FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19961

FusionGeneSummary for LONP2_HIRA

check button Fusion gene summary
Fusion gene informationFusion gene name: LONP2_HIRA
Fusion gene ID: 19961
HgeneTgene
Gene symbol

LONP2

HIRA

Gene ID

83752

7290

Gene namelon peptidase 2, peroxisomalhistone cell cycle regulator
SynonymsLONP|LONPL|PLON|PSLONDGCR1|TUP1|TUPLE1
Cytomap

16q12.1

22q11.21

Type of geneprotein-codingprotein-coding
Descriptionlon protease homolog 2, peroxisomallon protease 2lon protease-like protein 2peroxisomal LON protease likeperoxisomal Lon protease homolog 2protein HIRADiGeorge critical region gene 1HIR histone cell cycle regulation defective homolog ATUP1-like enhancer of split protein 1
Modification date2018052320180523
UniProtAcc

Q86WA8

P54198

Ensembl transtripts involved in fusion geneENST00000285737, ENST00000535754, 
ENST00000564259, 
ENST00000340170, 
ENST00000263208, ENST00000541063, 
ENST00000546308, ENST00000464189, 
Fusion gene scores* DoF score5 X 3 X 4=609 X 8 X 4=288
# samples 49
** MAII scorelog2(4/60*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/288*10)=-1.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: LONP2 [Title/Abstract] AND HIRA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneHIRA

GO:0006336

DNA replication-independent nucleosome assembly

14718166


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-44-4112-01ALONP2chr16

48337216

+HIRAchr22

19398301

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000285737ENST00000340170LONP2chr16

48337216

+HIRAchr22

19398301

-
In-frameENST00000285737ENST00000263208LONP2chr16

48337216

+HIRAchr22

19398301

-
5CDS-5UTRENST00000285737ENST00000541063LONP2chr16

48337216

+HIRAchr22

19398301

-
5CDS-5UTRENST00000285737ENST00000546308LONP2chr16

48337216

+HIRAchr22

19398301

-
5CDS-5UTRENST00000285737ENST00000464189LONP2chr16

48337216

+HIRAchr22

19398301

-
In-frameENST00000535754ENST00000340170LONP2chr16

48337216

+HIRAchr22

19398301

-
In-frameENST00000535754ENST00000263208LONP2chr16

48337216

+HIRAchr22

19398301

-
5CDS-5UTRENST00000535754ENST00000541063LONP2chr16

48337216

+HIRAchr22

19398301

-
5CDS-5UTRENST00000535754ENST00000546308LONP2chr16

48337216

+HIRAchr22

19398301

-
5CDS-5UTRENST00000535754ENST00000464189LONP2chr16

48337216

+HIRAchr22

19398301

-
intron-3CDSENST00000564259ENST00000340170LONP2chr16

48337216

+HIRAchr22

19398301

-
intron-3CDSENST00000564259ENST00000263208LONP2chr16

48337216

+HIRAchr22

19398301

-
intron-5UTRENST00000564259ENST00000541063LONP2chr16

48337216

+HIRAchr22

19398301

-
intron-5UTRENST00000564259ENST00000546308LONP2chr16

48337216

+HIRAchr22

19398301

-
intron-5UTRENST00000564259ENST00000464189LONP2chr16

48337216

+HIRAchr22

19398301

-

Top

FusionProtFeatures for LONP2_HIRA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LONP2

Q86WA8

HIRA

P54198

ATP-dependent serine protease that mediates theselective degradation of misfolded and unassembled polypeptides inthe peroxisomal matrix. Necessary for type 2 peroxisome targetingsignal (PTS2)-containing protein processing and facilitatesperoxisome matrix protein import (By similarity). May indirectlyregulate peroxisomal fatty acid beta-oxidation through degradationof the self-processed forms of TYSND1. {ECO:0000255|HAMAP-Rule:MF_03121, ECO:0000269|PubMed:22002062}. Cooperates with ASF1A to promote replication-independentchromatin assembly. Required for the periodic repression ofhistone gene transcription during the cell cycle. Required for theformation of senescence-associated heterochromatin foci (SAHF) andefficient senescence-associated cell cycle exit.{ECO:0000269|PubMed:12370293, ECO:0000269|PubMed:14718166,ECO:0000269|PubMed:15621527}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLONP2chr16:48337216chr22:19398301ENST00000285737+111513_220598853DomainLon N-terminal
HgeneLONP2chr16:48337216chr22:19398301ENST00000285737+1115375_382598853Nucleotide bindingATP
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025408_412121018Compositional biasNote=Poly-Gln
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025640_643121018Compositional biasNote=Poly-Lys
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025805_808121018Compositional biasNote=Poly-Val
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021408_41212811Compositional biasNote=Poly-Gln
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021640_64312811Compositional biasNote=Poly-Lys
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021805_80812811Compositional biasNote=Poly-Val
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025439_475121018RegionNote=Required for repression of histone gene transcription
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021439_47512811RegionNote=Required for repression of histone gene transcription
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-02511_53121018RepeatNote=WD 1
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025129_168121018RepeatNote=WD 3
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025172_211121018RepeatNote=WD 4
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025220_263121018RepeatNote=WD 5
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025266_322121018RepeatNote=WD 6
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025326_367121018RepeatNote=WD 7
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-02568_107121018RepeatNote=WD 2
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-02111_5312811RepeatNote=WD 1
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021129_16812811RepeatNote=WD 3
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021172_21112811RepeatNote=WD 4
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021220_26312811RepeatNote=WD 5
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021266_32212811RepeatNote=WD 6
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021326_36712811RepeatNote=WD 7
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-02168_10712811RepeatNote=WD 2

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLONP2chr16:48337216chr22:19398301ENST00000285737+1115651_837598853DomainLon proteolytic


Top

FusionGeneSequence for LONP2_HIRA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LONP2_ENST00000285737_chr16_48337216_+_HIRA_ENST00000340170_chr22_19398301_-_1397aa
MSSVSPIQIPSRLPLLLTHEGVLLPGSTMRTSVDSARNLQLVRSRLLKGTSLQSTILGVIPNTPDPASDAQDLPPLHRIGTAALAVQVVG
SNWPKPHYTLLITGLCRFQIVQVLKEKPTPIAEVEQLDRLEEFPNTCKMREELGELSEQFYKTAVQLVEMLDMSVPAVAKLRRLLDSLPR
EALPDILTSIIRTSNKEKLQILDAVSLEERFKMTIPLLVRQIEGLKLLQKTRKPKQDDDKRVIAIRPIRRITHISGTLEDEDEDEDNDDI
VMLEKKIRTSSMPEQAHKVCVKEIKRLKKMPQSMPETALTRNTLELMVELPWNKSTTDRLDIRAARILLDNDHYAMEKLKKRVLEYLAVR
QLKNNLKGPILCFVGPPGVGKTSVGRSVAKTLGREFHRIALGGVCDQSDIRGHRRTTVGSMPGRIINGLKTVGVNNPVFLLDEVDKLGKS
LQGDPAAALLEVLDPEQNHNFTDHTLNVAFDLSQVLFIATANTTATIPAALLDRMEIIQVPGTTQEEKIEIAHRHLIPKQLEQHGLTPQQ
IQIPQVTTLDIITRTTREAGVRSLDRKLGAICRAVAVKVAEGQHKEAKLDRSDVTEREGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWN
MSPVLQEDDEKDENIPKMLCQMDNHLACVNCVRWSNSGMTLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILRNHSGDV
MDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGLTWDPVGKYIASQADDRSLKVWRTLDWQLETSITKPFDECGGTTH
VLRLSWSPDGHYLVSAHAMNNSGPTAQIIEREGWKTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSAKPSCPYCCCAVGSKDRSLSVWLT
CLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFSQDELGDPLSEEEKSRIHQSTTGKSLAIMTEAQLSTAVIENPEMLKY
QRRQQQQQLDQKSAATREMGSATSVAGVVNGESLEDIRKNLLKKQVETRTADGRRRITPLCIAQLDTGDFSTAFFNSIPLSGSLAGTMLS
SHSSPQLLPLDSSTPNSFGASKPCTEPVVAASARPAGDSVNKDSMNATSTPAALSPSVLTTPSKIEPMKAFDSRFTERSKATPGAPALTS
MTPTAVERDVHRQVVVVKEESLHSILAGSDMTVSQILLTQHGIPVMNLSDGKAYCFNPSLSTWNLVSDKQDSLAQCADFRSSLPSQDAML
CSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTG

>In-frame_LONP2_ENST00000285737_chr16_48337216_+_HIRA_ENST00000263208_chr22_19398301_-_1604aa
MSSVSPIQIPSRLPLLLTHEGVLLPGSTMRTSVDSARNLQLVRSRLLKGTSLQSTILGVIPNTPDPASDAQDLPPLHRIGTAALAVQVVG
SNWPKPHYTLLITGLCRFQIVQVLKEKPTPIAEVEQLDRLEEFPNTCKMREELGELSEQFYKTAVQLVEMLDMSVPAVAKLRRLLDSLPR
EALPDILTSIIRTSNKEKLQILDAVSLEERFKMTIPLLVRQIEGLKLLQKTRKPKQDDDKRVIAIRPIRRITHISGTLEDEDEDEDNDDI
VMLEKKIRTSSMPEQAHKVCVKEIKRLKKMPQSMPETALTRNTLELMVELPWNKSTTDRLDIRAARILLDNDHYAMEKLKKRVLEYLAVR
QLKNNLKGPILCFVGPPGVGKTSVGRSVAKTLGREFHRIALGGVCDQSDIRGHRRTTVGSMPGRIINGLKTVGVNNPVFLLDEVDKLGKS
LQGDPAAALLEVLDPEQNHNFTDHTLNVAFDLSQVLFIATANTTATIPAALLDRMEIIQVPGTTQEEKIEIAHRHLIPKQLEQHGLTPQQ
IQIPQVTTLDIITRTTREAGVRSLDRKLGAICRAVAVKVAEGQHKEAKLDRSDVTEREGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWN
MSPVLQEDDEKDENIPKMLCQMDNHLACVNCVRWSNSGMTLASGGDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILRNHSGDV
MDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVKGLTWDPVGKYIASQADDRSLKVWRTLDWQLETSITKPFDECGGTTH
VLRLSWSPDGHYLVSAHAMNNSGPTAQIIEREGWKTNMDFVGHRKAVTVVKFNPKIFKKKQKNGSSAKPSCPYCCCAVGSKDRSLSVWLT
CLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFSQDELGDPLSEEEKSRIHQSTTGKSLAIMTEAQLSTAVIENPEMLKY
QRRQQQQQLDQKSAATREMGSATSVAGVVNGESLEDIRKNLLKKQVETRTADGRRRITPLCIAQLDTGDFSTAFFNSIPLSGSLAGTMLS
SHSSPQLLPLDSSTPNSFGASKPCTEPVVAASARPAGDSVNKDSMNATSTPAALSPSVLTTPSKIEPMKAFDSRFTERSKATPGAPALTS
MTPTAVERLKEQNLVKELRPRDLLESSSDSDEKVPLAKASSLSKRKLELEVETVEKKKKGRPRKDSRLMPVSLSVQSPAALTAEKEAMCL
SAPALALKLPIPSPQRAFTLQVSSDPSMYIEVENEVTVVGGVKLSRLKCNREGKEWETVLTSRILTAAGSCDVVCVACEKRMLSVFSTCG
RRLLSPILLPSPISTLHCTGSYVMALTAAATLSVWDVHRQVVVVKEESLHSILAGSDMTVSQILLTQHGIPVMNLSDGKAYCFNPSLSTW
NLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYAR

>In-frame_LONP2_ENST00000535754_chr16_48337216_+_HIRA_ENST00000340170_chr22_19398301_-_1353aa
MSSVSPIQIPSRLPLLLTHEGVLLPGSTMRTSVDSARNLQLVRSRLLKGTSLQSTILGVIPNTPDPASDAQDLPPLHRIGTAALAVQVVG
SNWPKPHYTLLITGLCRFQIVQVLKEKPTPIAEVEQLDRLEEFPNTCKMREELGELSEQFYKTAVQILDAVSLEERFKMTIPLLVRQIEG
LKLLQKTRKPKQDDDKRVIAIRPIRRITHISGTLEDEDEDEDNDDIVMLEKKIRTSSMPEQAHKVCVKEIKRLKKMPQSMPETALTRNTL
ELMVELPWNKSTTDRLDIRAARILLDNDHYAMEKLKKRVLEYLAVRQLKNNLKGPILCFVGPPGVGKTSVGRSVAKTLGREFHRIALGGV
CDQSDIRGHRRTTVGSMPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHNFTDHTLNVAFDLSQVLFIATANTT
ATIPAALLDRMEIIQVPGTTQEEKIEIAHRHLIPKQLEQHGLTPQQIQIPQVTTLDIITRTTREAGVRSLDRKLGAICRAVAVKVAEGQH
KEAKLDRSDVTEREGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEKDENIPKMLCQMDNHLACVNCVRWSNSGMTLASG
GDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILRNHSGDVMDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVK
GLTWDPVGKYIASQADDRSLKVWRTLDWQLETSITKPFDECGGTTHVLRLSWSPDGHYLVSAHAMNNSGPTAQIIEREGWKTNMDFVGHR
KAVTVVKFNPKIFKKKQKNGSSAKPSCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFS
QDELGDPLSEEEKSRIHQSTTGKSLAIMTEAQLSTAVIENPEMLKYQRRQQQQQLDQKSAATREMGSATSVAGVVNGESLEDIRKNLLKK
QVETRTADGRRRITPLCIAQLDTGDFSTAFFNSIPLSGSLAGTMLSSHSSPQLLPLDSSTPNSFGASKPCTEPVVAASARPAGDSVNKDS
MNATSTPAALSPSVLTTPSKIEPMKAFDSRFTERSKATPGAPALTSMTPTAVERDVHRQVVVVKEESLHSILAGSDMTVSQILLTQHGIP
VMNLSDGKAYCFNPSLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGRQAARLFSVPHVVQQETTLAYLENQVAA
ALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTGSQWESTVVGLRKRELLKELLPVIGQNLRFQRLFTECQEQLDILR

>In-frame_LONP2_ENST00000535754_chr16_48337216_+_HIRA_ENST00000263208_chr22_19398301_-_1560aa
MSSVSPIQIPSRLPLLLTHEGVLLPGSTMRTSVDSARNLQLVRSRLLKGTSLQSTILGVIPNTPDPASDAQDLPPLHRIGTAALAVQVVG
SNWPKPHYTLLITGLCRFQIVQVLKEKPTPIAEVEQLDRLEEFPNTCKMREELGELSEQFYKTAVQILDAVSLEERFKMTIPLLVRQIEG
LKLLQKTRKPKQDDDKRVIAIRPIRRITHISGTLEDEDEDEDNDDIVMLEKKIRTSSMPEQAHKVCVKEIKRLKKMPQSMPETALTRNTL
ELMVELPWNKSTTDRLDIRAARILLDNDHYAMEKLKKRVLEYLAVRQLKNNLKGPILCFVGPPGVGKTSVGRSVAKTLGREFHRIALGGV
CDQSDIRGHRRTTVGSMPGRIINGLKTVGVNNPVFLLDEVDKLGKSLQGDPAAALLEVLDPEQNHNFTDHTLNVAFDLSQVLFIATANTT
ATIPAALLDRMEIIQVPGTTQEEKIEIAHRHLIPKQLEQHGLTPQQIQIPQVTTLDIITRTTREAGVRSLDRKLGAICRAVAVKVAEGQH
KEAKLDRSDVTEREGKPIFSVDIHPDGTKFATGGQGQDSGKVVIWNMSPVLQEDDEKDENIPKMLCQMDNHLACVNCVRWSNSGMTLASG
GDDKLIMVWKRATYIGPSTVFGSSGKLANVEQWRCVSILRNHSGDVMDVAWSPHDAWLASCSVDNTVVIWNAVKFPEILATLRGHSGLVK
GLTWDPVGKYIASQADDRSLKVWRTLDWQLETSITKPFDECGGTTHVLRLSWSPDGHYLVSAHAMNNSGPTAQIIEREGWKTNMDFVGHR
KAVTVVKFNPKIFKKKQKNGSSAKPSCPYCCCAVGSKDRSLSVWLTCLKRPLVVIHELFDKSIMDISWTLNGLGILVCSMDGSVAFLDFS
QDELGDPLSEEEKSRIHQSTTGKSLAIMTEAQLSTAVIENPEMLKYQRRQQQQQLDQKSAATREMGSATSVAGVVNGESLEDIRKNLLKK
QVETRTADGRRRITPLCIAQLDTGDFSTAFFNSIPLSGSLAGTMLSSHSSPQLLPLDSSTPNSFGASKPCTEPVVAASARPAGDSVNKDS
MNATSTPAALSPSVLTTPSKIEPMKAFDSRFTERSKATPGAPALTSMTPTAVERLKEQNLVKELRPRDLLESSSDSDEKVPLAKASSLSK
RKLELEVETVEKKKKGRPRKDSRLMPVSLSVQSPAALTAEKEAMCLSAPALALKLPIPSPQRAFTLQVSSDPSMYIEVENEVTVVGGVKL
SRLKCNREGKEWETVLTSRILTAAGSCDVVCVACEKRMLSVFSTCGRRLLSPILLPSPISTLHCTGSYVMALTAAATLSVWDVHRQVVVV
KEESLHSILAGSDMTVSQILLTQHGIPVMNLSDGKAYCFNPSLSTWNLVSDKQDSLAQCADFRSSLPSQDAMLCSGPLAIIQGRTSNSGR
QAARLFSVPHVVQQETTLAYLENQVAAALTLQSSHEYRHWLLVYARYLVNEGFEYRLREICKDLLGPVHYSTGSQWESTVVGLRKRELLK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LONP2_ENST00000285737_chr16_48337216_+_HIRA_ENST00000340170_chr22_19398301_-_4191nt
ATGTCATCAGTGAGCCCCATCCAGATCCCCAGTCGCCTCCCGCTGCTGCTCACCCACGAGGGCGTCCTGCTGCCCGGCTCCACCATGCGC
ACCAGCGTGGACTCGGCCCGCAACCTGCAGCTGGTGCGGAGCCGCCTTCTGAAGGGCACGTCGCTGCAAAGCACCATCCTGGGCGTCATC
CCCAACACGCCTGACCCCGCCAGCGACGCGCAGGACCTGCCGCCGCTGCACAGGATTGGCACAGCTGCACTGGCCGTTCAGGTTGTGGGC
AGTAACTGGCCCAAGCCCCACTACACTCTGTTGATTACAGGCCTATGCCGTTTCCAGATTGTACAGGTCTTAAAAGAGAAGCCATATCCC
ATTGCTGAAGTGGAGCAGTTGGACCGACTTGAGGAGTTTCCCAACACCTGTAAAATGAGGGAGGAGCTAGGAGAACTATCAGAGCAGTTT
TACAAATATGCAGTACAATTGGTTGAAATGTTGGATATGTCTGTCCCTGCAGTTGCTAAATTGAGACGTCTTTTAGATAGTCTTCCAAGG
GAAGCTTTACCAGACATCTTGACATCAATTATCCGAACAAGCAACAAAGAGAAACTCCAGATTTTAGATGCTGTGAGCCTAGAGGAGCGG
TTCAAGATGACTATACCACTGCTTGTCAGACAAATTGAAGGCCTGAAATTGCTTCAAAAAACCAGAAAACCCAAGCAAGATGATGATAAG
AGGGTTATAGCAATACGCCCTATTAGGAGAATTACACATATCTCAGGTACTTTAGAAGATGAAGATGAAGATGAAGATAATGATGACATT
GTCATGCTAGAGAAAAAAATACGAACATCTAGTATGCCAGAGCAGGCCCATAAAGTCTGTGTCAAAGAGATAAAGAGACTCAAAAAAATG
CCTCAGTCAATGCCAGAATATGCTCTGACTAGAAATTATTTGGAACTTATGGTAGAACTTCCTTGGAACAAAAGTACAACTGACCGCCTG
GACATTAGGGCAGCCCGGATTCTTCTGGATAATGACCATTACGCCATGGAAAAATTGAAGAAAAGAGTACTGGAATACTTGGCTGTCAGA
CAGCTCAAAAATAACCTGAAGGGCCCAATCCTATGCTTTGTTGGCCCTCCTGGAGTTGGTAAAACAAGTGTGGGAAGATCAGTGGCCAAG
ACTCTAGGTCGAGAGTTCCACAGGATTGCACTTGGAGGAGTATGTGATCAGTCTGACATTCGAGGACACAGGCGCACCTATGTTGGCAGC
ATGCCTGGTCGCATCATCAACGGCTTGAAGACTGTGGGAGTGAACAACCCAGTGTTCCTATTAGATGAGGTTGACAAACTGGGAAAAAGT
CTACAGGGTGATCCAGCAGCAGCTCTGCTTGAGGTGTTGGATCCTGAACAAAACCATAACTTCACAGATCATTATCTAAATGTGGCCTTT
GACCTTTCTCAAGTTCTTTTTATAGCTACTGCCAACACCACTGCTACCATTCCAGCTGCCTTGTTGGACAGAATGGAGATCATTCAGGTT
CCAGGTTATACACAGGAGGAGAAGATAGAGATTGCCCATAGGCACTTGATCCCCAAGCAGCTGGAACAACATGGGCTGACTCCACAGCAG
ATTCAGATACCCCAGGTCACCACTCTTGACATCATCACCAGGTATACCAGAGAGGCAGGGGTTCGTTCTCTGGATAGAAAACTTGGGGCC
ATTTGCCGAGCTGTGGCCGTGAAGGTGGCAGAAGGACAGCATAAGGAAGCCAAGTTGGACCGTTCTGATGTGACTGAGAGAGAAGGCAAG
CCGATTTTTTCAGTTGATATTCACCCTGACGGGACCAAGTTCGCAACTGGAGGACAAGGGCAGGATTCTGGGAAGGTTGTGATCTGGAAT
ATGTCTCCAGTCCTCCAGGAGGATGACGAGAAGGATGAAAATATTCCCAAGATGCTTTGCCAGATGGACAATCACTTAGCATGTGTGAAC
TGTGTGCGGTGGTCAAACAGTGGGATGTATTTAGCTTCTGGGGGAGATGACAAACTGATTATGGTGTGGAAGCGGGCTACGTACATCGGC
CCCAGCACCGTGTTCGGCTCCAGTGGTAAGCTTGCCAATGTGGAGCAGTGGCGGTGTGTCTCTATCCTCCGGAATCATTCAGGCGATGTG
ATGGATGTAGCATGGTCTCCCCACGATGCCTGGCTAGCCTCATGCAGCGTGGATAACACTGTCGTCATCTGGAATGCTGTAAAGTTCCCA
GAAATTCTAGCTACTCTGAGAGGTCATTCTGGCTTGGTCAAAGGGTTGACATGGGACCCTGTTGGTAAATACATAGCTTCTCAAGCTGAT
GACCGCAGCCTAAAGGTGTGGAGGACGCTGGACTGGCAGTTGGAGACCAGCATCACCAAGCCTTTTGATGAGTGTGGAGGAACGACCCAT
GTGTTGCGGCTCAGCTGGTCACCTGATGGGCATTACCTGGTGTCTGCCCATGCCATGAACAACTCAGGCCCCACTGCCCAGATCATCGAA
CGGGAGGGATGGAAGACCAACATGGACTTTGTTGGGCACCGGAAAGCTGTGACTGTCGTGAAATTCAACCCAAAAATCTTCAAAAAGAAG
CAGAAGAATGGGAGTTCTGCGAAGCCTAGCTGCCCGTACTGCTGCTGTGCTGTTGGCAGCAAGGACCGCTCGCTTTCTGTCTGGCTCACA
TGTCTGAAACGGCCGCTGGTGGTCATCCATGAACTGTTTGACAAATCCATCATGGATATTTCCTGGACTCTGAATGGGCTGGGCATCTTG
GTATGCTCTATGGACGGCTCTGTGGCATTCCTCGACTTCTCCCAGGATGAGCTTGGCGATCCCCTGAGCGAGGAGGAGAAGAGCCGCATT
CACCAGTCCACCTATGGCAAGAGCCTAGCCATCATGACCGAGGCCCAGCTCTCCACAGCCGTCATTGAGAACCCTGAGATGCTCAAGTAC
CAGCGAAGGCAGCAGCAGCAGCAGCTGGACCAGAAGAGTGCTGCGACCAGGGAGATGGGCTCAGCCACCTCAGTCGCAGGCGTTGTCAAC
GGGGAGAGTCTTGAAGATATCAGGAAGAATCTTTTGAAGAAACAAGTTGAGACTCGGACAGCAGATGGCCGGAGAAGAATCACGCCTCTC
TGCATAGCACAGCTGGACACTGGGGACTTCTCCACGGCATTCTTTAACAGCATCCCCCTCTCGGGCTCCCTGGCGGGCACCATGCTCTCT
TCTCATAGCAGTCCACAGCTACTGCCACTGGACTCCAGTACCCCTAACTCCTTCGGCGCCTCGAAGCCTTGCACAGAGCCTGTGGTGGCT
GCCAGTGCCAGACCTGCAGGCGATTCTGTCAATAAAGACAGTATGAATGCTACCTCTACTCCTGCTGCATTGTCACCTTCTGTGTTAACG
ACCCCGTCCAAGATCGAACCCATGAAAGCGTTTGACTCCCGGTTCACAGAGCGGTCCAAAGCCACACCAGGTGCTCCTGCCCTGACCAGC
ATGACTCCGACAGCTGTGGAAAGGGATGTTCACAGACAGGTGGTTGTGGTGAAAGAAGAGTCTCTACACTCCATCCTGGCAGGAAGTGAT
ATGACGGTATCACAGATCTTGCTGACGCAGCATGGAATCCCAGTAATGAACCTGTCCGATGGGAAGGCGTACTGCTTTAATCCGTCACTT
TCCACATGGAACCTGGTTTCTGACAAGCAGGACTCACTGGCTCAGTGTGCAGACTTTAGGAGCAGCCTGCCATCCCAGGACGCCATGCTG
TGCTCAGGACCGTTAGCCATAATCCAGGGCCGCACCTCCAACTCGGGAAGGCAGGCTGCCCGGCTCTTCTCCGTGCCTCATGTGGTGCAG
CAAGAGACCACCCTGGCCTACCTAGAGAACCAGGTGGCAGCAGCACTCACCCTGCAGTCCAGCCACGAGTACCGCCATTGGCTCCTCGTC
TACGCACGGTACCTCGTAAACGAAGGGTTTGAATACCGACTTCGAGAAATATGCAAGGACTTACTGGGTCCGGTTCACTACTCCACTGGA
AGCCAGTGGGAGTCAACAGTAGTGGGTCTGCGGAAGAGGGAGCTGCTGAAGGAGCTGCTACCAGTCATCGGGCAGAACCTCCGATTCCAG

