 X 6=108
# samples 76
** MAII scorelog2(7/120*10)=-0.777607578663552
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/108*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MAP2K4 [Title/Abstract] AND NIPSNAP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-BH-A0W7-01AMAP2K4chr17

11924318

+NIPSNAP1chr22

29957851

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000353533ENST00000216121MAP2K4chr17

11924318

+NIPSNAP1chr22

29957851

-
5CDS-intronENST00000353533ENST00000494966MAP2K4chr17

11924318

+NIPSNAP1chr22

29957851

-
In-frameENST00000415385ENST00000216121MAP2K4chr17

11924318

+NIPSNAP1chr22

29957851

-
5CDS-intronENST00000415385ENST00000494966MAP2K4chr17

11924318

+NIPSNAP1chr22

29957851

-
intron-3CDSENST00000581941ENST00000216121MAP2K4chr17

11924318

+NIPSNAP1chr22

29957851

-
intron-intronENST00000581941ENST00000494966MAP2K4chr17

11924318

+NIPSNAP1chr22

29957851

-

Top

FusionProtFeatures for MAP2K4_NIPSNAP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MAP2K4

P45985

NIPSNAP1

Q9BPW8

Dual specificity protein kinase which acts as anessential component of the MAP kinase signal transduction pathway.Essential component of the stress-activated protein kinase/c-JunN-terminal kinase (SAP/JNK) signaling pathway. With MAP2K7/MKK7,is the one of the only known kinase to directly activate thestress-activated protein kinase/c-Jun N-terminal kinasesMAPK8/JNK1, MAPK9/JNK2 and MAPK10/JNK3. MAP2K4/MKK4 andMAP2K7/MKK7 both activate the JNKs by phosphorylation, but theydiffer in their preference for the phosphorylation site in theThr-Pro-Tyr motif. MAP2K4 shows preference for phosphorylation ofthe Tyr residue and MAP2K7/MKK7 for the Thr residue. Thephosphorylation of the Thr residue by MAP2K7/MKK7 seems to be theprerequisite for JNK activation at least in response toproinflammatory cytokines, while other stimuli activate bothMAP2K4/MKK4 and MAP2K7/MKK7 which synergistically phosphorylateJNKs. MAP2K4 is required for maintaining peripheral lymphoidhomeostasis. The MKK/JNK signaling pathway is also involved inmitochondrial death signaling pathway, including the releasecytochrome c, leading to apoptosis. Whereas MAP2K7/MKK7exclusively activates JNKs, MAP2K4/MKK4 additionally activates thep38 MAPKs MAPK11, MAPK12, MAPK13 and MAPK14.{ECO:0000269|PubMed:7716521}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMAP2K4chr17:11924318chr22:29957851ENST00000353533+1115_1938400Compositional biasNote=Gly/Ser-rich
HgeneMAP2K4chr17:11924318chr22:29957851ENST00000415385+1125_1938411Compositional biasNote=Gly/Ser-rich

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneMAP2K4chr17:11924318chr22:29957851ENST00000353533+111102_36738400DomainProtein kinase
HgeneMAP2K4chr17:11924318chr22:29957851ENST00000415385+112102_36738411DomainProtein kinase
HgeneMAP2K4chr17:11924318chr22:29957851ENST00000353533+111108_11638400Nucleotide bindingATP
HgeneMAP2K4chr17:11924318chr22:29957851ENST00000415385+112108_11638411Nucleotide bindingATP
HgeneMAP2K4chr17:11924318chr22:29957851ENST00000353533+111364_38738400RegionNote=DVD domain
HgeneMAP2K4chr17:11924318chr22:29957851ENST00000353533+11137_5238400RegionNote=D domain
HgeneMAP2K4chr17:11924318chr22:29957851ENST00000415385+112364_38738411RegionNote=DVD domain
HgeneMAP2K4chr17:11924318chr22:29957851ENST00000415385+11237_5238411RegionNote=D domain


Top

FusionGeneSequence for MAP2K4_NIPSNAP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MAP2K4_ENST00000353533_chr17_11924318_+_NIPSNAP1_ENST00000216121_chr22_29957851_-_201aa
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQVHLWRFSGGYPALMDCMNKLKNNKEYLEFRRERSQMLLSRRNQLLLEFSFWN
EPQPRMGPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTV

>In-frame_MAP2K4_ENST00000415385_chr17_11924318_+_NIPSNAP1_ENST00000216121_chr22_29957851_-_201aa
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQVHLWRFSGGYPALMDCMNKLKNNKEYLEFRRERSQMLLSRRNQLLLEFSFWN
EPQPRMGPNIYELRTYKLKPGTMIEWGNNWARAIKYRQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MAP2K4_ENST00000353533_chr17_11924318_+_NIPSNAP1_ENST00000216121_chr22_29957851_-_603nt
ATGGCGGCTCCGAGCCCGAGCGGCGGCGGCGGCTCCGGGGGCGGCAGCGGCAGCGGCACCCCCGGCCCCGTAGGGTCCCCGGCGCCAGGC
CACCCGGCCGTCAGCAGCATGCAGGTGCACCTGTGGCGATTCTCAGGTGGCTACCCAGCCCTCATGGACTGCATGAACAAGCTCAAAAAC
AATAAGGAGTACCTGGAGTTCCGAAGGGAGCGGAGCCAGATGCTGCTGTCCAGGAGAAACCAGCTGCTCCTCGAGTTCAGCTTCTGGAAT
GAGCCACAGCCCAGAATGGGTCCCAACATCTATGAGCTGAGGACATACAAGCTCAAGCCAGGAACCATGATCGAGTGGGGGAACAACTGG
GCTCGGGCCATCAAGTACCGGCAGGAGAACCAGGAGGCAGTGGGCGGCTTCTTCTCACAGATAGGAGAGCTCTACGTGGTGCACCATCTC
TGGGCCTATAAAGACCTGCAGTCTCGGGAGGAGACTCGAAACGCTGCCTGGAGGAAGAGAGGCTGGGATGAAAATGTCTACTATACAGTC

>In-frame_MAP2K4_ENST00000415385_chr17_11924318_+_NIPSNAP1_ENST00000216121_chr22_29957851_-_603nt
ATGGCGGCTCCGAGCCCGAGCGGCGGCGGCGGCTCCGGGGGCGGCAGCGGCAGCGGCACCCCCGGCCCCGTAGGGTCCCCGGCGCCAGGC
CACCCGGCCGTCAGCAGCATGCAGGTGCACCTGTGGCGATTCTCAGGTGGCTACCCAGCCCTCATGGACTGCATGAACAAGCTCAAAAAC
AATAAGGAGTACCTGGAGTTCCGAAGGGAGCGGAGCCAGATGCTGCTGTCCAGGAGAAACCAGCTGCTCCTCGAGTTCAGCTTCTGGAAT
GAGCCACAGCCCAGAATGGGTCCCAACATCTATGAGCTGAGGACATACAAGCTCAAGCCAGGAACCATGATCGAGTGGGGGAACAACTGG
GCTCGGGCCATCAAGTACCGGCAGGAGAACCAGGAGGCAGTGGGCGGCTTCTTCTCACAGATAGGAGAGCTCTACGTGGTGCACCATCTC
TGGGCCTATAAAGACCTGCAGTCTCGGGAGGAGACTCGAAACGCTGCCTGGAGGAAGAGAGGCTGGGATGAAAATGTCTACTATACAGTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_MAP2K4_ENST00000353533_chr17_11924318_+_NIPSNAP1_ENST00000216121_chr22_29957851_-_1793nt
GCGAGAGGCCGAGCTTGCTGCATTGCAGCCGCCGCGGCGCCGCTCGGCTCTTCACTCCCAACAATGGCGGCTCCGAGCCCGAGCGGCGGC
GGCGGCTCCGGGGGCGGCAGCGGCAGCGGCACCCCCGGCCCCGTAGGGTCCCCGGCGCCAGGCCACCCGGCCGTCAGCAGCATGCAGGTG
CACCTGTGGCGATTCTCAGGTGGCTACCCAGCCCTCATGGACTGCATGAACAAGCTCAAAAACAATAAGGAGTACCTGGAGTTCCGAAGG
GAGCGGAGCCAGATGCTGCTGTCCAGGAGAAACCAGCTGCTCCTCGAGTTCAGCTTCTGGAATGAGCCACAGCCCAGAATGGGTCCCAAC
ATCTATGAGCTGAGGACATACAAGCTCAAGCCAGGAACCATGATCGAGTGGGGGAACAACTGGGCTCGGGCCATCAAGTACCGGCAGGAG
AACCAGGAGGCAGTGGGCGGCTTCTTCTCACAGATAGGAGAGCTCTACGTGGTGCACCATCTCTGGGCCTATAAAGACCTGCAGTCTCGG
GAGGAGACTCGAAACGCTGCCTGGAGGAAGAGAGGCTGGGATGAAAATGTCTACTATACAGTCCCCCTGGTGCGACACATGGAGTCTAGG
ATCATGATCCCCTTGAAGATCTCGCCTCTGCAGTGATGCTGCCTACACCTCCACCTCCTTCCCCTTCTCCCTCAGGCAACCCCGACAGAC
AGTGGCACTCCTGGTCCTGCTGTCTTGGTTTTGTCTTGGCTCTGGGAGGACTCTGAGGGGCAGTGCTCAGTTCAGACAAGGGGGAACTGA
AGGCTGACAAGTTCTGAGGATTACAGCTCTGCCCAGGCCCTTTCTACTTTCCCTGCCTGCCTCCCTCCCCCTGCTAGAAGTAGTTTCTGA
TTTCCCTGAATGAAAGATAGTGATCTTTTAGGCCTTCATTTATCTTCTAAAATTCCTCATCTCAAGGCCACCAGTCCCCAGTTATCACCC
TTGGAAATCCTCTGTTTAGCTTAGTTGCACAAAAGGTAGTATGTCCAGTGGCTAGAGGTGGGGTGGGAAGAGAGGAGGCCAGGCCAGGCC
CTCAGGAATTCCCTGGTTTCCACTGGGCCACCCACTTGCTGGACAGTCTGAGCCAAGTCCCTCCTGCTGGAGAAAAGCCTGGAACTGCCA
AAACAAAAAAACAAATACAAACAAACCTCGTCACCACGGTCAGGAGGAGGTTCAGACATTCTGCCCAGAGGGGCTGGGGAAAGGGATGGG
AGCCAGGAAAGATTTAGGGGCAGGAGACAGACACGTAACAGGAACTCGGAAGGTAGAACTTAGAATTCAGAACTTGGGTTTCAATTGTAG
AATTTGGAATCTGGAATACAGAATTGGGAAGAAGAACAGAGATGACAAAAGACCACTTGAAGAGAGGTTCCTAATACTAGACAGATGGAG
AGTGGCTTGGCTGTTTCCCCCTGCATATTGGGGTTGAAAACTTAAATGTGTAGTTCCAGTCCTTCTATGCAGAGTCTCTCCTGCCCTCCC
TCCTTCCTGCAGGCAAATATACAAGCTAGACCCTGTTCCCTCACCCTGTATCCTGTCTCCCCTAATTGACATTCTATCAGCCCAACCCTC
ATTCTGCAGGGCCACCTGGTGTGTGGAGGTGGCGGGAGGGGTCAGTGACTCTGGGGGTCTCCTCAGTGACCCCCATACCTCATCATGAAC

>In-frame_MAP2K4_ENST00000415385_chr17_11924318_+_NIPSNAP1_ENST00000216121_chr22_29957851_-_1783nt
GAGCTTGCTGCATTGCAGCCGCCGCGGCGCCGCTCGGCTCTTCACTCCCAACAATGGCGGCTCCGAGCCCGAGCGGCGGCGGCGGCTCCG
GGGGCGGCAGCGGCAGCGGCACCCCCGGCCCCGTAGGGTCCCCGGCGCCAGGCCACCCGGCCGTCAGCAGCATGCAGGTGCACCTGTGGC
GATTCTCAGGTGGCTACCCAGCCCTCATGGACTGCATGAACAAGCTCAAAAACAATAAGGAGTACCTGGAGTTCCGAAGGGAGCGGAGCC
AGATGCTGCTGTCCAGGAGAAACCAGCTGCTCCTCGAGTTCAGCTTCTGGAATGAGCCACAGCCCAGAATGGGTCCCAACATCTATGAGC
TGAGGACATACAAGCTCAAGCCAGGAACCATGATCGAGTGGGGGAACAACTGGGCTCGGGCCATCAAGTACCGGCAGGAGAACCAGGAGG
CAGTGGGCGGCTTCTTCTCACAGATAGGAGAGCTCTACGTGGTGCACCATCTCTGGGCCTATAAAGACCTGCAGTCTCGGGAGGAGACTC
GAAACGCTGCCTGGAGGAAGAGAGGCTGGGATGAAAATGTCTACTATACAGTCCCCCTGGTGCGACACATGGAGTCTAGGATCATGATCC
CCTTGAAGATCTCGCCTCTGCAGTGATGCTGCCTACACCTCCACCTCCTTCCCCTTCTCCCTCAGGCAACCCCGACAGACAGTGGCACTC
CTGGTCCTGCTGTCTTGGTTTTGTCTTGGCTCTGGGAGGACTCTGAGGGGCAGTGCTCAGTTCAGACAAGGGGGAACTGAAGGCTGACAA
GTTCTGAGGATTACAGCTCTGCCCAGGCCCTTTCTACTTTCCCTGCCTGCCTCCCTCCCCCTGCTAGAAGTAGTTTCTGATTTCCCTGAA
TGAAAGATAGTGATCTTTTAGGCCTTCATTTATCTTCTAAAATTCCTCATCTCAAGGCCACCAGTCCCCAGTTATCACCCTTGGAAATCC
TCTGTTTAGCTTAGTTGCACAAAAGGTAGTATGTCCAGTGGCTAGAGGTGGGGTGGGAAGAGAGGAGGCCAGGCCAGGCCCTCAGGAATT
CCCTGGTTTCCACTGGGCCACCCACTTGCTGGACAGTCTGAGCCAAGTCCCTCCTGCTGGAGAAAAGCCTGGAACTGCCAAAACAAAAAA
ACAAATACAAACAAACCTCGTCACCACGGTCAGGAGGAGGTTCAGACATTCTGCCCAGAGGGGCTGGGGAAAGGGATGGGAGCCAGGAAA
GATTTAGGGGCAGGAGACAGACACGTAACAGGAACTCGGAAGGTAGAACTTAGAATTCAGAACTTGGGTTTCAATTGTAGAATTTGGAAT
CTGGAATACAGAATTGGGAAGAAGAACAGAGATGACAAAAGACCACTTGAAGAGAGGTTCCTAATACTAGACAGATGGAGAGTGGCTTGG
CTGTTTCCCCCTGCATATTGGGGTTGAAAACTTAAATGTGTAGTTCCAGTCCTTCTATGCAGAGTCTCTCCTGCCCTCCCTCCTTCCTGC
AGGCAAATATACAAGCTAGACCCTGTTCCCTCACCCTGTATCCTGTCTCCCCTAATTGACATTCTATCAGCCCAACCCTCATTCTGCAGG
GCCACCTGGTGTGTGGAGGTGGCGGGAGGGGTCAGTGACTCTGGGGGTCTCCTCAGTGACCCCCATACCTCATCATGAACCCTTGGGTAG


Top

FusionGenePPI for MAP2K4_NIPSNAP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MAP2K4FLNC, SPAG9, MAPK8, MAP4K2, MAP2K7, MAP3K8, AKT1, MAPK8IP3, MAP3K11, MAP3K4, ARRB2, MAP3K2, MAP3K1, NPHS1, ITCH, MAPK9, BLNK, PML, MAPK10, MAP3K5, MAP2K6, MAP2K4, MAPK14, MAP3K3, LRRK2, APP, JUN, MAP3K7, ARRB1, MAPK1, GCH1, GEMIN5, RBBP8, EGFR, MAP3K10, NBR1, KTI12, VASP, FLNB, CDC5L, UBC, TRIM25NIPSNAP1RGS2, GABARAPL1, GABARAPL2, GBAS, MAP1LC3A, MAP1LC3B, SQSTM1, ICT1, PRKCI, DBI, CDH1, NPM1, AMOT, CTTNBP2NL, PARK2, VCP, ENO1, SHMT2, MOV10, NXF1, CUL7, OBSL1, FOXRED2, UBE2A, UBE2B, KCMF1, NTRK1, TCTN3, XPO1, CCT6A, FAT1, HSPD1, PLEC, PRKAA2, TCF20, TCP1, CCT3, BCL7B, GTF3C5, KNTC1, CCT7, CCT4, CCT2, IVNS1ABP, CCT8, HPSE, POP1, FNDC3A, CCT5, GANAB, ARHGEF12, ZNF281, C10orf12, HP1BP3, HAUS6, MRPS18A, ASCC2, TNRC18, DNAJC21, NSMCE2, GABARAP, COQ9, NDUFA4, CISD3, NDUFS3, C15orf48, CHCHD2, PTPMT1, IFT140, WDR19


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MAP2K4_NIPSNAP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MAP2K4_NIPSNAP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource