FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 20689

FusionGeneSummary for MALT1_NOL4

check button Fusion gene summary
Fusion gene informationFusion gene name: MALT1_NOL4
Fusion gene ID: 20689
HgeneTgene
Gene symbol

MALT1

NOL4

Gene ID

10892

8715

Gene nameMALT1 paracaspasenucleolar protein 4
SynonymsIMD12|MLT|MLT1|PCASP1CT125|HRIHFB2255|NOLP
Cytomap

18q21.32

18q12.1

Type of geneprotein-codingprotein-coding
Descriptionmucosa-associated lymphoid tissue lymphoma translocation protein 1MALT lymphoma-associated translocationMALT1 proteasecaspase-like proteinmucosa associated lymphoid tissue lymphoma translocation gene 1paracaspaseparacaspase-1nucleolar protein 4cancer/testis antigen 125nucleolar localized protein
Modification date2018052920180519
UniProtAcc

Q9UDY8

O94818

Ensembl transtripts involved in fusion geneENST00000348428, ENST00000345724, 
ENST00000261592, ENST00000269185, 
ENST00000535384, ENST00000535475, 
ENST00000589544, ENST00000538587, 
ENST00000590846, 
Fusion gene scores* DoF score4 X 4 X 3=484 X 4 X 4=64
# samples 54
** MAII scorelog2(5/48*10)=0.0588936890535686
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: MALT1 [Title/Abstract] AND NOL4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneMALT1

GO:0006508

proteolysis

18223652

HgeneMALT1

GO:0042981

regulation of apoptotic process

12819136

HgeneMALT1

GO:0050852

T cell receptor signaling pathway

15125833

HgeneMALT1

GO:0051168

nuclear export

16123224

HgeneMALT1

GO:0051259

protein complex oligomerization

15125833


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-77-8131-01AMALT1chr18

56367823

+NOL4chr18

31432999

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000348428ENST00000261592MALT1chr18

56367823

+NOL4chr18

31432999

-
Frame-shitENST00000348428ENST00000269185MALT1chr18

56367823

+NOL4chr18

31432999

-
Frame-shitENST00000348428ENST00000535384MALT1chr18

56367823

+NOL4chr18

31432999

-
Frame-shitENST00000348428ENST00000535475MALT1chr18

56367823

+NOL4chr18

31432999

-
Frame-shitENST00000348428ENST00000589544MALT1chr18

56367823

+NOL4chr18

31432999

-
In-frameENST00000348428ENST00000538587MALT1chr18

56367823

+NOL4chr18

31432999

-
5CDS-intronENST00000348428ENST00000590846MALT1chr18

56367823

+NOL4chr18

31432999

-
Frame-shitENST00000345724ENST00000261592MALT1chr18

56367823

+NOL4chr18

31432999

-
Frame-shitENST00000345724ENST00000269185MALT1chr18

56367823

+NOL4chr18

31432999

-
Frame-shitENST00000345724ENST00000535384MALT1chr18

56367823

+NOL4chr18

31432999

-
Frame-shitENST00000345724ENST00000535475MALT1chr18

56367823

+NOL4chr18

31432999

-
Frame-shitENST00000345724ENST00000589544MALT1chr18

56367823

+NOL4chr18

31432999

-
In-frameENST00000345724ENST00000538587MALT1chr18

56367823

+NOL4chr18

31432999

-
5CDS-intronENST00000345724ENST00000590846MALT1chr18

56367823

+NOL4chr18

31432999

-

Top

FusionProtFeatures for MALT1_NOL4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
MALT1

Q9UDY8

NOL4

O94818

Enhances BCL10-induced activation of NF-kappa-B.Involved in nuclear export of BCL10. Binds to TRAF6, inducingTRAF6 oligomerization and activation of its ligase activity. Hasubiquitin ligase activity. MALT1-dependent BCL10 cleavage plays animportant role in T-cell antigen receptor-induced integrinadhesion. Involved in the induction of T helper 17 cells (Th17)differentiation. Cleaves RC3H1 and ZC3H12A in response to T-cellreceptor (TCR) stimulation which releases their cooperativelyrepressed targets to promote Th17 cell differentiation (Bysimilarity). {ECO:0000250|UniProtKB:Q2TBA3,ECO:0000269|PubMed:11262391, ECO:0000269|PubMed:14695475,ECO:0000269|PubMed:18264101}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for MALT1_NOL4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_MALT1_ENST00000348428_chr18_56367823_+_NOL4_ENST00000538587_chr18_31432999_-_281aa
MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLSCLDLEQCSLKVLEPEGSPSL
CLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQTQWFKMNKEIPNGNTSELIFNAV
HVKDAGFTVCRVNNNFTFEFSQWSQLDVCDIPESFQRPTDLSMKRQLATSSGSSSSSNSRPQLSPTEINAVRQLVAGTRESAAFLLRSAD

>In-frame_MALT1_ENST00000345724_chr18_56367823_+_NOL4_ENST00000538587_chr18_31432999_-_281aa
MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLSCLDLEQCSLKVLEPEGSPSL
CLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQTQWFKMNKEIPNGNTSELIFNAV
HVKDAGFTVCRVNNNFTFEFSQWSQLDVCDIPESFQRPTDLSMKRQLATSSGSSSSSNSRPQLSPTEINAVRQLVAGTRESAAFLLRSAD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_MALT1_ENST00000348428_chr18_56367823_+_NOL4_ENST00000538587_chr18_31432999_-_843nt
ATGTCGCTGTTGGGGGACCCGCTACAGGCCCTGCCGCCCTCGGCCGCCCCCACGGGGCCGCTGCTCGCCCCTCCGGCCGGCGCGACCCTC
AACCGCCTGCGGGAGCCGCTGCTGCGGAGGCTCAGCGAGCTCCTGGATCAGGCGCCCGAGGGCCGGGGCTGGAGGAGACTGGCGGAGCTG
GCGGGGAGTCGCGGGCGCCTCCGCCTCAGTTGCCTAGACCTGGAGCAGTGTTCTCTTAAGGTACTGGAGCCTGAAGGAAGCCCCAGCCTG
TGTCTGCTGAAGTTAATGGGTGAAAAAGGTTGCACAGTCACAGAATTGAGTGATTTCCTGCAGGCTATGGAACACACTGAAGTTCTTCAG
CTTCTCAGCCCCCCAGGAATAAAGATTACTGTAAACCCAGAGTCAAAGGCAGTCTTGGCTGGACAGTTTGTGAAACTGTGTTGCCGGGCA
ACTGGACATCCTTTTGTTCAATATCAGTGGTTCAAAATGAATAAAGAGATTCCAAATGGAAATACATCAGAGCTTATTTTTAATGCAGTG
CATGTAAAAGATGCAGGCTTTTATGTCTGTCGAGTTAATAACAATTTCACCTTTGAATTCAGCCAGTGGTCACAGCTGGATGTTTGCGAC
ATCCCAGAGAGCTTCCAGAGACCCACTGATCTCAGCATGAAGAGACAATTGGCGACTAGCTCAGGATCCTCCAGCAGCTCAAACTCCAGA
CCCCAGCTGAGTCCAACTGAAATCAATGCCGTGAGACAGCTTGTTGCAGGATATCGAGAATCAGCTGCATTTTTATTGCGATCTGCAGAT

>In-frame_MALT1_ENST00000345724_chr18_56367823_+_NOL4_ENST00000538587_chr18_31432999_-_843nt
ATGTCGCTGTTGGGGGACCCGCTACAGGCCCTGCCGCCCTCGGCCGCCCCCACGGGGCCGCTGCTCGCCCCTCCGGCCGGCGCGACCCTC
AACCGCCTGCGGGAGCCGCTGCTGCGGAGGCTCAGCGAGCTCCTGGATCAGGCGCCCGAGGGCCGGGGCTGGAGGAGACTGGCGGAGCTG
GCGGGGAGTCGCGGGCGCCTCCGCCTCAGTTGCCTAGACCTGGAGCAGTGTTCTCTTAAGGTACTGGAGCCTGAAGGAAGCCCCAGCCTG
TGTCTGCTGAAGTTAATGGGTGAAAAAGGTTGCACAGTCACAGAATTGAGTGATTTCCTGCAGGCTATGGAACACACTGAAGTTCTTCAG
CTTCTCAGCCCCCCAGGAATAAAGATTACTGTAAACCCAGAGTCAAAGGCAGTCTTGGCTGGACAGTTTGTGAAACTGTGTTGCCGGGCA
ACTGGACATCCTTTTGTTCAATATCAGTGGTTCAAAATGAATAAAGAGATTCCAAATGGAAATACATCAGAGCTTATTTTTAATGCAGTG
CATGTAAAAGATGCAGGCTTTTATGTCTGTCGAGTTAATAACAATTTCACCTTTGAATTCAGCCAGTGGTCACAGCTGGATGTTTGCGAC
ATCCCAGAGAGCTTCCAGAGACCCACTGATCTCAGCATGAAGAGACAATTGGCGACTAGCTCAGGATCCTCCAGCAGCTCAAACTCCAGA
CCCCAGCTGAGTCCAACTGAAATCAATGCCGTGAGACAGCTTGTTGCAGGATATCGAGAATCAGCTGCATTTTTATTGCGATCTGCAGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_MALT1_ENST00000348428_chr18_56367823_+_NOL4_ENST00000538587_chr18_31432999_-_1354nt
CGAGGCTCCGTGCCCCGCCCCCCGGGTGCCCCGCCCCTTTGCGCGGCTGGCGCGGCCAGCAGGCCAGGCTCCCCTCGGCAAACCTGTCTA
ATTGGGGCGGGGAGCGGAGCTTCCTCCTCTGAGGGCCGTGCCGCGCTGCCAGATTTGTTCTTCCGCCCCTGCCTCCGCGGCTCGGAGGCG
AGCGGAAGGTGCCCCGGGGCCGAGGCCCGTGACGGGGCGGGCGGGAGCCCCGGCAGTCCGGGGTCGCCGGCGAGGGCCATGTCGCTGTTG
GGGGACCCGCTACAGGCCCTGCCGCCCTCGGCCGCCCCCACGGGGCCGCTGCTCGCCCCTCCGGCCGGCGCGACCCTCAACCGCCTGCGG
GAGCCGCTGCTGCGGAGGCTCAGCGAGCTCCTGGATCAGGCGCCCGAGGGCCGGGGCTGGAGGAGACTGGCGGAGCTGGCGGGGAGTCGC
GGGCGCCTCCGCCTCAGTTGCCTAGACCTGGAGCAGTGTTCTCTTAAGGTACTGGAGCCTGAAGGAAGCCCCAGCCTGTGTCTGCTGAAG
TTAATGGGTGAAAAAGGTTGCACAGTCACAGAATTGAGTGATTTCCTGCAGGCTATGGAACACACTGAAGTTCTTCAGCTTCTCAGCCCC
CCAGGAATAAAGATTACTGTAAACCCAGAGTCAAAGGCAGTCTTGGCTGGACAGTTTGTGAAACTGTGTTGCCGGGCAACTGGACATCCT
TTTGTTCAATATCAGTGGTTCAAAATGAATAAAGAGATTCCAAATGGAAATACATCAGAGCTTATTTTTAATGCAGTGCATGTAAAAGAT
GCAGGCTTTTATGTCTGTCGAGTTAATAACAATTTCACCTTTGAATTCAGCCAGTGGTCACAGCTGGATGTTTGCGACATCCCAGAGAGC
TTCCAGAGACCCACTGATCTCAGCATGAAGAGACAATTGGCGACTAGCTCAGGATCCTCCAGCAGCTCAAACTCCAGACCCCAGCTGAGT
CCAACTGAAATCAATGCCGTGAGACAGCTTGTTGCAGGATATCGAGAATCAGCTGCATTTTTATTGCGATCTGCAGATGAACTGGAAAAT
CTCATTTTACAACAGAACTGAGACAGACGACCACCATATTCACTGAGGTCTAAATTTGCAGTTTCCACTAATGACATTTTGATTTCCCAA
CAGAGATACTTCTGGTCTTACTGCACAGTCTTTTAAGAGAAATACTTCCATTATGCCACATTGTCCTTGATCCGTAAGTGATGTGTTAAG
GTGCTTCAAAGGAACTCTGACCTCTGAAGTACTTGAGCTACTTTAGTATGTCCAGCCTATTGCTTTTTGTTTTAGTGTGTCACCATAAAT

>In-frame_MALT1_ENST00000345724_chr18_56367823_+_NOL4_ENST00000538587_chr18_31432999_-_1208nt
GTTCTTCCGCCCCTGCCTCCGCGGCTCGGAGGCGAGCGGAAGGTGCCCCGGGGCCGAGGCCCGTGACGGGGCGGGCGGGAGCCCCGGCAG
TCCGGGGTCGCCGGCGAGGGCCATGTCGCTGTTGGGGGACCCGCTACAGGCCCTGCCGCCCTCGGCCGCCCCCACGGGGCCGCTGCTCGC
CCCTCCGGCCGGCGCGACCCTCAACCGCCTGCGGGAGCCGCTGCTGCGGAGGCTCAGCGAGCTCCTGGATCAGGCGCCCGAGGGCCGGGG
CTGGAGGAGACTGGCGGAGCTGGCGGGGAGTCGCGGGCGCCTCCGCCTCAGTTGCCTAGACCTGGAGCAGTGTTCTCTTAAGGTACTGGA
GCCTGAAGGAAGCCCCAGCCTGTGTCTGCTGAAGTTAATGGGTGAAAAAGGTTGCACAGTCACAGAATTGAGTGATTTCCTGCAGGCTAT
GGAACACACTGAAGTTCTTCAGCTTCTCAGCCCCCCAGGAATAAAGATTACTGTAAACCCAGAGTCAAAGGCAGTCTTGGCTGGACAGTT
TGTGAAACTGTGTTGCCGGGCAACTGGACATCCTTTTGTTCAATATCAGTGGTTCAAAATGAATAAAGAGATTCCAAATGGAAATACATC
AGAGCTTATTTTTAATGCAGTGCATGTAAAAGATGCAGGCTTTTATGTCTGTCGAGTTAATAACAATTTCACCTTTGAATTCAGCCAGTG
GTCACAGCTGGATGTTTGCGACATCCCAGAGAGCTTCCAGAGACCCACTGATCTCAGCATGAAGAGACAATTGGCGACTAGCTCAGGATC
CTCCAGCAGCTCAAACTCCAGACCCCAGCTGAGTCCAACTGAAATCAATGCCGTGAGACAGCTTGTTGCAGGATATCGAGAATCAGCTGC
ATTTTTATTGCGATCTGCAGATGAACTGGAAAATCTCATTTTACAACAGAACTGAGACAGACGACCACCATATTCACTGAGGTCTAAATT
TGCAGTTTCCACTAATGACATTTTGATTTCCCAACAGAGATACTTCTGGTCTTACTGCACAGTCTTTTAAGAGAAATACTTCCATTATGC
CACATTGTCCTTGATCCGTAAGTGATGTGTTAAGGTGCTTCAAAGGAACTCTGACCTCTGAAGTACTTGAGCTACTTTAGTATGTCCAGC


Top

FusionGenePPI for MALT1_NOL4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
MALT1BCL10, UBE2G2, TRAF6, TRAF2, NFKBIA, CSNK1A1, IKBKG, COPS5, GPS1, CAMK2G, MALT1, RELB, DIABLO, CARD11, USP2, TAB2, MAP3K7, HECTD3, SQSTM1, PRKCQ, DAB2, USP9X, KDM1A, CARM1, PRMT6, SUV39H1, STUB1, RNF31, TNFAIP3, UBE2V2, UBE2N, XPO1, RBCK1, PRKCD, TRIB1, IKBKB, CARD14NOL4MAGEA11, CTBP2, SNAPC5, MAPK6, CHMP2A, CTBP1, FAM9B, TEX9, SKA3, AKT1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for MALT1_NOL4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for MALT1_NOL4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneMALT1C0079744Diffuse Large B-Cell Lymphoma1CTD_human
HgeneMALT1C3809583IMMUNODEFICIENCY 121ORPHANET;UNIPROT