>In-frame_LONP2_ENST00000285737_chr16_48337216_+_HIRA_ENST00000263208_chr22_19398301_-_4812nt
ATGTCATCAGTGAGCCCCATCCAGATCCCCAGTCGCCTCCCGCTGCTGCTCACCCACGAGGGCGTCCTGCTGCCCGGCTCCACCATGCGC
ACCAGCGTGGACTCGGCCCGCAACCTGCAGCTGGTGCGGAGCCGCCTTCTGAAGGGCACGTCGCTGCAAAGCACCATCCTGGGCGTCATC
CCCAACACGCCTGACCCCGCCAGCGACGCGCAGGACCTGCCGCCGCTGCACAGGATTGGCACAGCTGCACTGGCCGTTCAGGTTGTGGGC
AGTAACTGGCCCAAGCCCCACTACACTCTGTTGATTACAGGCCTATGCCGTTTCCAGATTGTACAGGTCTTAAAAGAGAAGCCATATCCC
ATTGCTGAAGTGGAGCAGTTGGACCGACTTGAGGAGTTTCCCAACACCTGTAAAATGAGGGAGGAGCTAGGAGAACTATCAGAGCAGTTT
TACAAATATGCAGTACAATTGGTTGAAATGTTGGATATGTCTGTCCCTGCAGTTGCTAAATTGAGACGTCTTTTAGATAGTCTTCCAAGG
GAAGCTTTACCAGACATCTTGACATCAATTATCCGAACAAGCAACAAAGAGAAACTCCAGATTTTAGATGCTGTGAGCCTAGAGGAGCGG
TTCAAGATGACTATACCACTGCTTGTCAGACAAATTGAAGGCCTGAAATTGCTTCAAAAAACCAGAAAACCCAAGCAAGATGATGATAAG
AGGGTTATAGCAATACGCCCTATTAGGAGAATTACACATATCTCAGGTACTTTAGAAGATGAAGATGAAGATGAAGATAATGATGACATT
GTCATGCTAGAGAAAAAAATACGAACATCTAGTATGCCAGAGCAGGCCCATAAAGTCTGTGTCAAAGAGATAAAGAGACTCAAAAAAATG
CCTCAGTCAATGCCAGAATATGCTCTGACTAGAAATTATTTGGAACTTATGGTAGAACTTCCTTGGAACAAAAGTACAACTGACCGCCTG
GACATTAGGGCAGCCCGGATTCTTCTGGATAATGACCATTACGCCATGGAAAAATTGAAGAAAAGAGTACTGGAATACTTGGCTGTCAGA
CAGCTCAAAAATAACCTGAAGGGCCCAATCCTATGCTTTGTTGGCCCTCCTGGAGTTGGTAAAACAAGTGTGGGAAGATCAGTGGCCAAG
ACTCTAGGTCGAGAGTTCCACAGGATTGCACTTGGAGGAGTATGTGATCAGTCTGACATTCGAGGACACAGGCGCACCTATGTTGGCAGC
ATGCCTGGTCGCATCATCAACGGCTTGAAGACTGTGGGAGTGAACAACCCAGTGTTCCTATTAGATGAGGTTGACAAACTGGGAAAAAGT
CTACAGGGTGATCCAGCAGCAGCTCTGCTTGAGGTGTTGGATCCTGAACAAAACCATAACTTCACAGATCATTATCTAAATGTGGCCTTT
GACCTTTCTCAAGTTCTTTTTATAGCTACTGCCAACACCACTGCTACCATTCCAGCTGCCTTGTTGGACAGAATGGAGATCATTCAGGTT
CCAGGTTATACACAGGAGGAGAAGATAGAGATTGCCCATAGGCACTTGATCCCCAAGCAGCTGGAACAACATGGGCTGACTCCACAGCAG
ATTCAGATACCCCAGGTCACCACTCTTGACATCATCACCAGGTATACCAGAGAGGCAGGGGTTCGTTCTCTGGATAGAAAACTTGGGGCC
ATTTGCCGAGCTGTGGCCGTGAAGGTGGCAGAAGGACAGCATAAGGAAGCCAAGTTGGACCGTTCTGATGTGACTGAGAGAGAAGGCAAG
CCGATTTTTTCAGTTGATATTCACCCTGACGGGACCAAGTTCGCAACTGGAGGACAAGGGCAGGATTCTGGGAAGGTTGTGATCTGGAAT
ATGTCTCCAGTCCTCCAGGAGGATGACGAGAAGGATGAAAATATTCCCAAGATGCTTTGCCAGATGGACAATCACTTAGCATGTGTGAAC
TGTGTGCGGTGGTCAAACAGTGGGATGTATTTAGCTTCTGGGGGAGATGACAAACTGATTATGGTGTGGAAGCGGGCTACGTACATCGGC
CCCAGCACCGTGTTCGGCTCCAGTGGTAAGCTTGCCAATGTGGAGCAGTGGCGGTGTGTCTCTATCCTCCGGAATCATTCAGGCGATGTG
ATGGATGTAGCATGGTCTCCCCACGATGCCTGGCTAGCCTCATGCAGCGTGGATAACACTGTCGTCATCTGGAATGCTGTAAAGTTCCCA
GAAATTCTAGCTACTCTGAGAGGTCATTCTGGCTTGGTCAAAGGGTTGACATGGGACCCTGTTGGTAAATACATAGCTTCTCAAGCTGAT
GACCGCAGCCTAAAGGTGTGGAGGACGCTGGACTGGCAGTTGGAGACCAGCATCACCAAGCCTTTTGATGAGTGTGGAGGAACGACCCAT
GTGTTGCGGCTCAGCTGGTCACCTGATGGGCATTACCTGGTGTCTGCCCATGCCATGAACAACTCAGGCCCCACTGCCCAGATCATCGAA
CGGGAGGGATGGAAGACCAACATGGACTTTGTTGGGCACCGGAAAGCTGTGACTGTCGTGAAATTCAACCCAAAAATCTTCAAAAAGAAG
CAGAAGAATGGGAGTTCTGCGAAGCCTAGCTGCCCGTACTGCTGCTGTGCTGTTGGCAGCAAGGACCGCTCGCTTTCTGTCTGGCTCACA
TGTCTGAAACGGCCGCTGGTGGTCATCCATGAACTGTTTGACAAATCCATCATGGATATTTCCTGGACTCTGAATGGGCTGGGCATCTTG
GTATGCTCTATGGACGGCTCTGTGGCATTCCTCGACTTCTCCCAGGATGAGCTTGGCGATCCCCTGAGCGAGGAGGAGAAGAGCCGCATT
CACCAGTCCACCTATGGCAAGAGCCTAGCCATCATGACCGAGGCCCAGCTCTCCACAGCCGTCATTGAGAACCCTGAGATGCTCAAGTAC
CAGCGAAGGCAGCAGCAGCAGCAGCTGGACCAGAAGAGTGCTGCGACCAGGGAGATGGGCTCAGCCACCTCAGTCGCAGGCGTTGTCAAC
GGGGAGAGTCTTGAAGATATCAGGAAGAATCTTTTGAAGAAACAAGTTGAGACTCGGACAGCAGATGGCCGGAGAAGAATCACGCCTCTC
TGCATAGCACAGCTGGACACTGGGGACTTCTCCACGGCATTCTTTAACAGCATCCCCCTCTCGGGCTCCCTGGCGGGCACCATGCTCTCT
TCTCATAGCAGTCCACAGCTACTGCCACTGGACTCCAGTACCCCTAACTCCTTCGGCGCCTCGAAGCCTTGCACAGAGCCTGTGGTGGCT
GCCAGTGCCAGACCTGCAGGCGATTCTGTCAATAAAGACAGTATGAATGCTACCTCTACTCCTGCTGCATTGTCACCTTCTGTGTTAACG
ACCCCGTCCAAGATCGAACCCATGAAAGCGTTTGACTCCCGGTTCACAGAGCGGTCCAAAGCCACACCAGGTGCTCCTGCCCTGACCAGC
ATGACTCCGACAGCTGTGGAAAGGTTAAAAGAGCAGAACCTTGTGAAAGAGCTGAGGCCCCGAGACCTCCTGGAGAGCAGCAGTGACAGC
GATGAGAAAGTCCCTTTGGCTAAGGCTTCCTCACTGTCCAAGCGAAAACTTGAGCTTGAGGTAGAGACAGTAGAGAAGAAGAAGAAAGGG
CGGCCTCGGAAGGACTCTCGTCTCATGCCTGTGTCTCTGTCTGTCCAGTCTCCAGCTGCCCTAACCGCAGAGAAGGAGGCCATGTGTCTG
TCTGCACCAGCACTTGCACTGAAGCTGCCAATTCCAAGCCCCCAGAGAGCATTCACCCTCCAGGTCAGCTCCGATCCTTCCATGTACATT
GAGGTGGAGAATGAAGTGACAGTGGTGGGGGGCGTGAAGCTGAGCCGCCTGAAGTGCAACCGGGAAGGGAAGGAGTGGGAGACGGTACTC
ACCAGCCGGATCCTCACTGCTGCGGGCAGCTGTGACGTGGTGTGTGTCGCCTGTGAAAAAAGGATGCTGTCAGTGTTCTCCACCTGTGGT
CGCCGTCTCCTCTCTCCCATCCTCCTGCCATCCCCGATCTCTACTTTGCATTGCACAGGCTCCTACGTCATGGCGCTCACCGCTGCAGCC
ACACTCTCTGTCTGGGATGTTCACAGACAGGTGGTTGTGGTGAAAGAAGAGTCTCTACACTCCATCCTGGCAGGAAGTGATATGACGGTA
TCACAGATCTTGCTGACGCAGCATGGAATCCCAGTAATGAACCTGTCCGATGGGAAGGCGTACTGCTTTAATCCGTCACTTTCCACATGG
AACCTGGTTTCTGACAAGCAGGACTCACTGGCTCAGTGTGCAGACTTTAGGAGCAGCCTGCCATCCCAGGACGCCATGCTGTGCTCAGGA
CCGTTAGCCATAATCCAGGGCCGCACCTCCAACTCGGGAAGGCAGGCTGCCCGGCTCTTCTCCGTGCCTCATGTGGTGCAGCAAGAGACC
ACCCTGGCCTACCTAGAGAACCAGGTGGCAGCAGCACTCACCCTGCAGTCCAGCCACGAGTACCGCCATTGGCTCCTCGTCTACGCACGG
TACCTCGTAAACGAAGGGTTTGAATACCGACTTCGAGAAATATGCAAGGACTTACTGGGTCCGGTTCACTACTCCACTGGAAGCCAGTGG
GAGTCAACAGTAGTGGGTCTGCGGAAGAGGGAGCTGCTGAAGGAGCTGCTACCAGTCATCGGGCAGAACCTCCGATTCCAGCGCCTCTTC

>In-frame_LONP2_ENST00000535754_chr16_48337216_+_HIRA_ENST00000340170_chr22_19398301_-_4059nt
ATGTCATCAGTGAGCCCCATCCAGATCCCCAGTCGCCTCCCGCTGCTGCTCACCCACGAGGGCGTCCTGCTGCCCGGCTCCACCATGCGC
ACCAGCGTGGACTCGGCCCGCAACCTGCAGCTGGTGCGGAGCCGCCTTCTGAAGGGCACGTCGCTGCAAAGCACCATCCTGGGCGTCATC
CCCAACACGCCTGACCCCGCCAGCGACGCGCAGGACCTGCCGCCGCTGCACAGGATTGGCACAGCTGCACTGGCCGTTCAGGTTGTGGGC
AGTAACTGGCCCAAGCCCCACTACACTCTGTTGATTACAGGCCTATGCCGTTTCCAGATTGTACAGGTCTTAAAAGAGAAGCCATATCCC
ATTGCTGAAGTGGAGCAGTTGGACCGACTTGAGGAGTTTCCCAACACCTGTAAAATGAGGGAGGAGCTAGGAGAACTATCAGAGCAGTTT
TACAAATATGCAGTACAAATTTTAGATGCTGTGAGCCTAGAGGAGCGGTTCAAGATGACTATACCACTGCTTGTCAGACAAATTGAAGGC
CTGAAATTGCTTCAAAAAACCAGAAAACCCAAGCAAGATGATGATAAGAGGGTTATAGCAATACGCCCTATTAGGAGAATTACACATATC
TCAGGTACTTTAGAAGATGAAGATGAAGATGAAGATAATGATGACATTGTCATGCTAGAGAAAAAAATACGAACATCTAGTATGCCAGAG
CAGGCCCATAAAGTCTGTGTCAAAGAGATAAAGAGACTCAAAAAAATGCCTCAGTCAATGCCAGAATATGCTCTGACTAGAAATTATTTG
GAACTTATGGTAGAACTTCCTTGGAACAAAAGTACAACTGACCGCCTGGACATTAGGGCAGCCCGGATTCTTCTGGATAATGACCATTAC
GCCATGGAAAAATTGAAGAAAAGAGTACTGGAATACTTGGCTGTCAGACAGCTCAAAAATAACCTGAAGGGCCCAATCCTATGCTTTGTT
GGCCCTCCTGGAGTTGGTAAAACAAGTGTGGGAAGATCAGTGGCCAAGACTCTAGGTCGAGAGTTCCACAGGATTGCACTTGGAGGAGTA
TGTGATCAGTCTGACATTCGAGGACACAGGCGCACCTATGTTGGCAGCATGCCTGGTCGCATCATCAACGGCTTGAAGACTGTGGGAGTG
AACAACCCAGTGTTCCTATTAGATGAGGTTGACAAACTGGGAAAAAGTCTACAGGGTGATCCAGCAGCAGCTCTGCTTGAGGTGTTGGAT
CCTGAACAAAACCATAACTTCACAGATCATTATCTAAATGTGGCCTTTGACCTTTCTCAAGTTCTTTTTATAGCTACTGCCAACACCACT
GCTACCATTCCAGCTGCCTTGTTGGACAGAATGGAGATCATTCAGGTTCCAGGTTATACACAGGAGGAGAAGATAGAGATTGCCCATAGG
CACTTGATCCCCAAGCAGCTGGAACAACATGGGCTGACTCCACAGCAGATTCAGATACCCCAGGTCACCACTCTTGACATCATCACCAGG
TATACCAGAGAGGCAGGGGTTCGTTCTCTGGATAGAAAACTTGGGGCCATTTGCCGAGCTGTGGCCGTGAAGGTGGCAGAAGGACAGCAT
AAGGAAGCCAAGTTGGACCGTTCTGATGTGACTGAGAGAGAAGGCAAGCCGATTTTTTCAGTTGATATTCACCCTGACGGGACCAAGTTC
GCAACTGGAGGACAAGGGCAGGATTCTGGGAAGGTTGTGATCTGGAATATGTCTCCAGTCCTCCAGGAGGATGACGAGAAGGATGAAAAT
ATTCCCAAGATGCTTTGCCAGATGGACAATCACTTAGCATGTGTGAACTGTGTGCGGTGGTCAAACAGTGGGATGTATTTAGCTTCTGGG
GGAGATGACAAACTGATTATGGTGTGGAAGCGGGCTACGTACATCGGCCCCAGCACCGTGTTCGGCTCCAGTGGTAAGCTTGCCAATGTG
GAGCAGTGGCGGTGTGTCTCTATCCTCCGGAATCATTCAGGCGATGTGATGGATGTAGCATGGTCTCCCCACGATGCCTGGCTAGCCTCA
TGCAGCGTGGATAACACTGTCGTCATCTGGAATGCTGTAAAGTTCCCAGAAATTCTAGCTACTCTGAGAGGTCATTCTGGCTTGGTCAAA
GGGTTGACATGGGACCCTGTTGGTAAATACATAGCTTCTCAAGCTGATGACCGCAGCCTAAAGGTGTGGAGGACGCTGGACTGGCAGTTG
GAGACCAGCATCACCAAGCCTTTTGATGAGTGTGGAGGAACGACCCATGTGTTGCGGCTCAGCTGGTCACCTGATGGGCATTACCTGGTG
TCTGCCCATGCCATGAACAACTCAGGCCCCACTGCCCAGATCATCGAACGGGAGGGATGGAAGACCAACATGGACTTTGTTGGGCACCGG
AAAGCTGTGACTGTCGTGAAATTCAACCCAAAAATCTTCAAAAAGAAGCAGAAGAATGGGAGTTCTGCGAAGCCTAGCTGCCCGTACTGC
TGCTGTGCTGTTGGCAGCAAGGACCGCTCGCTTTCTGTCTGGCTCACATGTCTGAAACGGCCGCTGGTGGTCATCCATGAACTGTTTGAC
AAATCCATCATGGATATTTCCTGGACTCTGAATGGGCTGGGCATCTTGGTATGCTCTATGGACGGCTCTGTGGCATTCCTCGACTTCTCC
CAGGATGAGCTTGGCGATCCCCTGAGCGAGGAGGAGAAGAGCCGCATTCACCAGTCCACCTATGGCAAGAGCCTAGCCATCATGACCGAG
GCCCAGCTCTCCACAGCCGTCATTGAGAACCCTGAGATGCTCAAGTACCAGCGAAGGCAGCAGCAGCAGCAGCTGGACCAGAAGAGTGCT
GCGACCAGGGAGATGGGCTCAGCCACCTCAGTCGCAGGCGTTGTCAACGGGGAGAGTCTTGAAGATATCAGGAAGAATCTTTTGAAGAAA
CAAGTTGAGACTCGGACAGCAGATGGCCGGAGAAGAATCACGCCTCTCTGCATAGCACAGCTGGACACTGGGGACTTCTCCACGGCATTC
TTTAACAGCATCCCCCTCTCGGGCTCCCTGGCGGGCACCATGCTCTCTTCTCATAGCAGTCCACAGCTACTGCCACTGGACTCCAGTACC
CCTAACTCCTTCGGCGCCTCGAAGCCTTGCACAGAGCCTGTGGTGGCTGCCAGTGCCAGACCTGCAGGCGATTCTGTCAATAAAGACAGT
ATGAATGCTACCTCTACTCCTGCTGCATTGTCACCTTCTGTGTTAACGACCCCGTCCAAGATCGAACCCATGAAAGCGTTTGACTCCCGG
TTCACAGAGCGGTCCAAAGCCACACCAGGTGCTCCTGCCCTGACCAGCATGACTCCGACAGCTGTGGAAAGGGATGTTCACAGACAGGTG
GTTGTGGTGAAAGAAGAGTCTCTACACTCCATCCTGGCAGGAAGTGATATGACGGTATCACAGATCTTGCTGACGCAGCATGGAATCCCA
GTAATGAACCTGTCCGATGGGAAGGCGTACTGCTTTAATCCGTCACTTTCCACATGGAACCTGGTTTCTGACAAGCAGGACTCACTGGCT
CAGTGTGCAGACTTTAGGAGCAGCCTGCCATCCCAGGACGCCATGCTGTGCTCAGGACCGTTAGCCATAATCCAGGGCCGCACCTCCAAC
TCGGGAAGGCAGGCTGCCCGGCTCTTCTCCGTGCCTCATGTGGTGCAGCAAGAGACCACCCTGGCCTACCTAGAGAACCAGGTGGCAGCA
GCACTCACCCTGCAGTCCAGCCACGAGTACCGCCATTGGCTCCTCGTCTACGCACGGTACCTCGTAAACGAAGGGTTTGAATACCGACTT
CGAGAAATATGCAAGGACTTACTGGGTCCGGTTCACTACTCCACTGGAAGCCAGTGGGAGTCAACAGTAGTGGGTCTGCGGAAGAGGGAG
CTGCTGAAGGAGCTGCTACCAGTCATCGGGCAGAACCTCCGATTCCAGCGCCTCTTCACCGAGTGTCAGGAACAGCTCGACATCCTGAGG

>In-frame_LONP2_ENST00000535754_chr16_48337216_+_HIRA_ENST00000263208_chr22_19398301_-_4680nt
ATGTCATCAGTGAGCCCCATCCAGATCCCCAGTCGCCTCCCGCTGCTGCTCACCCACGAGGGCGTCCTGCTGCCCGGCTCCACCATGCGC
ACCAGCGTGGACTCGGCCCGCAACCTGCAGCTGGTGCGGAGCCGCCTTCTGAAGGGCACGTCGCTGCAAAGCACCATCCTGGGCGTCATC
CCCAACACGCCTGACCCCGCCAGCGACGCGCAGGACCTGCCGCCGCTGCACAGGATTGGCACAGCTGCACTGGCCGTTCAGGTTGTGGGC
AGTAACTGGCCCAAGCCCCACTACACTCTGTTGATTACAGGCCTATGCCGTTTCCAGATTGTACAGGTCTTAAAAGAGAAGCCATATCCC
ATTGCTGAAGTGGAGCAGTTGGACCGACTTGAGGAGTTTCCCAACACCTGTAAAATGAGGGAGGAGCTAGGAGAACTATCAGAGCAGTTT
TACAAATATGCAGTACAAATTTTAGATGCTGTGAGCCTAGAGGAGCGGTTCAAGATGACTATACCACTGCTTGTCAGACAAATTGAAGGC
CTGAAATTGCTTCAAAAAACCAGAAAACCCAAGCAAGATGATGATAAGAGGGTTATAGCAATACGCCCTATTAGGAGAATTACACATATC
TCAGGTACTTTAGAAGATGAAGATGAAGATGAAGATAATGATGACATTGTCATGCTAGAGAAAAAAATACGAACATCTAGTATGCCAGAG
CAGGCCCATAAAGTCTGTGTCAAAGAGATAAAGAGACTCAAAAAAATGCCTCAGTCAATGCCAGAATATGCTCTGACTAGAAATTATTTG
GAACTTATGGTAGAACTTCCTTGGAACAAAAGTACAACTGACCGCCTGGACATTAGGGCAGCCCGGATTCTTCTGGATAATGACCATTAC
GCCATGGAAAAATTGAAGAAAAGAGTACTGGAATACTTGGCTGTCAGACAGCTCAAAAATAACCTGAAGGGCCCAATCCTATGCTTTGTT
GGCCCTCCTGGAGTTGGTAAAACAAGTGTGGGAAGATCAGTGGCCAAGACTCTAGGTCGAGAGTTCCACAGGATTGCACTTGGAGGAGTA
TGTGATCAGTCTGACATTCGAGGACACAGGCGCACCTATGTTGGCAGCATGCCTGGTCGCATCATCAACGGCTTGAAGACTGTGGGAGTG
AACAACCCAGTGTTCCTATTAGATGAGGTTGACAAACTGGGAAAAAGTCTACAGGGTGATCCAGCAGCAGCTCTGCTTGAGGTGTTGGAT
CCTGAACAAAACCATAACTTCACAGATCATTATCTAAATGTGGCCTTTGACCTTTCTCAAGTTCTTTTTATAGCTACTGCCAACACCACT
GCTACCATTCCAGCTGCCTTGTTGGACAGAATGGAGATCATTCAGGTTCCAGGTTATACACAGGAGGAGAAGATAGAGATTGCCCATAGG
CACTTGATCCCCAAGCAGCTGGAACAACATGGGCTGACTCCACAGCAGATTCAGATACCCCAGGTCACCACTCTTGACATCATCACCAGG
TATACCAGAGAGGCAGGGGTTCGTTCTCTGGATAGAAAACTTGGGGCCATTTGCCGAGCTGTGGCCGTGAAGGTGGCAGAAGGACAGCAT
AAGGAAGCCAAGTTGGACCGTTCTGATGTGACTGAGAGAGAAGGCAAGCCGATTTTTTCAGTTGATATTCACCCTGACGGGACCAAGTTC
GCAACTGGAGGACAAGGGCAGGATTCTGGGAAGGTTGTGATCTGGAATATGTCTCCAGTCCTCCAGGAGGATGACGAGAAGGATGAAAAT
ATTCCCAAGATGCTTTGCCAGATGGACAATCACTTAGCATGTGTGAACTGTGTGCGGTGGTCAAACAGTGGGATGTATTTAGCTTCTGGG
GGAGATGACAAACTGATTATGGTGTGGAAGCGGGCTACGTACATCGGCCCCAGCACCGTGTTCGGCTCCAGTGGTAAGCTTGCCAATGTG
GAGCAGTGGCGGTGTGTCTCTATCCTCCGGAATCATTCAGGCGATGTGATGGATGTAGCATGGTCTCCCCACGATGCCTGGCTAGCCTCA
TGCAGCGTGGATAACACTGTCGTCATCTGGAATGCTGTAAAGTTCCCAGAAATTCTAGCTACTCTGAGAGGTCATTCTGGCTTGGTCAAA
GGGTTGACATGGGACCCTGTTGGTAAATACATAGCTTCTCAAGCTGATGACCGCAGCCTAAAGGTGTGGAGGACGCTGGACTGGCAGTTG
GAGACCAGCATCACCAAGCCTTTTGATGAGTGTGGAGGAACGACCCATGTGTTGCGGCTCAGCTGGTCACCTGATGGGCATTACCTGGTG
TCTGCCCATGCCATGAACAACTCAGGCCCCACTGCCCAGATCATCGAACGGGAGGGATGGAAGACCAACATGGACTTTGTTGGGCACCGG
AAAGCTGTGACTGTCGTGAAATTCAACCCAAAAATCTTCAAAAAGAAGCAGAAGAATGGGAGTTCTGCGAAGCCTAGCTGCCCGTACTGC
TGCTGTGCTGTTGGCAGCAAGGACCGCTCGCTTTCTGTCTGGCTCACATGTCTGAAACGGCCGCTGGTGGTCATCCATGAACTGTTTGAC
AAATCCATCATGGATATTTCCTGGACTCTGAATGGGCTGGGCATCTTGGTATGCTCTATGGACGGCTCTGTGGCATTCCTCGACTTCTCC
CAGGATGAGCTTGGCGATCCCCTGAGCGAGGAGGAGAAGAGCCGCATTCACCAGTCCACCTATGGCAAGAGCCTAGCCATCATGACCGAG
GCCCAGCTCTCCACAGCCGTCATTGAGAACCCTGAGATGCTCAAGTACCAGCGAAGGCAGCAGCAGCAGCAGCTGGACCAGAAGAGTGCT
GCGACCAGGGAGATGGGCTCAGCCACCTCAGTCGCAGGCGTTGTCAACGGGGAGAGTCTTGAAGATATCAGGAAGAATCTTTTGAAGAAA
CAAGTTGAGACTCGGACAGCAGATGGCCGGAGAAGAATCACGCCTCTCTGCATAGCACAGCTGGACACTGGGGACTTCTCCACGGCATTC
TTTAACAGCATCCCCCTCTCGGGCTCCCTGGCGGGCACCATGCTCTCTTCTCATAGCAGTCCACAGCTACTGCCACTGGACTCCAGTACC
CCTAACTCCTTCGGCGCCTCGAAGCCTTGCACAGAGCCTGTGGTGGCTGCCAGTGCCAGACCTGCAGGCGATTCTGTCAATAAAGACAGT
ATGAATGCTACCTCTACTCCTGCTGCATTGTCACCTTCTGTGTTAACGACCCCGTCCAAGATCGAACCCATGAAAGCGTTTGACTCCCGG
TTCACAGAGCGGTCCAAAGCCACACCAGGTGCTCCTGCCCTGACCAGCATGACTCCGACAGCTGTGGAAAGGTTAAAAGAGCAGAACCTT
GTGAAAGAGCTGAGGCCCCGAGACCTCCTGGAGAGCAGCAGTGACAGCGATGAGAAAGTCCCTTTGGCTAAGGCTTCCTCACTGTCCAAG
CGAAAACTTGAGCTTGAGGTAGAGACAGTAGAGAAGAAGAAGAAAGGGCGGCCTCGGAAGGACTCTCGTCTCATGCCTGTGTCTCTGTCT
GTCCAGTCTCCAGCTGCCCTAACCGCAGAGAAGGAGGCCATGTGTCTGTCTGCACCAGCACTTGCACTGAAGCTGCCAATTCCAAGCCCC
CAGAGAGCATTCACCCTCCAGGTCAGCTCCGATCCTTCCATGTACATTGAGGTGGAGAATGAAGTGACAGTGGTGGGGGGCGTGAAGCTG
AGCCGCCTGAAGTGCAACCGGGAAGGGAAGGAGTGGGAGACGGTACTCACCAGCCGGATCCTCACTGCTGCGGGCAGCTGTGACGTGGTG
TGTGTCGCCTGTGAAAAAAGGATGCTGTCAGTGTTCTCCACCTGTGGTCGCCGTCTCCTCTCTCCCATCCTCCTGCCATCCCCGATCTCT
ACTTTGCATTGCACAGGCTCCTACGTCATGGCGCTCACCGCTGCAGCCACACTCTCTGTCTGGGATGTTCACAGACAGGTGGTTGTGGTG
AAAGAAGAGTCTCTACACTCCATCCTGGCAGGAAGTGATATGACGGTATCACAGATCTTGCTGACGCAGCATGGAATCCCAGTAATGAAC
CTGTCCGATGGGAAGGCGTACTGCTTTAATCCGTCACTTTCCACATGGAACCTGGTTTCTGACAAGCAGGACTCACTGGCTCAGTGTGCA
GACTTTAGGAGCAGCCTGCCATCCCAGGACGCCATGCTGTGCTCAGGACCGTTAGCCATAATCCAGGGCCGCACCTCCAACTCGGGAAGG
CAGGCTGCCCGGCTCTTCTCCGTGCCTCATGTGGTGCAGCAAGAGACCACCCTGGCCTACCTAGAGAACCAGGTGGCAGCAGCACTCACC
CTGCAGTCCAGCCACGAGTACCGCCATTGGCTCCTCGTCTACGCACGGTACCTCGTAAACGAAGGGTTTGAATACCGACTTCGAGAAATA
TGCAAGGACTTACTGGGTCCGGTTCACTACTCCACTGGAAGCCAGTGGGAGTCAACAGTAGTGGGTCTGCGGAAGAGGGAGCTGCTGAAG
GAGCTGCTACCAGTCATCGGGCAGAACCTCCGATTCCAGCGCCTCTTCACCGAGTGTCAGGAACAGCTCGACATCCTGAGGGACAAGTAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_LONP2_ENST00000285737_chr16_48337216_+_HIRA_ENST00000340170_chr22_19398301_-_5026nt
AGGCGGGTCTGAGGTTTGGTGACTGCGGGGCAGGCCGGGGGCAGCTGTCTGTCTGGCTCTTTTTGACAGCCCCCAGTGCGAAAGGCTGCC
AGCATGTCATCAGTGAGCCCCATCCAGATCCCCAGTCGCCTCCCGCTGCTGCTCACCCACGAGGGCGTCCTGCTGCCCGGCTCCACCATG
CGCACCAGCGTGGACTCGGCCCGCAACCTGCAGCTGGTGCGGAGCCGCCTTCTGAAGGGCACGTCGCTGCAAAGCACCATCCTGGGCGTC
ATCCCCAACACGCCTGACCCCGCCAGCGACGCGCAGGACCTGCCGCCGCTGCACAGGATTGGCACAGCTGCACTGGCCGTTCAGGTTGTG
GGCAGTAACTGGCCCAAGCCCCACTACACTCTGTTGATTACAGGCCTATGCCGTTTCCAGATTGTACAGGTCTTAAAAGAGAAGCCATAT
CCCATTGCTGAAGTGGAGCAGTTGGACCGACTTGAGGAGTTTCCCAACACCTGTAAAATGAGGGAGGAGCTAGGAGAACTATCAGAGCAG
TTTTACAAATATGCAGTACAATTGGTTGAAATGTTGGATATGTCTGTCCCTGCAGTTGCTAAATTGAGACGTCTTTTAGATAGTCTTCCA
AGGGAAGCTTTACCAGACATCTTGACATCAATTATCCGAACAAGCAACAAAGAGAAACTCCAGATTTTAGATGCTGTGAGCCTAGAGGAG
CGGTTCAAGATGACTATACCACTGCTTGTCAGACAAATTGAAGGCCTGAAATTGCTTCAAAAAACCAGAAAACCCAAGCAAGATGATGAT
AAGAGGGTTATAGCAATACGCCCTATTAGGAGAATTACACATATCTCAGGTACTTTAGAAGATGAAGATGAAGATGAAGATAATGATGAC
ATTGTCATGCTAGAGAAAAAAATACGAACATCTAGTATGCCAGAGCAGGCCCATAAAGTCTGTGTCAAAGAGATAAAGAGACTCAAAAAA
ATGCCTCAGTCAATGCCAGAATATGCTCTGACTAGAAATTATTTGGAACTTATGGTAGAACTTCCTTGGAACAAAAGTACAACTGACCGC
CTGGACATTAGGGCAGCCCGGATTCTTCTGGATAATGACCATTACGCCATGGAAAAATTGAAGAAAAGAGTACTGGAATACTTGGCTGTC
AGACAGCTCAAAAATAACCTGAAGGGCCCAATCCTATGCTTTGTTGGCCCTCCTGGAGTTGGTAAAACAAGTGTGGGAAGATCAGTGGCC
AAGACTCTAGGTCGAGAGTTCCACAGGATTGCACTTGGAGGAGTATGTGATCAGTCTGACATTCGAGGACACAGGCGCACCTATGTTGGC
AGCATGCCTGGTCGCATCATCAACGGCTTGAAGACTGTGGGAGTGAACAACCCAGTGTTCCTATTAGATGAGGTTGACAAACTGGGAAAA
AGTCTACAGGGTGATCCAGCAGCAGCTCTGCTTGAGGTGTTGGATCCTGAACAAAACCATAACTTCACAGATCATTATCTAAATGTGGCC
TTTGACCTTTCTCAAGTTCTTTTTATAGCTACTGCCAACACCACTGCTACCATTCCAGCTGCCTTGTTGGACAGAATGGAGATCATTCAG
GTTCCAGGTTATACACAGGAGGAGAAGATAGAGATTGCCCATAGGCACTTGATCCCCAAGCAGCTGGAACAACATGGGCTGACTCCACAG
CAGATTCAGATACCCCAGGTCACCACTCTTGACATCATCACCAGGTATACCAGAGAGGCAGGGGTTCGTTCTCTGGATAGAAAACTTGGG
GCCATTTGCCGAGCTGTGGCCGTGAAGGTGGCAGAAGGACAGCATAAGGAAGCCAAGTTGGACCGTTCTGATGTGACTGAGAGAGAAGGC
AAGCCGATTTTTTCAGTTGATATTCACCCTGACGGGACCAAGTTCGCAACTGGAGGACAAGGGCAGGATTCTGGGAAGGTTGTGATCTGG
AATATGTCTCCAGTCCTCCAGGAGGATGACGAGAAGGATGAAAATATTCCCAAGATGCTTTGCCAGATGGACAATCACTTAGCATGTGTG
AACTGTGTGCGGTGGTCAAACAGTGGGATGTATTTAGCTTCTGGGGGAGATGACAAACTGATTATGGTGTGGAAGCGGGCTACGTACATC
GGCCCCAGCACCGTGTTCGGCTCCAGTGGTAAGCTTGCCAATGTGGAGCAGTGGCGGTGTGTCTCTATCCTCCGGAATCATTCAGGCGAT
GTGATGGATGTAGCATGGTCTCCCCACGATGCCTGGCTAGCCTCATGCAGCGTGGATAACACTGTCGTCATCTGGAATGCTGTAAAGTTC
CCAGAAATTCTAGCTACTCTGAGAGGTCATTCTGGCTTGGTCAAAGGGTTGACATGGGACCCTGTTGGTAAATACATAGCTTCTCAAGCT
GATGACCGCAGCCTAAAGGTGTGGAGGACGCTGGACTGGCAGTTGGAGACCAGCATCACCAAGCCTTTTGATGAGTGTGGAGGAACGACC
CATGTGTTGCGGCTCAGCTGGTCACCTGATGGGCATTACCTGGTGTCTGCCCATGCCATGAACAACTCAGGCCCCACTGCCCAGATCATC
GAACGGGAGGGATGGAAGACCAACATGGACTTTGTTGGGCACCGGAAAGCTGTGACTGTCGTGAAATTCAACCCAAAAATCTTCAAAAAG
AAGCAGAAGAATGGGAGTTCTGCGAAGCCTAGCTGCCCGTACTGCTGCTGTGCTGTTGGCAGCAAGGACCGCTCGCTTTCTGTCTGGCTC
ACATGTCTGAAACGGCCGCTGGTGGTCATCCATGAACTGTTTGACAAATCCATCATGGATATTTCCTGGACTCTGAATGGGCTGGGCATC
TTGGTATGCTCTATGGACGGCTCTGTGGCATTCCTCGACTTCTCCCAGGATGAGCTTGGCGATCCCCTGAGCGAGGAGGAGAAGAGCCGC
ATTCACCAGTCCACCTATGGCAAGAGCCTAGCCATCATGACCGAGGCCCAGCTCTCCACAGCCGTCATTGAGAACCCTGAGATGCTCAAG
TACCAGCGAAGGCAGCAGCAGCAGCAGCTGGACCAGAAGAGTGCTGCGACCAGGGAGATGGGCTCAGCCACCTCAGTCGCAGGCGTTGTC
AACGGGGAGAGTCTTGAAGATATCAGGAAGAATCTTTTGAAGAAACAAGTTGAGACTCGGACAGCAGATGGCCGGAGAAGAATCACGCCT
CTCTGCATAGCACAGCTGGACACTGGGGACTTCTCCACGGCATTCTTTAACAGCATCCCCCTCTCGGGCTCCCTGGCGGGCACCATGCTC
TCTTCTCATAGCAGTCCACAGCTACTGCCACTGGACTCCAGTACCCCTAACTCCTTCGGCGCCTCGAAGCCTTGCACAGAGCCTGTGGTG
GCTGCCAGTGCCAGACCTGCAGGCGATTCTGTCAATAAAGACAGTATGAATGCTACCTCTACTCCTGCTGCATTGTCACCTTCTGTGTTA
ACGACCCCGTCCAAGATCGAACCCATGAAAGCGTTTGACTCCCGGTTCACAGAGCGGTCCAAAGCCACACCAGGTGCTCCTGCCCTGACC
AGCATGACTCCGACAGCTGTGGAAAGGGATGTTCACAGACAGGTGGTTGTGGTGAAAGAAGAGTCTCTACACTCCATCCTGGCAGGAAGT
GATATGACGGTATCACAGATCTTGCTGACGCAGCATGGAATCCCAGTAATGAACCTGTCCGATGGGAAGGCGTACTGCTTTAATCCGTCA
CTTTCCACATGGAACCTGGTTTCTGACAAGCAGGACTCACTGGCTCAGTGTGCAGACTTTAGGAGCAGCCTGCCATCCCAGGACGCCATG
CTGTGCTCAGGACCGTTAGCCATAATCCAGGGCCGCACCTCCAACTCGGGAAGGCAGGCTGCCCGGCTCTTCTCCGTGCCTCATGTGGTG
CAGCAAGAGACCACCCTGGCCTACCTAGAGAACCAGGTGGCAGCAGCACTCACCCTGCAGTCCAGCCACGAGTACCGCCATTGGCTCCTC
GTCTACGCACGGTACCTCGTAAACGAAGGGTTTGAATACCGACTTCGAGAAATATGCAAGGACTTACTGGGTCCGGTTCACTACTCCACT
GGAAGCCAGTGGGAGTCAACAGTAGTGGGTCTGCGGAAGAGGGAGCTGCTGAAGGAGCTGCTACCAGTCATCGGGCAGAACCTCCGATTC
CAGCGCCTCTTCACCGAGTGTCAGGAACAGCTCGACATCCTGAGGGACAAGTAGCCTGCCCCAGCCTGCCCTGGCTGCAGCAAGGGCAGG
GCCACACTCTCGCCGCTGATGACATGCAGGACCGCCTCTCACCTGACCAGGCTGTAGGGGGAGGAGACACTGGCAGGAGATGTGCTGTCC
TGCACCAGCGCCAGCCCAGCTCCCTGGGCAGATGTGCCCTGTGTCCTGGGTCTGACATTGCCTCAGGAGGGGGAAGCTCATCCCTCCCTC
CAAGCCCCCGATGCGGAGCTAGGGCTGGAGCTCTGCCCAGGTGCCCTGGGGCCAGCAAGGCAGTCCCAGGCCTGCCGTCTCCAGCACGGC
CCCAAGGTGGACACTAGCCCCTGCTGCTGCAGGCACCATGCTGCTTCAGCAGTGACGATTGAGCCATTTGTGAGAGAGAATCCGGAAGCG
TTAGGTATTACAGCAGACTGACCTAAGACCTATGTAAAAGGAAAGCTGTTCCAACACACGGACTATTTTTGTACTAGAATTTGCTAACTT
GTAATATTGAATTTCCTTTGGCCGATAATCAGGATTTCCCTATAAGTCACTTGGACATTGGTCACTTGTAGGAAATTTAAACTCTAATTA
TGACAGCTACACTGAAAAATAATTGTACTGAAATTAACTTGTCTATCTTCATTTGGTTTTAATTTTTAAATGTTTGTAAAAAGAGACTGT

>In-frame_LONP2_ENST00000285737_chr16_48337216_+_HIRA_ENST00000263208_chr22_19398301_-_5647nt
AGGCGGGTCTGAGGTTTGGTGACTGCGGGGCAGGCCGGGGGCAGCTGTCTGTCTGGCTCTTTTTGACAGCCCCCAGTGCGAAAGGCTGCC
AGCATGTCATCAGTGAGCCCCATCCAGATCCCCAGTCGCCTCCCGCTGCTGCTCACCCACGAGGGCGTCCTGCTGCCCGGCTCCACCATG
CGCACCAGCGTGGACTCGGCCCGCAACCTGCAGCTGGTGCGGAGCCGCCTTCTGAAGGGCACGTCGCTGCAAAGCACCATCCTGGGCGTC
ATCCCCAACACGCCTGACCCCGCCAGCGACGCGCAGGACCTGCCGCCGCTGCACAGGATTGGCACAGCTGCACTGGCCGTTCAGGTTGTG
GGCAGTAACTGGCCCAAGCCCCACTACACTCTGTTGATTACAGGCCTATGCCGTTTCCAGATTGTACAGGTCTTAAAAGAGAAGCCATAT
CCCATTGCTGAAGTGGAGCAGTTGGACCGACTTGAGGAGTTTCCCAACACCTGTAAAATGAGGGAGGAGCTAGGAGAACTATCAGAGCAG
TTTTACAAATATGCAGTACAATTGGTTGAAATGTTGGATATGTCTGTCCCTGCAGTTGCTAAATTGAGACGTCTTTTAGATAGTCTTCCA
AGGGAAGCTTTACCAGACATCTTGACATCAATTATCCGAACAAGCAACAAAGAGAAACTCCAGATTTTAGATGCTGTGAGCCTAGAGGAG
CGGTTCAAGATGACTATACCACTGCTTGTCAGACAAATTGAAGGCCTGAAATTGCTTCAAAAAACCAGAAAACCCAAGCAAGATGATGAT
AAGAGGGTTATAGCAATACGCCCTATTAGGAGAATTACACATATCTCAGGTACTTTAGAAGATGAAGATGAAGATGAAGATAATGATGAC
ATTGTCATGCTAGAGAAAAAAATACGAACATCTAGTATGCCAGAGCAGGCCCATAAAGTCTGTGTCAAAGAGATAAAGAGACTCAAAAAA
ATGCCTCAGTCAATGCCAGAATATGCTCTGACTAGAAATTATTTGGAACTTATGGTAGAACTTCCTTGGAACAAAAGTACAACTGACCGC
CTGGACATTAGGGCAGCCCGGATTCTTCTGGATAATGACCATTACGCCATGGAAAAATTGAAGAAAAGAGTACTGGAATACTTGGCTGTC
AGACAGCTCAAAAATAACCTGAAGGGCCCAATCCTATGCTTTGTTGGCCCTCCTGGAGTTGGTAAAACAAGTGTGGGAAGATCAGTGGCC
AAGACTCTAGGTCGAGAGTTCCACAGGATTGCACTTGGAGGAGTATGTGATCAGTCTGACATTCGAGGACACAGGCGCACCTATGTTGGC
AGCATGCCTGGTCGCATCATCAACGGCTTGAAGACTGTGGGAGTGAACAACCCAGTGTTCCTATTAGATGAGGTTGACAAACTGGGAAAA
AGTCTACAGGGTGATCCAGCAGCAGCTCTGCTTGAGGTGTTGGATCCTGAACAAAACCATAACTTCACAGATCATTATCTAAATGTGGCC
TTTGACCTTTCTCAAGTTCTTTTTATAGCTACTGCCAACACCACTGCTACCATTCCAGCTGCCTTGTTGGACAGAATGGAGATCATTCAG
GTTCCAGGTTATACACAGGAGGAGAAGATAGAGATTGCCCATAGGCACTTGATCCCCAAGCAGCTGGAACAACATGGGCTGACTCCACAG
CAGATTCAGATACCCCAGGTCACCACTCTTGACATCATCACCAGGTATACCAGAGAGGCAGGGGTTCGTTCTCTGGATAGAAAACTTGGG
GCCATTTGCCGAGCTGTGGCCGTGAAGGTGGCAGAAGGACAGCATAAGGAAGCCAAGTTGGACCGTTCTGATGTGACTGAGAGAGAAGGC
AAGCCGATTTTTTCAGTTGATATTCACCCTGACGGGACCAAGTTCGCAACTGGAGGACAAGGGCAGGATTCTGGGAAGGTTGTGATCTGG
AATATGTCTCCAGTCCTCCAGGAGGATGACGAGAAGGATGAAAATATTCCCAAGATGCTTTGCCAGATGGACAATCACTTAGCATGTGTG
AACTGTGTGCGGTGGTCAAACAGTGGGATGTATTTAGCTTCTGGGGGAGATGACAAACTGATTATGGTGTGGAAGCGGGCTACGTACATC
GGCCCCAGCACCGTGTTCGGCTCCAGTGGTAAGCTTGCCAATGTGGAGCAGTGGCGGTGTGTCTCTATCCTCCGGAATCATTCAGGCGAT
GTGATGGATGTAGCATGGTCTCCCCACGATGCCTGGCTAGCCTCATGCAGCGTGGATAACACTGTCGTCATCTGGAATGCTGTAAAGTTC
CCAGAAATTCTAGCTACTCTGAGAGGTCATTCTGGCTTGGTCAAAGGGTTGACATGGGACCCTGTTGGTAAATACATAGCTTCTCAAGCT
GATGACCGCAGCCTAAAGGTGTGGAGGACGCTGGACTGGCAGTTGGAGACCAGCATCACCAAGCCTTTTGATGAGTGTGGAGGAACGACC
CATGTGTTGCGGCTCAGCTGGTCACCTGATGGGCATTACCTGGTGTCTGCCCATGCCATGAACAACTCAGGCCCCACTGCCCAGATCATC
GAACGGGAGGGATGGAAGACCAACATGGACTTTGTTGGGCACCGGAAAGCTGTGACTGTCGTGAAATTCAACCCAAAAATCTTCAAAAAG
AAGCAGAAGAATGGGAGTTCTGCGAAGCCTAGCTGCCCGTACTGCTGCTGTGCTGTTGGCAGCAAGGACCGCTCGCTTTCTGTCTGGCTC
ACATGTCTGAAACGGCCGCTGGTGGTCATCCATGAACTGTTTGACAAATCCATCATGGATATTTCCTGGACTCTGAATGGGCTGGGCATC
TTGGTATGCTCTATGGACGGCTCTGTGGCATTCCTCGACTTCTCCCAGGATGAGCTTGGCGATCCCCTGAGCGAGGAGGAGAAGAGCCGC
ATTCACCAGTCCACCTATGGCAAGAGCCTAGCCATCATGACCGAGGCCCAGCTCTCCACAGCCGTCATTGAGAACCCTGAGATGCTCAAG
TACCAGCGAAGGCAGCAGCAGCAGCAGCTGGACCAGAAGAGTGCTGCGACCAGGGAGATGGGCTCAGCCACCTCAGTCGCAGGCGTTGTC
AACGGGGAGAGTCTTGAAGATATCAGGAAGAATCTTTTGAAGAAACAAGTTGAGACTCGGACAGCAGATGGCCGGAGAAGAATCACGCCT
CTCTGCATAGCACAGCTGGACACTGGGGACTTCTCCACGGCATTCTTTAACAGCATCCCCCTCTCGGGCTCCCTGGCGGGCACCATGCTC
TCTTCTCATAGCAGTCCACAGCTACTGCCACTGGACTCCAGTACCCCTAACTCCTTCGGCGCCTCGAAGCCTTGCACAGAGCCTGTGGTG
GCTGCCAGTGCCAGACCTGCAGGCGATTCTGTCAATAAAGACAGTATGAATGCTACCTCTACTCCTGCTGCATTGTCACCTTCTGTGTTA
ACGACCCCGTCCAAGATCGAACCCATGAAAGCGTTTGACTCCCGGTTCACAGAGCGGTCCAAAGCCACACCAGGTGCTCCTGCCCTGACC
AGCATGACTCCGACAGCTGTGGAAAGGTTAAAAGAGCAGAACCTTGTGAAAGAGCTGAGGCCCCGAGACCTCCTGGAGAGCAGCAGTGAC
AGCGATGAGAAAGTCCCTTTGGCTAAGGCTTCCTCACTGTCCAAGCGAAAACTTGAGCTTGAGGTAGAGACAGTAGAGAAGAAGAAGAAA
GGGCGGCCTCGGAAGGACTCTCGTCTCATGCCTGTGTCTCTGTCTGTCCAGTCTCCAGCTGCCCTAACCGCAGAGAAGGAGGCCATGTGT
CTGTCTGCACCAGCACTTGCACTGAAGCTGCCAATTCCAAGCCCCCAGAGAGCATTCACCCTCCAGGTCAGCTCCGATCCTTCCATGTAC
ATTGAGGTGGAGAATGAAGTGACAGTGGTGGGGGGCGTGAAGCTGAGCCGCCTGAAGTGCAACCGGGAAGGGAAGGAGTGGGAGACGGTA
CTCACCAGCCGGATCCTCACTGCTGCGGGCAGCTGTGACGTGGTGTGTGTCGCCTGTGAAAAAAGGATGCTGTCAGTGTTCTCCACCTGT
GGTCGCCGTCTCCTCTCTCCCATCCTCCTGCCATCCCCGATCTCTACTTTGCATTGCACAGGCTCCTACGTCATGGCGCTCACCGCTGCA
GCCACACTCTCTGTCTGGGATGTTCACAGACAGGTGGTTGTGGTGAAAGAAGAGTCTCTACACTCCATCCTGGCAGGAAGTGATATGACG
GTATCACAGATCTTGCTGACGCAGCATGGAATCCCAGTAATGAACCTGTCCGATGGGAAGGCGTACTGCTTTAATCCGTCACTTTCCACA
TGGAACCTGGTTTCTGACAAGCAGGACTCACTGGCTCAGTGTGCAGACTTTAGGAGCAGCCTGCCATCCCAGGACGCCATGCTGTGCTCA
GGACCGTTAGCCATAATCCAGGGCCGCACCTCCAACTCGGGAAGGCAGGCTGCCCGGCTCTTCTCCGTGCCTCATGTGGTGCAGCAAGAG
ACCACCCTGGCCTACCTAGAGAACCAGGTGGCAGCAGCACTCACCCTGCAGTCCAGCCACGAGTACCGCCATTGGCTCCTCGTCTACGCA
CGGTACCTCGTAAACGAAGGGTTTGAATACCGACTTCGAGAAATATGCAAGGACTTACTGGGTCCGGTTCACTACTCCACTGGAAGCCAG
TGGGAGTCAACAGTAGTGGGTCTGCGGAAGAGGGAGCTGCTGAAGGAGCTGCTACCAGTCATCGGGCAGAACCTCCGATTCCAGCGCCTC
TTCACCGAGTGTCAGGAACAGCTCGACATCCTGAGGGACAAGTAGCCTGCCCCAGCCTGCCCTGGCTGCAGCAAGGGCAGGGCCACACTC
TCGCCGCTGATGACATGCAGGACCGCCTCTCACCTGACCAGGCTGTAGGGGGAGGAGACACTGGCAGGAGATGTGCTGTCCTGCACCAGC
GCCAGCCCAGCTCCCTGGGCAGATGTGCCCTGTGTCCTGGGTCTGACATTGCCTCAGGAGGGGGAAGCTCATCCCTCCCTCCAAGCCCCC
GATGCGGAGCTAGGGCTGGAGCTCTGCCCAGGTGCCCTGGGGCCAGCAAGGCAGTCCCAGGCCTGCCGTCTCCAGCACGGCCCCAAGGTG
GACACTAGCCCCTGCTGCTGCAGGCACCATGCTGCTTCAGCAGTGACGATTGAGCCATTTGTGAGAGAGAATCCGGAAGCGTTAGGTATT
ACAGCAGACTGACCTAAGACCTATGTAAAAGGAAAGCTGTTCCAACACACGGACTATTTTTGTACTAGAATTTGCTAACTTGTAATATTG
AATTTCCTTTGGCCGATAATCAGGATTTCCCTATAAGTCACTTGGACATTGGTCACTTGTAGGAAATTTAAACTCTAATTATGACAGCTA
CACTGAAAAATAATTGTACTGAAATTAACTTGTCTATCTTCATTTGGTTTTAATTTTTAAATGTTTGTAAAAAGAGACTGTTTTGGGGGA

>In-frame_LONP2_ENST00000535754_chr16_48337216_+_HIRA_ENST00000340170_chr22_19398301_-_4857nt
GGGGCAGCTGTCTGTCTGGCTCTTTTTGACAGCCCCCAGTGCGAAAGGCTGCCAGCATGTCATCAGTGAGCCCCATCCAGATCCCCAGTC
GCCTCCCGCTGCTGCTCACCCACGAGGGCGTCCTGCTGCCCGGCTCCACCATGCGCACCAGCGTGGACTCGGCCCGCAACCTGCAGCTGG
TGCGGAGCCGCCTTCTGAAGGGCACGTCGCTGCAAAGCACCATCCTGGGCGTCATCCCCAACACGCCTGACCCCGCCAGCGACGCGCAGG
ACCTGCCGCCGCTGCACAGGATTGGCACAGCTGCACTGGCCGTTCAGGTTGTGGGCAGTAACTGGCCCAAGCCCCACTACACTCTGTTGA
TTACAGGCCTATGCCGTTTCCAGATTGTACAGGTCTTAAAAGAGAAGCCATATCCCATTGCTGAAGTGGAGCAGTTGGACCGACTTGAGG
AGTTTCCCAACACCTGTAAAATGAGGGAGGAGCTAGGAGAACTATCAGAGCAGTTTTACAAATATGCAGTACAAATTTTAGATGCTGTGA
GCCTAGAGGAGCGGTTCAAGATGACTATACCACTGCTTGTCAGACAAATTGAAGGCCTGAAATTGCTTCAAAAAACCAGAAAACCCAAGC
AAGATGATGATAAGAGGGTTATAGCAATACGCCCTATTAGGAGAATTACACATATCTCAGGTACTTTAGAAGATGAAGATGAAGATGAAG
ATAATGATGACATTGTCATGCTAGAGAAAAAAATACGAACATCTAGTATGCCAGAGCAGGCCCATAAAGTCTGTGTCAAAGAGATAAAGA
GACTCAAAAAAATGCCTCAGTCAATGCCAGAATATGCTCTGACTAGAAATTATTTGGAACTTATGGTAGAACTTCCTTGGAACAAAAGTA
CAACTGACCGCCTGGACATTAGGGCAGCCCGGATTCTTCTGGATAATGACCATTACGCCATGGAAAAATTGAAGAAAAGAGTACTGGAAT
ACTTGGCTGTCAGACAGCTCAAAAATAACCTGAAGGGCCCAATCCTATGCTTTGTTGGCCCTCCTGGAGTTGGTAAAACAAGTGTGGGAA
GATCAGTGGCCAAGACTCTAGGTCGAGAGTTCCACAGGATTGCACTTGGAGGAGTATGTGATCAGTCTGACATTCGAGGACACAGGCGCA
CCTATGTTGGCAGCATGCCTGGTCGCATCATCAACGGCTTGAAGACTGTGGGAGTGAACAACCCAGTGTTCCTATTAGATGAGGTTGACA
AACTGGGAAAAAGTCTACAGGGTGATCCAGCAGCAGCTCTGCTTGAGGTGTTGGATCCTGAACAAAACCATAACTTCACAGATCATTATC
TAAATGTGGCCTTTGACCTTTCTCAAGTTCTTTTTATAGCTACTGCCAACACCACTGCTACCATTCCAGCTGCCTTGTTGGACAGAATGG
AGATCATTCAGGTTCCAGGTTATACACAGGAGGAGAAGATAGAGATTGCCCATAGGCACTTGATCCCCAAGCAGCTGGAACAACATGGGC
TGACTCCACAGCAGATTCAGATACCCCAGGTCACCACTCTTGACATCATCACCAGGTATACCAGAGAGGCAGGGGTTCGTTCTCTGGATA
GAAAACTTGGGGCCATTTGCCGAGCTGTGGCCGTGAAGGTGGCAGAAGGACAGCATAAGGAAGCCAAGTTGGACCGTTCTGATGTGACTG
AGAGAGAAGGCAAGCCGATTTTTTCAGTTGATATTCACCCTGACGGGACCAAGTTCGCAACTGGAGGACAAGGGCAGGATTCTGGGAAGG
TTGTGATCTGGAATATGTCTCCAGTCCTCCAGGAGGATGACGAGAAGGATGAAAATATTCCCAAGATGCTTTGCCAGATGGACAATCACT
TAGCATGTGTGAACTGTGTGCGGTGGTCAAACAGTGGGATGTATTTAGCTTCTGGGGGAGATGACAAACTGATTATGGTGTGGAAGCGGG
CTACGTACATCGGCCCCAGCACCGTGTTCGGCTCCAGTGGTAAGCTTGCCAATGTGGAGCAGTGGCGGTGTGTCTCTATCCTCCGGAATC
ATTCAGGCGATGTGATGGATGTAGCATGGTCTCCCCACGATGCCTGGCTAGCCTCATGCAGCGTGGATAACACTGTCGTCATCTGGAATG
CTGTAAAGTTCCCAGAAATTCTAGCTACTCTGAGAGGTCATTCTGGCTTGGTCAAAGGGTTGACATGGGACCCTGTTGGTAAATACATAG
CTTCTCAAGCTGATGACCGCAGCCTAAAGGTGTGGAGGACGCTGGACTGGCAGTTGGAGACCAGCATCACCAAGCCTTTTGATGAGTGTG
GAGGAACGACCCATGTGTTGCGGCTCAGCTGGTCACCTGATGGGCATTACCTGGTGTCTGCCCATGCCATGAACAACTCAGGCCCCACTG
CCCAGATCATCGAACGGGAGGGATGGAAGACCAACATGGACTTTGTTGGGCACCGGAAAGCTGTGACTGTCGTGAAATTCAACCCAAAAA
TCTTCAAAAAGAAGCAGAAGAATGGGAGTTCTGCGAAGCCTAGCTGCCCGTACTGCTGCTGTGCTGTTGGCAGCAAGGACCGCTCGCTTT
CTGTCTGGCTCACATGTCTGAAACGGCCGCTGGTGGTCATCCATGAACTGTTTGACAAATCCATCATGGATATTTCCTGGACTCTGAATG
GGCTGGGCATCTTGGTATGCTCTATGGACGGCTCTGTGGCATTCCTCGACTTCTCCCAGGATGAGCTTGGCGATCCCCTGAGCGAGGAGG
AGAAGAGCCGCATTCACCAGTCCACCTATGGCAAGAGCCTAGCCATCATGACCGAGGCCCAGCTCTCCACAGCCGTCATTGAGAACCCTG
AGATGCTCAAGTACCAGCGAAGGCAGCAGCAGCAGCAGCTGGACCAGAAGAGTGCTGCGACCAGGGAGATGGGCTCAGCCACCTCAGTCG
CAGGCGTTGTCAACGGGGAGAGTCTTGAAGATATCAGGAAGAATCTTTTGAAGAAACAAGTTGAGACTCGGACAGCAGATGGCCGGAGAA
GAATCACGCCTCTCTGCATAGCACAGCTGGACACTGGGGACTTCTCCACGGCATTCTTTAACAGCATCCCCCTCTCGGGCTCCCTGGCGG
GCACCATGCTCTCTTCTCATAGCAGTCCACAGCTACTGCCACTGGACTCCAGTACCCCTAACTCCTTCGGCGCCTCGAAGCCTTGCACAG
AGCCTGTGGTGGCTGCCAGTGCCAGACCTGCAGGCGATTCTGTCAATAAAGACAGTATGAATGCTACCTCTACTCCTGCTGCATTGTCAC
CTTCTGTGTTAACGACCCCGTCCAAGATCGAACCCATGAAAGCGTTTGACTCCCGGTTCACAGAGCGGTCCAAAGCCACACCAGGTGCTC
CTGCCCTGACCAGCATGACTCCGACAGCTGTGGAAAGGGATGTTCACAGACAGGTGGTTGTGGTGAAAGAAGAGTCTCTACACTCCATCC
TGGCAGGAAGTGATATGACGGTATCACAGATCTTGCTGACGCAGCATGGAATCCCAGTAATGAACCTGTCCGATGGGAAGGCGTACTGCT
TTAATCCGTCACTTTCCACATGGAACCTGGTTTCTGACAAGCAGGACTCACTGGCTCAGTGTGCAGACTTTAGGAGCAGCCTGCCATCCC
AGGACGCCATGCTGTGCTCAGGACCGTTAGCCATAATCCAGGGCCGCACCTCCAACTCGGGAAGGCAGGCTGCCCGGCTCTTCTCCGTGC
CTCATGTGGTGCAGCAAGAGACCACCCTGGCCTACCTAGAGAACCAGGTGGCAGCAGCACTCACCCTGCAGTCCAGCCACGAGTACCGCC
ATTGGCTCCTCGTCTACGCACGGTACCTCGTAAACGAAGGGTTTGAATACCGACTTCGAGAAATATGCAAGGACTTACTGGGTCCGGTTC
ACTACTCCACTGGAAGCCAGTGGGAGTCAACAGTAGTGGGTCTGCGGAAGAGGGAGCTGCTGAAGGAGCTGCTACCAGTCATCGGGCAGA
ACCTCCGATTCCAGCGCCTCTTCACCGAGTGTCAGGAACAGCTCGACATCCTGAGGGACAAGTAGCCTGCCCCAGCCTGCCCTGGCTGCA
GCAAGGGCAGGGCCACACTCTCGCCGCTGATGACATGCAGGACCGCCTCTCACCTGACCAGGCTGTAGGGGGAGGAGACACTGGCAGGAG
ATGTGCTGTCCTGCACCAGCGCCAGCCCAGCTCCCTGGGCAGATGTGCCCTGTGTCCTGGGTCTGACATTGCCTCAGGAGGGGGAAGCTC
ATCCCTCCCTCCAAGCCCCCGATGCGGAGCTAGGGCTGGAGCTCTGCCCAGGTGCCCTGGGGCCAGCAAGGCAGTCCCAGGCCTGCCGTC
TCCAGCACGGCCCCAAGGTGGACACTAGCCCCTGCTGCTGCAGGCACCATGCTGCTTCAGCAGTGACGATTGAGCCATTTGTGAGAGAGA
ATCCGGAAGCGTTAGGTATTACAGCAGACTGACCTAAGACCTATGTAAAAGGAAAGCTGTTCCAACACACGGACTATTTTTGTACTAGAA
TTTGCTAACTTGTAATATTGAATTTCCTTTGGCCGATAATCAGGATTTCCCTATAAGTCACTTGGACATTGGTCACTTGTAGGAAATTTA
AACTCTAATTATGACAGCTACACTGAAAAATAATTGTACTGAAATTAACTTGTCTATCTTCATTTGGTTTTAATTTTTAAATGTTTGTAA

>In-frame_LONP2_ENST00000535754_chr16_48337216_+_HIRA_ENST00000263208_chr22_19398301_-_5478nt
GGGGCAGCTGTCTGTCTGGCTCTTTTTGACAGCCCCCAGTGCGAAAGGCTGCCAGCATGTCATCAGTGAGCCCCATCCAGATCCCCAGTC
GCCTCCCGCTGCTGCTCACCCACGAGGGCGTCCTGCTGCCCGGCTCCACCATGCGCACCAGCGTGGACTCGGCCCGCAACCTGCAGCTGG
TGCGGAGCCGCCTTCTGAAGGGCACGTCGCTGCAAAGCACCATCCTGGGCGTCATCCCCAACACGCCTGACCCCGCCAGCGACGCGCAGG
ACCTGCCGCCGCTGCACAGGATTGGCACAGCTGCACTGGCCGTTCAGGTTGTGGGCAGTAACTGGCCCAAGCCCCACTACACTCTGTTGA
TTACAGGCCTATGCCGTTTCCAGATTGTACAGGTCTTAAAAGAGAAGCCATATCCCATTGCTGAAGTGGAGCAGTTGGACCGACTTGAGG
AGTTTCCCAACACCTGTAAAATGAGGGAGGAGCTAGGAGAACTATCAGAGCAGTTTTACAAATATGCAGTACAAATTTTAGATGCTGTGA
GCCTAGAGGAGCGGTTCAAGATGACTATACCACTGCTTGTCAGACAAATTGAAGGCCTGAAATTGCTTCAAAAAACCAGAAAACCCAAGC
AAGATGATGATAAGAGGGTTATAGCAATACGCCCTATTAGGAGAATTACACATATCTCAGGTACTTTAGAAGATGAAGATGAAGATGAAG
ATAATGATGACATTGTCATGCTAGAGAAAAAAATACGAACATCTAGTATGCCAGAGCAGGCCCATAAAGTCTGTGTCAAAGAGATAAAGA
GACTCAAAAAAATGCCTCAGTCAATGCCAGAATATGCTCTGACTAGAAATTATTTGGAACTTATGGTAGAACTTCCTTGGAACAAAAGTA
CAACTGACCGCCTGGACATTAGGGCAGCCCGGATTCTTCTGGATAATGACCATTACGCCATGGAAAAATTGAAGAAAAGAGTACTGGAAT
ACTTGGCTGTCAGACAGCTCAAAAATAACCTGAAGGGCCCAATCCTATGCTTTGTTGGCCCTCCTGGAGTTGGTAAAACAAGTGTGGGAA
GATCAGTGGCCAAGACTCTAGGTCGAGAGTTCCACAGGATTGCACTTGGAGGAGTATGTGATCAGTCTGACATTCGAGGACACAGGCGCA
CCTATGTTGGCAGCATGCCTGGTCGCATCATCAACGGCTTGAAGACTGTGGGAGTGAACAACCCAGTGTTCCTATTAGATGAGGTTGACA
AACTGGGAAAAAGTCTACAGGGTGATCCAGCAGCAGCTCTGCTTGAGGTGTTGGATCCTGAACAAAACCATAACTTCACAGATCATTATC
TAAATGTGGCCTTTGACCTTTCTCAAGTTCTTTTTATAGCTACTGCCAACACCACTGCTACCATTCCAGCTGCCTTGTTGGACAGAATGG
AGATCATTCAGGTTCCAGGTTATACACAGGAGGAGAAGATAGAGATTGCCCATAGGCACTTGATCCCCAAGCAGCTGGAACAACATGGGC
TGACTCCACAGCAGATTCAGATACCCCAGGTCACCACTCTTGACATCATCACCAGGTATACCAGAGAGGCAGGGGTTCGTTCTCTGGATA
GAAAACTTGGGGCCATTTGCCGAGCTGTGGCCGTGAAGGTGGCAGAAGGACAGCATAAGGAAGCCAAGTTGGACCGTTCTGATGTGACTG
AGAGAGAAGGCAAGCCGATTTTTTCAGTTGATATTCACCCTGACGGGACCAAGTTCGCAACTGGAGGACAAGGGCAGGATTCTGGGAAGG
TTGTGATCTGGAATATGTCTCCAGTCCTCCAGGAGGATGACGAGAAGGATGAAAATATTCCCAAGATGCTTTGCCAGATGGACAATCACT
TAGCATGTGTGAACTGTGTGCGGTGGTCAAACAGTGGGATGTATTTAGCTTCTGGGGGAGATGACAAACTGATTATGGTGTGGAAGCGGG
CTACGTACATCGGCCCCAGCACCGTGTTCGGCTCCAGTGGTAAGCTTGCCAATGTGGAGCAGTGGCGGTGTGTCTCTATCCTCCGGAATC
ATTCAGGCGATGTGATGGATGTAGCATGGTCTCCCCACGATGCCTGGCTAGCCTCATGCAGCGTGGATAACACTGTCGTCATCTGGAATG
CTGTAAAGTTCCCAGAAATTCTAGCTACTCTGAGAGGTCATTCTGGCTTGGTCAAAGGGTTGACATGGGACCCTGTTGGTAAATACATAG
CTTCTCAAGCTGATGACCGCAGCCTAAAGGTGTGGAGGACGCTGGACTGGCAGTTGGAGACCAGCATCACCAAGCCTTTTGATGAGTGTG
GAGGAACGACCCATGTGTTGCGGCTCAGCTGGTCACCTGATGGGCATTACCTGGTGTCTGCCCATGCCATGAACAACTCAGGCCCCACTG
CCCAGATCATCGAACGGGAGGGATGGAAGACCAACATGGACTTTGTTGGGCACCGGAAAGCTGTGACTGTCGTGAAATTCAACCCAAAAA
TCTTCAAAAAGAAGCAGAAGAATGGGAGTTCTGCGAAGCCTAGCTGCCCGTACTGCTGCTGTGCTGTTGGCAGCAAGGACCGCTCGCTTT
CTGTCTGGCTCACATGTCTGAAACGGCCGCTGGTGGTCATCCATGAACTGTTTGACAAATCCATCATGGATATTTCCTGGACTCTGAATG
GGCTGGGCATCTTGGTATGCTCTATGGACGGCTCTGTGGCATTCCTCGACTTCTCCCAGGATGAGCTTGGCGATCCCCTGAGCGAGGAGG
AGAAGAGCCGCATTCACCAGTCCACCTATGGCAAGAGCCTAGCCATCATGACCGAGGCCCAGCTCTCCACAGCCGTCATTGAGAACCCTG
AGATGCTCAAGTACCAGCGAAGGCAGCAGCAGCAGCAGCTGGACCAGAAGAGTGCTGCGACCAGGGAGATGGGCTCAGCCACCTCAGTCG
CAGGCGTTGTCAACGGGGAGAGTCTTGAAGATATCAGGAAGAATCTTTTGAAGAAACAAGTTGAGACTCGGACAGCAGATGGCCGGAGAA
GAATCACGCCTCTCTGCATAGCACAGCTGGACACTGGGGACTTCTCCACGGCATTCTTTAACAGCATCCCCCTCTCGGGCTCCCTGGCGG
GCACCATGCTCTCTTCTCATAGCAGTCCACAGCTACTGCCACTGGACTCCAGTACCCCTAACTCCTTCGGCGCCTCGAAGCCTTGCACAG
AGCCTGTGGTGGCTGCCAGTGCCAGACCTGCAGGCGATTCTGTCAATAAAGACAGTATGAATGCTACCTCTACTCCTGCTGCATTGTCAC
CTTCTGTGTTAACGACCCCGTCCAAGATCGAACCCATGAAAGCGTTTGACTCCCGGTTCACAGAGCGGTCCAAAGCCACACCAGGTGCTC
CTGCCCTGACCAGCATGACTCCGACAGCTGTGGAAAGGTTAAAAGAGCAGAACCTTGTGAAAGAGCTGAGGCCCCGAGACCTCCTGGAGA
GCAGCAGTGACAGCGATGAGAAAGTCCCTTTGGCTAAGGCTTCCTCACTGTCCAAGCGAAAACTTGAGCTTGAGGTAGAGACAGTAGAGA
AGAAGAAGAAAGGGCGGCCTCGGAAGGACTCTCGTCTCATGCCTGTGTCTCTGTCTGTCCAGTCTCCAGCTGCCCTAACCGCAGAGAAGG
AGGCCATGTGTCTGTCTGCACCAGCACTTGCACTGAAGCTGCCAATTCCAAGCCCCCAGAGAGCATTCACCCTCCAGGTCAGCTCCGATC
CTTCCATGTACATTGAGGTGGAGAATGAAGTGACAGTGGTGGGGGGCGTGAAGCTGAGCCGCCTGAAGTGCAACCGGGAAGGGAAGGAGT
GGGAGACGGTACTCACCAGCCGGATCCTCACTGCTGCGGGCAGCTGTGACGTGGTGTGTGTCGCCTGTGAAAAAAGGATGCTGTCAGTGT
TCTCCACCTGTGGTCGCCGTCTCCTCTCTCCCATCCTCCTGCCATCCCCGATCTCTACTTTGCATTGCACAGGCTCCTACGTCATGGCGC
TCACCGCTGCAGCCACACTCTCTGTCTGGGATGTTCACAGACAGGTGGTTGTGGTGAAAGAAGAGTCTCTACACTCCATCCTGGCAGGAA
GTGATATGACGGTATCACAGATCTTGCTGACGCAGCATGGAATCCCAGTAATGAACCTGTCCGATGGGAAGGCGTACTGCTTTAATCCGT
CACTTTCCACATGGAACCTGGTTTCTGACAAGCAGGACTCACTGGCTCAGTGTGCAGACTTTAGGAGCAGCCTGCCATCCCAGGACGCCA
TGCTGTGCTCAGGACCGTTAGCCATAATCCAGGGCCGCACCTCCAACTCGGGAAGGCAGGCTGCCCGGCTCTTCTCCGTGCCTCATGTGG
TGCAGCAAGAGACCACCCTGGCCTACCTAGAGAACCAGGTGGCAGCAGCACTCACCCTGCAGTCCAGCCACGAGTACCGCCATTGGCTCC
TCGTCTACGCACGGTACCTCGTAAACGAAGGGTTTGAATACCGACTTCGAGAAATATGCAAGGACTTACTGGGTCCGGTTCACTACTCCA
CTGGAAGCCAGTGGGAGTCAACAGTAGTGGGTCTGCGGAAGAGGGAGCTGCTGAAGGAGCTGCTACCAGTCATCGGGCAGAACCTCCGAT
TCCAGCGCCTCTTCACCGAGTGTCAGGAACAGCTCGACATCCTGAGGGACAAGTAGCCTGCCCCAGCCTGCCCTGGCTGCAGCAAGGGCA
GGGCCACACTCTCGCCGCTGATGACATGCAGGACCGCCTCTCACCTGACCAGGCTGTAGGGGGAGGAGACACTGGCAGGAGATGTGCTGT
CCTGCACCAGCGCCAGCCCAGCTCCCTGGGCAGATGTGCCCTGTGTCCTGGGTCTGACATTGCCTCAGGAGGGGGAAGCTCATCCCTCCC
TCCAAGCCCCCGATGCGGAGCTAGGGCTGGAGCTCTGCCCAGGTGCCCTGGGGCCAGCAAGGCAGTCCCAGGCCTGCCGTCTCCAGCACG
GCCCCAAGGTGGACACTAGCCCCTGCTGCTGCAGGCACCATGCTGCTTCAGCAGTGACGATTGAGCCATTTGTGAGAGAGAATCCGGAAG
CGTTAGGTATTACAGCAGACTGACCTAAGACCTATGTAAAAGGAAAGCTGTTCCAACACACGGACTATTTTTGTACTAGAATTTGCTAAC
TTGTAATATTGAATTTCCTTTGGCCGATAATCAGGATTTCCCTATAAGTCACTTGGACATTGGTCACTTGTAGGAAATTTAAACTCTAAT
TATGACAGCTACACTGAAAAATAATTGTACTGAAATTAACTTGTCTATCTTCATTTGGTTTTAATTTTTAAATGTTTGTAAAAAGAGACT


Top

FusionGenePPI for LONP2_HIRA


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LONP2AMOT, ELAVL1, PEX5, WWOX, OS9, RSPH9, IL17A, DCN, FBXW11, MTMR10, PCDHA12, IL1R2, DKK3, TMOD3, CDC16, MAP7D2, PCDHA4, PCDHA9, SUCLA2, TRIM25HIRAUPF1, NFU1, HIRIP3, HIST1H2BK, HIST1H2BD, H3F3A, ASF1A, ASF1B, MEF2D, CABIN1, DNAJA2, UBN1, POLR2A, ELAVL1, HIST1H4F, HIST2H3C, HNRNPD, PML, CUL3, MOV10, NXF1, UBE2I, HIST1H3A, MEF2A, FOXK2, NFATC2, TFAP4, CDX1, XAGE1B, TEAD2, SP4, ZBTB48, MECP2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025421_479121018ASF1A
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021421_47912811ASF1A
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025421_729121018CCNA1
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021421_72912811CCNA1
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025593_826121018histone H2B
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021593_82612811histone H2B
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025738_1017121018histone H4
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021738_101712811histone H4
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025594_739121018PAX3
TgeneHIRAchr16:48337216chr22:19398301ENST00000263208-025740_828121018PAX3
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021594_73912811PAX3
TgeneHIRAchr16:48337216chr22:19398301ENST00000340170-021740_82812811PAX3


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LONP2_HIRA


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LONP2_HIRA


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource