FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19890

FusionGeneSummary for LMF1_CCDC154

check button Fusion gene summary
Fusion gene informationFusion gene name: LMF1_CCDC154
Fusion gene ID: 19890
HgeneTgene
Gene symbol

LMF1

CCDC154

Gene ID

64788

645811

Gene namelipase maturation factor 1coiled-coil domain containing 154
SynonymsC16orf26|HMFN1876|JFP11|TMEM112|TMEM112AC16orf29
Cytomap

16p13.3

16p13.3

Type of geneprotein-codingprotein-coding
Descriptionlipase maturation factor 1transmembrane protein 112coiled-coil domain-containing protein 154
Modification date2018052320180519
UniProtAcc

Q96S06

A6NI56

Ensembl transtripts involved in fusion geneENST00000262301, ENST00000399843, 
ENST00000543238, ENST00000568897, 
ENST00000568268, ENST00000539379, 
ENST00000409671, ENST00000389176, 
Fusion gene scores* DoF score2 X 2 X 2=81 X 1 X 1=1
# samples 21
** MAII scorelog2(2/8*10)=1.32192809488736log2(1/1*10)=3.32192809488736
Context

PubMed: LMF1 [Title/Abstract] AND CCDC154 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-DU-A6S2-01ALMF1chr16

960931

-CCDC154chr16

1489127

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000262301ENST00000409671LMF1chr16

960931

-CCDC154chr16

1489127

-
In-frameENST00000262301ENST00000389176LMF1chr16

960931

-CCDC154chr16

1489127

-
In-frameENST00000399843ENST00000409671LMF1chr16

960931

-CCDC154chr16

1489127

-
In-frameENST00000399843ENST00000389176LMF1chr16

960931

-CCDC154chr16

1489127

-
intron-3CDSENST00000543238ENST00000409671LMF1chr16

960931

-CCDC154chr16

1489127

-
intron-3CDSENST00000543238ENST00000389176LMF1chr16

960931

-CCDC154chr16

1489127

-
In-frameENST00000568897ENST00000409671LMF1chr16

960931

-CCDC154chr16

1489127

-
In-frameENST00000568897ENST00000389176LMF1chr16

960931

-CCDC154chr16

1489127

-
intron-3CDSENST00000568268ENST00000409671LMF1chr16

960931

-CCDC154chr16

1489127

-
intron-3CDSENST00000568268ENST00000389176LMF1chr16

960931

-CCDC154chr16

1489127

-
3UTR-3CDSENST00000539379ENST00000409671LMF1chr16

960931

-CCDC154chr16

1489127

-
3UTR-3CDSENST00000539379ENST00000389176LMF1chr16

960931

-CCDC154chr16

1489127

-

Top

FusionProtFeatures for LMF1_CCDC154


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LMF1

Q96S06

CCDC154

A6NI56

Involved in the maturation of specific proteins in theendoplasmic reticulum. Required for maturation and transport ofactive lipoprotein lipase (LPL) through the secretory pathway.Each LMF1 molecule chaperones 50 or more molecules of LPL.{ECO:0000250|UniProtKB:Q3U3R4, ECO:0000269|PubMed:24909692}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLMF1chr16:960931chr16:1489127ENST00000262301-411152_207221568Topological domainCytoplasmic
HgeneLMF1chr16:960931chr16:1489127ENST00000262301-4111_49221568Topological domainCytoplasmic
HgeneLMF1chr16:960931chr16:1489127ENST00000262301-41173_127221568Topological domainLumenal
HgeneLMF1chr16:960931chr16:1489127ENST00000262301-411128_151221568TransmembraneHelical
HgeneLMF1chr16:960931chr16:1489127ENST00000262301-411208_221221568TransmembraneHelical
HgeneLMF1chr16:960931chr16:1489127ENST00000262301-41150_72221568TransmembraneHelical
TgeneCCDC154chr16:960931chr16:1489127ENST00000389176-517393_419225675Coiled coilOntology_term=ECO:0000255
TgeneCCDC154chr16:960931chr16:1489127ENST00000389176-517466_530225675Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLMF1chr16:960931chr16:1489127ENST00000262301-411222_292221568Topological domainLumenal
HgeneLMF1chr16:960931chr16:1489127ENST00000262301-411322_367221568Topological domainCytoplasmic
HgeneLMF1chr16:960931chr16:1489127ENST00000262301-411389_567221568Topological domainLumenal
HgeneLMF1chr16:960931chr16:1489127ENST00000262301-411293_321221568TransmembraneHelical
HgeneLMF1chr16:960931chr16:1489127ENST00000262301-411368_388221568TransmembraneHelical
TgeneCCDC154chr16:960931chr16:1489127ENST00000389176-517215_302225675Coiled coilOntology_term=ECO:0000255
TgeneCCDC154chr16:960931chr16:1489127ENST00000389176-51776_182225675Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for LMF1_CCDC154


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LMF1_ENST00000262301_chr16_960931_-_CCDC154_ENST00000409671_chr16_1489127_-_664aa
MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFWLTRIVLLKALAFVYFVAFLVAFHQNKQLIGDRGLLPCRVF
LKNFQQYFQDRTSWEVFSYMPTILWLMDWSDMNSNLDLLALLGLGISSFVLITGCANMLLMAALWGLYMSLVNVGHVWYSFGWESQLLET
GFLGIFLCPLWTLSRLPQHTPTSRIVLWGFRWLIFRIMLGAAQVTKLGEEVSLRFLKREAKLCGFLQKSFLALEKRMKASESSRLKLEGS
LRGELESRWEKLRGLMEERLRALQGQHEESHLLEQCQGLDAAVAQLTKFVQQNQASLNRVLLAEEKAWDAKGRLEESRAGELAAYVQENL
EAAQLAGELARQEMHGELVLLREKSRALEASVAQLAGQLKELSGHLPALSSRLDLQEQMLGLRLSEAKTEWEGAERKSLEDLARWRKEVT
EHLRGVREKVDGLPQQIESVSDKCLLHKSDSDLRISAEGKAREFKVGALRQELATLLSSVQLLKEDNPGRKIAEMQGKLATFQNQIMKLE
NCVQANKTIQNLRFNTEARLRTQEMATLWESVLRLWSEEGPRTPLGSWKALPSLVRPRVFIKDMAPGKVVPMNCWGVYQAVRWLRWKASL

>In-frame_LMF1_ENST00000262301_chr16_960931_-_CCDC154_ENST00000389176_chr16_1489127_-_671aa
MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFWLTRIVLLKALAFVYFVAFLVAFHQNKQLIGDRGLLPCRVF
LKNFQQYFQDRTSWEVFSYMPTILWLMDWSDMNSNLDLLALLGLGISSFVLITGCANMLLMAALWGLYMSLVNVGHVWYSFGWESQLLET
GFLGIFLCPLWTLSRLPQHTPTSRIVLWGFRWLIFRIMLGAAQVTKLGEEVSLRFLKREAKLCGFLQKSFLALEKRMKASESSRLKLEGS
LRGELESRWEKLRGLMEERLRALQGQHEVGPGGRRAEESHLLEQCQGLDAAVAQLTKFVQQNQASLNRVLLAEEKAWDAKGRLEESRAGE
LAAYVQENLEAAQLAGELARQEMHGELVLLREKSRALEASVAQLAGQLKELSGHLPALSSRLDLQEQMLGLRLSEAKTEWEGAERKSLED
LARWRKEVTEHLRGVREKVDGLPQQIESVSDKCLLHKSDSDLRISAEGKAREFKVGALRQELATLLSSVQLLKEDNPGRKIAEMQGKLAT
NQIMKLENCVQANKTIQNLRFNTEARLRTQEMATLWESVLRLWSEEGPRTPLGSWKALPSLVRPRVFIKDMAPGKVVPMNCWGVYQAVRW

>In-frame_LMF1_ENST00000399843_chr16_960931_-_CCDC154_ENST00000409671_chr16_1489127_-_664aa
MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFWLTRIVLLKALAFVYFVAFLVAFHQNKQLIGDRGLLPCRVF
LKNFQQYFQDRTSWEVFSYMPTILWLMDWSDMNSNLDLLALLGLGISSFVLITGCANMLLMAALWGLYMSLVNVGHVWYSFRWESQLLET
GFLGIFLCPLWTLSRLPQHTPTSRIVLWGFRWLIFRIMLGAAQVTKLGEEVSLRFLKREAKLCGFLQKSFLALEKRMKASESSRLKLEGS
LRGELESRWEKLRGLMEERLRALQGQHEESHLLEQCQGLDAAVAQLTKFVQQNQASLNRVLLAEEKAWDAKGRLEESRAGELAAYVQENL
EAAQLAGELARQEMHGELVLLREKSRALEASVAQLAGQLKELSGHLPALSSRLDLQEQMLGLRLSEAKTEWEGAERKSLEDLARWRKEVT
EHLRGVREKVDGLPQQIESVSDKCLLHKSDSDLRISAEGKAREFKVGALRQELATLLSSVQLLKEDNPGRKIAEMQGKLATFQNQIMKLE
NCVQANKTIQNLRFNTEARLRTQEMATLWESVLRLWSEEGPRTPLGSWKALPSLVRPRVFIKDMAPGKVVPMNCWGVYQAVRWLRWKASL

>In-frame_LMF1_ENST00000399843_chr16_960931_-_CCDC154_ENST00000389176_chr16_1489127_-_671aa
MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFWLTRIVLLKALAFVYFVAFLVAFHQNKQLIGDRGLLPCRVF
LKNFQQYFQDRTSWEVFSYMPTILWLMDWSDMNSNLDLLALLGLGISSFVLITGCANMLLMAALWGLYMSLVNVGHVWYSFRWESQLLET
GFLGIFLCPLWTLSRLPQHTPTSRIVLWGFRWLIFRIMLGAAQVTKLGEEVSLRFLKREAKLCGFLQKSFLALEKRMKASESSRLKLEGS
LRGELESRWEKLRGLMEERLRALQGQHEVGPGGRRAEESHLLEQCQGLDAAVAQLTKFVQQNQASLNRVLLAEEKAWDAKGRLEESRAGE
LAAYVQENLEAAQLAGELARQEMHGELVLLREKSRALEASVAQLAGQLKELSGHLPALSSRLDLQEQMLGLRLSEAKTEWEGAERKSLED
LARWRKEVTEHLRGVREKVDGLPQQIESVSDKCLLHKSDSDLRISAEGKAREFKVGALRQELATLLSSVQLLKEDNPGRKIAEMQGKLAT
NQIMKLENCVQANKTIQNLRFNTEARLRTQEMATLWESVLRLWSEEGPRTPLGSWKALPSLVRPRVFIKDMAPGKVVPMNCWGVYQAVRW

>In-frame_LMF1_ENST00000568897_chr16_960931_-_CCDC154_ENST00000409671_chr16_1489127_-_447aa
MLGAAQVTKLGEEVSLRFLKREAKLCGFLQKSFLALEKRMKASESSRLKLEGSLRGELESRWEKLRGLMEERLRALQGQHEESHLLEQCQ
GLDAAVAQLTKFVQQNQASLNRVLLAEEKAWDAKGRLEESRAGELAAYVQENLEAAQLAGELARQEMHGELVLLREKSRALEASVAQLAG
QLKELSGHLPALSSRLDLQEQMLGLRLSEAKTEWEGAERKSLEDLARWRKEVTEHLRGVREKVDGLPQQIESVSDKCLLHKSDSDLRISA
EGKAREFKVGALRQELATLLSSVQLLKEDNPGRKIAEMQGKLATFQNQIMKLENCVQANKTIQNLRFNTEARLRTQEMATLWESVLRLWS

>In-frame_LMF1_ENST00000568897_chr16_960931_-_CCDC154_ENST00000389176_chr16_1489127_-_454aa
MLGAAQVTKLGEEVSLRFLKREAKLCGFLQKSFLALEKRMKASESSRLKLEGSLRGELESRWEKLRGLMEERLRALQGQHEVGPGGRRAE
ESHLLEQCQGLDAAVAQLTKFVQQNQASLNRVLLAEEKAWDAKGRLEESRAGELAAYVQENLEAAQLAGELARQEMHGELVLLREKSRAL
EASVAQLAGQLKELSGHLPALSSRLDLQEQMLGLRLSEAKTEWEGAERKSLEDLARWRKEVTEHLRGVREKVDGLPQQIESVSDKCLLHK
SDSDLRISAEGKAREFKVGALRQELATLLSSVQLLKEDNPGRKIAEMQGKLATNQIMKLENCVQANKTIQNLRFNTEARLRTQEMATLWE
SVLRLWSEEGPRTPLGSWKALPSLVRPRVFIKDMAPGKVVPMNCWGVYQAVRWLRWKASLIKLRALRRPGGVLEKPHSQEQVQQLTPSLF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LMF1_ENST00000262301_chr16_960931_-_CCDC154_ENST00000409671_chr16_1489127_-_1992nt
ATGCGCCCTGACAGCCCAACAATGGCGGCGCCCGCGGAGTCGCTGAGGAGGCGGAAGACTGGGTACTCGGATCCGGAGCCTGAGTCGCCG
CCCGCGCCGGGGCGTGGCCCCGCAGGCTCTCCGGCCCATCTCCACACGGGCACCTTCTGGCTGACCCGGATCGTGCTCCTGAAGGCCCTA
GCCTTCGTGTACTTCGTGGCATTCCTGGTGGCTTTCCATCAGAACAAGCAGCTCATCGGTGACAGGGGGCTGCTTCCCTGCAGAGTGTTC
CTGAAGAACTTCCAGCAGTACTTCCAGGACAGGACGAGCTGGGAAGTCTTCAGCTACATGCCCACCATCCTCTGGCTGATGGACTGGTCA
GACATGAACTCCAACCTGGACTTGCTGGCTCTTCTCGGACTGGGCATCTCGTCTTTCGTACTGATCACGGGCTGCGCCAACATGCTTCTC
ATGGCTGCCCTGTGGGGCCTCTACATGTCCCTGGTTAATGTGGGCCATGTCTGGTACTCTTTCGGATGGGAGTCCCAGCTTCTGGAGACG
GGGTTCCTGGGGATCTTCCTGTGCCCTCTGTGGACGCTGTCAAGGCTGCCCCAGCATACCCCCACATCCCGGATTGTCCTGTGGGGCTTC
CGGTGGCTGATCTTCAGGATCATGCTTGGAGCAGCCCAGGTGACCAAGCTCGGCGAAGAGGTGAGCCTGCGCTTCCTGAAGAGGGAGGCC
AAGCTGTGCGGCTTCCTGCAGAAGAGCTTCCTGGCCCTGGAGAAGAGAATGAAGGCCTCGGAGAGCTCACGGCTGAAGCTGGAGGGCAGC
CTGCGGGGCGAGCTGGAGAGCCGGTGGGAGAAGCTTCGGGGGCTGATGGAGGAGCGCCTGCGGGCCCTGCAGGGGCAGCATGAGGAGAGC
CACCTCCTGGAGCAGTGCCAGGGCCTGGATGCTGCCGTGGCCCAGCTGACCAAGTTTGTGCAGCAGAACCAGGCGTCGCTGAACCGTGTC
CTACTGGCCGAGGAGAAAGCCTGGGACGCCAAGGGGCGCTTGGAGGAAAGCCGGGCTGGGGAGCTGGCCGCCTATGTGCAGGAGAACCTG
GAGGCCGCACAGCTGGCTGGCGAGCTGGCCCGGCAGGAGATGCATGGAGAGCTGGTGCTGCTCCGAGAGAAGAGCCGGGCTCTGGAGGCA
TCCGTGGCGCAGCTGGCCGGGCAGTTAAAGGAGCTGAGTGGCCATCTCCCGGCTCTGAGCAGCCGGCTCGATCTGCAGGAGCAGATGCTG
GGCCTCAGGCTGTCCGAGGCAAAGACCGAATGGGAAGGTGCAGAGAGGAAGTCCCTGGAGGACCTGGCCAGGTGGCGGAAGGAGGTGACC
GAACACCTGCGAGGGGTGCGGGAGAAGGTGGATGGCCTCCCCCAGCAGATAGAGAGTGTCTCCGACAAGTGCCTGCTTCATAAGAGCGAC
TCAGACCTCAGGATTTCCGCCGAAGGCAAGGCCAGGGAGTTCAAGGTTGGGGCCCTGCGGCAGGAGCTGGCCACGCTACTATCATCCGTG
CAGCTGCTAAAGGAAGACAACCCTGGGCGGAAGATCGCGGAGATGCAGGGCAAGCTGGCCACGTTTCAGAACCAAATAATGAAGCTGGAA
AACTGCGTCCAGGCCAACAAGACCATCCAGAACCTCAGGTTCAACACTGAGGCCCGGCTGCGCACGCAGGAGATGGCCACCCTGTGGGAG
AGTGTGCTCCGGCTGTGGAGTGAGGAGGGCCCGCGGACGCCGCTGGGCAGCTGGAAGGCGCTCCCATCCCTGGTGAGGCCGCGGGTCTTC
ATCAAGGACATGGCGCCTGGCAAGGTGGTGCCCATGAACTGCTGGGGCGTGTACCAGGCTGTGAGGTGGCTGCGCTGGAAGGCGTCCCTC
ATAAAGCTCAGGGCCCTGCGGAGGCCAGGAGGGGTCCTGGAGAAGCCCCACAGCCAGGAGCAGGTGCAGCAGCTCACACCCTCACTGTTT

>In-frame_LMF1_ENST00000262301_chr16_960931_-_CCDC154_ENST00000389176_chr16_1489127_-_2013nt
ATGCGCCCTGACAGCCCAACAATGGCGGCGCCCGCGGAGTCGCTGAGGAGGCGGAAGACTGGGTACTCGGATCCGGAGCCTGAGTCGCCG
CCCGCGCCGGGGCGTGGCCCCGCAGGCTCTCCGGCCCATCTCCACACGGGCACCTTCTGGCTGACCCGGATCGTGCTCCTGAAGGCCCTA
GCCTTCGTGTACTTCGTGGCATTCCTGGTGGCTTTCCATCAGAACAAGCAGCTCATCGGTGACAGGGGGCTGCTTCCCTGCAGAGTGTTC
CTGAAGAACTTCCAGCAGTACTTCCAGGACAGGACGAGCTGGGAAGTCTTCAGCTACATGCCCACCATCCTCTGGCTGATGGACTGGTCA
GACATGAACTCCAACCTGGACTTGCTGGCTCTTCTCGGACTGGGCATCTCGTCTTTCGTACTGATCACGGGCTGCGCCAACATGCTTCTC
ATGGCTGCCCTGTGGGGCCTCTACATGTCCCTGGTTAATGTGGGCCATGTCTGGTACTCTTTCGGATGGGAGTCCCAGCTTCTGGAGACG
GGGTTCCTGGGGATCTTCCTGTGCCCTCTGTGGACGCTGTCAAGGCTGCCCCAGCATACCCCCACATCCCGGATTGTCCTGTGGGGCTTC
CGGTGGCTGATCTTCAGGATCATGCTTGGAGCAGCCCAGGTGACCAAGCTCGGCGAAGAGGTGAGCCTGCGCTTCCTGAAGAGGGAGGCC
AAGCTGTGCGGCTTCCTGCAGAAGAGCTTCCTGGCCCTGGAGAAGAGAATGAAGGCCTCGGAGAGCTCACGGCTGAAGCTGGAGGGCAGC
CTGCGGGGCGAGCTGGAGAGCCGGTGGGAGAAGCTTCGGGGGCTGATGGAGGAGCGCCTGCGGGCCCTGCAGGGGCAGCATGAGGTGGGG
CCGGGCGGGCGGCGGGCAGAGGAGAGCCACCTCCTGGAGCAGTGCCAGGGCCTGGATGCTGCCGTGGCCCAGCTGACCAAGTTTGTGCAG
CAGAACCAGGCGTCGCTGAACCGTGTCCTACTGGCCGAGGAGAAAGCCTGGGACGCCAAGGGGCGCTTGGAGGAAAGCCGGGCTGGGGAG
CTGGCCGCCTATGTGCAGGAGAACCTGGAGGCCGCACAGCTGGCTGGCGAGCTGGCCCGGCAGGAGATGCATGGAGAGCTGGTGCTGCTC
CGAGAGAAGAGCCGGGCTCTGGAGGCATCCGTGGCGCAGCTGGCCGGGCAGTTAAAGGAGCTGAGTGGCCATCTCCCGGCTCTGAGCAGC
CGGCTCGATCTGCAGGAGCAGATGCTGGGCCTCAGGCTGTCCGAGGCAAAGACCGAATGGGAAGGTGCAGAGAGGAAGTCCCTGGAGGAC
CTGGCCAGGTGGCGGAAGGAGGTGACCGAACACCTGCGAGGGGTGCGGGAGAAGGTGGATGGCCTCCCCCAGCAGATAGAGAGTGTCTCC
GACAAGTGCCTGCTTCATAAGAGCGACTCAGACCTCAGGATTTCCGCCGAAGGCAAGGCCAGGGAGTTCAAGGTTGGGGCCCTGCGGCAG
GAGCTGGCCACGCTACTATCATCCGTGCAGCTGCTAAAGGAAGACAACCCTGGGCGGAAGATCGCGGAGATGCAGGGCAAGCTGGCCACG
AACCAAATAATGAAGCTGGAAAACTGCGTCCAGGCCAACAAGACCATCCAGAACCTCAGGTTCAACACTGAGGCCCGGCTGCGCACGCAG
GAGATGGCCACCCTGTGGGAGAGTGTGCTCCGGCTGTGGAGTGAGGAGGGCCCGCGGACGCCGCTGGGCAGCTGGAAGGCGCTCCCATCC
CTGGTGAGGCCGCGGGTCTTCATCAAGGACATGGCGCCTGGCAAGGTGGTGCCCATGAACTGCTGGGGCGTGTACCAGGCTGTGAGGTGG
CTGCGCTGGAAGGCGTCCCTCATAAAGCTCAGGGCCCTGCGGAGGCCAGGAGGGGTCCTGGAGAAGCCCCACAGCCAGGAGCAGGTGCAG

>In-frame_LMF1_ENST00000399843_chr16_960931_-_CCDC154_ENST00000409671_chr16_1489127_-_1992nt
ATGCGCCCTGACAGCCCAACAATGGCGGCGCCCGCGGAGTCGCTGAGGAGGCGGAAGACTGGGTACTCGGATCCGGAGCCTGAGTCGCCG
CCCGCGCCGGGGCGTGGCCCCGCAGGCTCTCCGGCCCATCTCCACACGGGCACCTTCTGGCTGACCCGGATCGTGCTCCTGAAGGCCCTA
GCCTTCGTGTACTTCGTGGCATTCCTGGTGGCTTTCCATCAGAACAAGCAGCTCATCGGTGACAGGGGGCTGCTTCCCTGCAGAGTGTTC
CTGAAGAACTTCCAGCAGTACTTCCAGGACAGGACGAGCTGGGAAGTCTTCAGCTACATGCCCACCATCCTCTGGCTGATGGACTGGTCA
GACATGAACTCCAACCTGGACTTGCTGGCTCTTCTCGGACTGGGCATCTCGTCTTTCGTACTGATCACGGGCTGCGCCAACATGCTTCTC
ATGGCTGCCCTGTGGGGCCTCTACATGTCCCTGGTTAATGTGGGCCATGTCTGGTATTCCTTCAGATGGGAGTCCCAGCTTCTGGAGACG
GGGTTCCTGGGGATCTTCCTGTGCCCTCTGTGGACGCTGTCAAGGCTGCCCCAGCATACCCCCACATCCCGGATTGTCCTGTGGGGCTTC
CGGTGGCTGATCTTCAGGATCATGCTTGGAGCAGCCCAGGTGACCAAGCTCGGCGAAGAGGTGAGCCTGCGCTTCCTGAAGAGGGAGGCC
AAGCTGTGCGGCTTCCTGCAGAAGAGCTTCCTGGCCCTGGAGAAGAGAATGAAGGCCTCGGAGAGCTCACGGCTGAAGCTGGAGGGCAGC
CTGCGGGGCGAGCTGGAGAGCCGGTGGGAGAAGCTTCGGGGGCTGATGGAGGAGCGCCTGCGGGCCCTGCAGGGGCAGCATGAGGAGAGC
CACCTCCTGGAGCAGTGCCAGGGCCTGGATGCTGCCGTGGCCCAGCTGACCAAGTTTGTGCAGCAGAACCAGGCGTCGCTGAACCGTGTC
CTACTGGCCGAGGAGAAAGCCTGGGACGCCAAGGGGCGCTTGGAGGAAAGCCGGGCTGGGGAGCTGGCCGCCTATGTGCAGGAGAACCTG
GAGGCCGCACAGCTGGCTGGCGAGCTGGCCCGGCAGGAGATGCATGGAGAGCTGGTGCTGCTCCGAGAGAAGAGCCGGGCTCTGGAGGCA
TCCGTGGCGCAGCTGGCCGGGCAGTTAAAGGAGCTGAGTGGCCATCTCCCGGCTCTGAGCAGCCGGCTCGATCTGCAGGAGCAGATGCTG
GGCCTCAGGCTGTCCGAGGCAAAGACCGAATGGGAAGGTGCAGAGAGGAAGTCCCTGGAGGACCTGGCCAGGTGGCGGAAGGAGGTGACC
GAACACCTGCGAGGGGTGCGGGAGAAGGTGGATGGCCTCCCCCAGCAGATAGAGAGTGTCTCCGACAAGTGCCTGCTTCATAAGAGCGAC
TCAGACCTCAGGATTTCCGCCGAAGGCAAGGCCAGGGAGTTCAAGGTTGGGGCCCTGCGGCAGGAGCTGGCCACGCTACTATCATCCGTG
CAGCTGCTAAAGGAAGACAACCCTGGGCGGAAGATCGCGGAGATGCAGGGCAAGCTGGCCACGTTTCAGAACCAAATAATGAAGCTGGAA
AACTGCGTCCAGGCCAACAAGACCATCCAGAACCTCAGGTTCAACACTGAGGCCCGGCTGCGCACGCAGGAGATGGCCACCCTGTGGGAG
AGTGTGCTCCGGCTGTGGAGTGAGGAGGGCCCGCGGACGCCGCTGGGCAGCTGGAAGGCGCTCCCATCCCTGGTGAGGCCGCGGGTCTTC
ATCAAGGACATGGCGCCTGGCAAGGTGGTGCCCATGAACTGCTGGGGCGTGTACCAGGCTGTGAGGTGGCTGCGCTGGAAGGCGTCCCTC
ATAAAGCTCAGGGCCCTGCGGAGGCCAGGAGGGGTCCTGGAGAAGCCCCACAGCCAGGAGCAGGTGCAGCAGCTCACACCCTCACTGTTT

>In-frame_LMF1_ENST00000399843_chr16_960931_-_CCDC154_ENST00000389176_chr16_1489127_-_2013nt
ATGCGCCCTGACAGCCCAACAATGGCGGCGCCCGCGGAGTCGCTGAGGAGGCGGAAGACTGGGTACTCGGATCCGGAGCCTGAGTCGCCG
CCCGCGCCGGGGCGTGGCCCCGCAGGCTCTCCGGCCCATCTCCACACGGGCACCTTCTGGCTGACCCGGATCGTGCTCCTGAAGGCCCTA
GCCTTCGTGTACTTCGTGGCATTCCTGGTGGCTTTCCATCAGAACAAGCAGCTCATCGGTGACAGGGGGCTGCTTCCCTGCAGAGTGTTC
CTGAAGAACTTCCAGCAGTACTTCCAGGACAGGACGAGCTGGGAAGTCTTCAGCTACATGCCCACCATCCTCTGGCTGATGGACTGGTCA
GACATGAACTCCAACCTGGACTTGCTGGCTCTTCTCGGACTGGGCATCTCGTCTTTCGTACTGATCACGGGCTGCGCCAACATGCTTCTC
ATGGCTGCCCTGTGGGGCCTCTACATGTCCCTGGTTAATGTGGGCCATGTCTGGTATTCCTTCAGATGGGAGTCCCAGCTTCTGGAGACG
GGGTTCCTGGGGATCTTCCTGTGCCCTCTGTGGACGCTGTCAAGGCTGCCCCAGCATACCCCCACATCCCGGATTGTCCTGTGGGGCTTC
CGGTGGCTGATCTTCAGGATCATGCTTGGAGCAGCCCAGGTGACCAAGCTCGGCGAAGAGGTGAGCCTGCGCTTCCTGAAGAGGGAGGCC
AAGCTGTGCGGCTTCCTGCAGAAGAGCTTCCTGGCCCTGGAGAAGAGAATGAAGGCCTCGGAGAGCTCACGGCTGAAGCTGGAGGGCAGC
CTGCGGGGCGAGCTGGAGAGCCGGTGGGAGAAGCTTCGGGGGCTGATGGAGGAGCGCCTGCGGGCCCTGCAGGGGCAGCATGAGGTGGGG
CCGGGCGGGCGGCGGGCAGAGGAGAGCCACCTCCTGGAGCAGTGCCAGGGCCTGGATGCTGCCGTGGCCCAGCTGACCAAGTTTGTGCAG
CAGAACCAGGCGTCGCTGAACCGTGTCCTACTGGCCGAGGAGAAAGCCTGGGACGCCAAGGGGCGCTTGGAGGAAAGCCGGGCTGGGGAG
CTGGCCGCCTATGTGCAGGAGAACCTGGAGGCCGCACAGCTGGCTGGCGAGCTGGCCCGGCAGGAGATGCATGGAGAGCTGGTGCTGCTC
CGAGAGAAGAGCCGGGCTCTGGAGGCATCCGTGGCGCAGCTGGCCGGGCAGTTAAAGGAGCTGAGTGGCCATCTCCCGGCTCTGAGCAGC
CGGCTCGATCTGCAGGAGCAGATGCTGGGCCTCAGGCTGTCCGAGGCAAAGACCGAATGGGAAGGTGCAGAGAGGAAGTCCCTGGAGGAC
CTGGCCAGGTGGCGGAAGGAGGTGACCGAACACCTGCGAGGGGTGCGGGAGAAGGTGGATGGCCTCCCCCAGCAGATAGAGAGTGTCTCC
GACAAGTGCCTGCTTCATAAGAGCGACTCAGACCTCAGGATTTCCGCCGAAGGCAAGGCCAGGGAGTTCAAGGTTGGGGCCCTGCGGCAG
GAGCTGGCCACGCTACTATCATCCGTGCAGCTGCTAAAGGAAGACAACCCTGGGCGGAAGATCGCGGAGATGCAGGGCAAGCTGGCCACG
AACCAAATAATGAAGCTGGAAAACTGCGTCCAGGCCAACAAGACCATCCAGAACCTCAGGTTCAACACTGAGGCCCGGCTGCGCACGCAG
GAGATGGCCACCCTGTGGGAGAGTGTGCTCCGGCTGTGGAGTGAGGAGGGCCCGCGGACGCCGCTGGGCAGCTGGAAGGCGCTCCCATCC
CTGGTGAGGCCGCGGGTCTTCATCAAGGACATGGCGCCTGGCAAGGTGGTGCCCATGAACTGCTGGGGCGTGTACCAGGCTGTGAGGTGG
CTGCGCTGGAAGGCGTCCCTCATAAAGCTCAGGGCCCTGCGGAGGCCAGGAGGGGTCCTGGAGAAGCCCCACAGCCAGGAGCAGGTGCAG

>In-frame_LMF1_ENST00000568897_chr16_960931_-_CCDC154_ENST00000409671_chr16_1489127_-_1341nt
ATGCTTGGAGCAGCCCAGGTGACCAAGCTCGGCGAAGAGGTGAGCCTGCGCTTCCTGAAGAGGGAGGCCAAGCTGTGCGGCTTCCTGCAG
AAGAGCTTCCTGGCCCTGGAGAAGAGAATGAAGGCCTCGGAGAGCTCACGGCTGAAGCTGGAGGGCAGCCTGCGGGGCGAGCTGGAGAGC
CGGTGGGAGAAGCTTCGGGGGCTGATGGAGGAGCGCCTGCGGGCCCTGCAGGGGCAGCATGAGGAGAGCCACCTCCTGGAGCAGTGCCAG
GGCCTGGATGCTGCCGTGGCCCAGCTGACCAAGTTTGTGCAGCAGAACCAGGCGTCGCTGAACCGTGTCCTACTGGCCGAGGAGAAAGCC
TGGGACGCCAAGGGGCGCTTGGAGGAAAGCCGGGCTGGGGAGCTGGCCGCCTATGTGCAGGAGAACCTGGAGGCCGCACAGCTGGCTGGC
GAGCTGGCCCGGCAGGAGATGCATGGAGAGCTGGTGCTGCTCCGAGAGAAGAGCCGGGCTCTGGAGGCATCCGTGGCGCAGCTGGCCGGG
CAGTTAAAGGAGCTGAGTGGCCATCTCCCGGCTCTGAGCAGCCGGCTCGATCTGCAGGAGCAGATGCTGGGCCTCAGGCTGTCCGAGGCA
AAGACCGAATGGGAAGGTGCAGAGAGGAAGTCCCTGGAGGACCTGGCCAGGTGGCGGAAGGAGGTGACCGAACACCTGCGAGGGGTGCGG
GAGAAGGTGGATGGCCTCCCCCAGCAGATAGAGAGTGTCTCCGACAAGTGCCTGCTTCATAAGAGCGACTCAGACCTCAGGATTTCCGCC
GAAGGCAAGGCCAGGGAGTTCAAGGTTGGGGCCCTGCGGCAGGAGCTGGCCACGCTACTATCATCCGTGCAGCTGCTAAAGGAAGACAAC
CCTGGGCGGAAGATCGCGGAGATGCAGGGCAAGCTGGCCACGTTTCAGAACCAAATAATGAAGCTGGAAAACTGCGTCCAGGCCAACAAG
ACCATCCAGAACCTCAGGTTCAACACTGAGGCCCGGCTGCGCACGCAGGAGATGGCCACCCTGTGGGAGAGTGTGCTCCGGCTGTGGAGT
GAGGAGGGCCCGCGGACGCCGCTGGGCAGCTGGAAGGCGCTCCCATCCCTGGTGAGGCCGCGGGTCTTCATCAAGGACATGGCGCCTGGC
AAGGTGGTGCCCATGAACTGCTGGGGCGTGTACCAGGCTGTGAGGTGGCTGCGCTGGAAGGCGTCCCTCATAAAGCTCAGGGCCCTGCGG

>In-frame_LMF1_ENST00000568897_chr16_960931_-_CCDC154_ENST00000389176_chr16_1489127_-_1362nt
ATGCTTGGAGCAGCCCAGGTGACCAAGCTCGGCGAAGAGGTGAGCCTGCGCTTCCTGAAGAGGGAGGCCAAGCTGTGCGGCTTCCTGCAG
AAGAGCTTCCTGGCCCTGGAGAAGAGAATGAAGGCCTCGGAGAGCTCACGGCTGAAGCTGGAGGGCAGCCTGCGGGGCGAGCTGGAGAGC
CGGTGGGAGAAGCTTCGGGGGCTGATGGAGGAGCGCCTGCGGGCCCTGCAGGGGCAGCATGAGGTGGGGCCGGGCGGGCGGCGGGCAGAG
GAGAGCCACCTCCTGGAGCAGTGCCAGGGCCTGGATGCTGCCGTGGCCCAGCTGACCAAGTTTGTGCAGCAGAACCAGGCGTCGCTGAAC
CGTGTCCTACTGGCCGAGGAGAAAGCCTGGGACGCCAAGGGGCGCTTGGAGGAAAGCCGGGCTGGGGAGCTGGCCGCCTATGTGCAGGAG
AACCTGGAGGCCGCACAGCTGGCTGGCGAGCTGGCCCGGCAGGAGATGCATGGAGAGCTGGTGCTGCTCCGAGAGAAGAGCCGGGCTCTG
GAGGCATCCGTGGCGCAGCTGGCCGGGCAGTTAAAGGAGCTGAGTGGCCATCTCCCGGCTCTGAGCAGCCGGCTCGATCTGCAGGAGCAG
ATGCTGGGCCTCAGGCTGTCCGAGGCAAAGACCGAATGGGAAGGTGCAGAGAGGAAGTCCCTGGAGGACCTGGCCAGGTGGCGGAAGGAG
GTGACCGAACACCTGCGAGGGGTGCGGGAGAAGGTGGATGGCCTCCCCCAGCAGATAGAGAGTGTCTCCGACAAGTGCCTGCTTCATAAG
AGCGACTCAGACCTCAGGATTTCCGCCGAAGGCAAGGCCAGGGAGTTCAAGGTTGGGGCCCTGCGGCAGGAGCTGGCCACGCTACTATCA
TCCGTGCAGCTGCTAAAGGAAGACAACCCTGGGCGGAAGATCGCGGAGATGCAGGGCAAGCTGGCCACGAACCAAATAATGAAGCTGGAA
AACTGCGTCCAGGCCAACAAGACCATCCAGAACCTCAGGTTCAACACTGAGGCCCGGCTGCGCACGCAGGAGATGGCCACCCTGTGGGAG
AGTGTGCTCCGGCTGTGGAGTGAGGAGGGCCCGCGGACGCCGCTGGGCAGCTGGAAGGCGCTCCCATCCCTGGTGAGGCCGCGGGTCTTC
ATCAAGGACATGGCGCCTGGCAAGGTGGTGCCCATGAACTGCTGGGGCGTGTACCAGGCTGTGAGGTGGCTGCGCTGGAAGGCGTCCCTC
ATAAAGCTCAGGGCCCTGCGGAGGCCAGGAGGGGTCCTGGAGAAGCCCCACAGCCAGGAGCAGGTGCAGCAGCTCACACCCTCACTGTTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_LMF1_ENST00000262301_chr16_960931_-_CCDC154_ENST00000409671_chr16_1489127_-_2034nt
GAGTGCGCCCTCCCCGCACATGCGCCCTGACAGCCCAACAATGGCGGCGCCCGCGGAGTCGCTGAGGAGGCGGAAGACTGGGTACTCGGA
TCCGGAGCCTGAGTCGCCGCCCGCGCCGGGGCGTGGCCCCGCAGGCTCTCCGGCCCATCTCCACACGGGCACCTTCTGGCTGACCCGGAT
CGTGCTCCTGAAGGCCCTAGCCTTCGTGTACTTCGTGGCATTCCTGGTGGCTTTCCATCAGAACAAGCAGCTCATCGGTGACAGGGGGCT
GCTTCCCTGCAGAGTGTTCCTGAAGAACTTCCAGCAGTACTTCCAGGACAGGACGAGCTGGGAAGTCTTCAGCTACATGCCCACCATCCT
CTGGCTGATGGACTGGTCAGACATGAACTCCAACCTGGACTTGCTGGCTCTTCTCGGACTGGGCATCTCGTCTTTCGTACTGATCACGGG
CTGCGCCAACATGCTTCTCATGGCTGCCCTGTGGGGCCTCTACATGTCCCTGGTTAATGTGGGCCATGTCTGGTACTCTTTCGGATGGGA
GTCCCAGCTTCTGGAGACGGGGTTCCTGGGGATCTTCCTGTGCCCTCTGTGGACGCTGTCAAGGCTGCCCCAGCATACCCCCACATCCCG
GATTGTCCTGTGGGGCTTCCGGTGGCTGATCTTCAGGATCATGCTTGGAGCAGCCCAGGTGACCAAGCTCGGCGAAGAGGTGAGCCTGCG
CTTCCTGAAGAGGGAGGCCAAGCTGTGCGGCTTCCTGCAGAAGAGCTTCCTGGCCCTGGAGAAGAGAATGAAGGCCTCGGAGAGCTCACG
GCTGAAGCTGGAGGGCAGCCTGCGGGGCGAGCTGGAGAGCCGGTGGGAGAAGCTTCGGGGGCTGATGGAGGAGCGCCTGCGGGCCCTGCA
GGGGCAGCATGAGGAGAGCCACCTCCTGGAGCAGTGCCAGGGCCTGGATGCTGCCGTGGCCCAGCTGACCAAGTTTGTGCAGCAGAACCA
GGCGTCGCTGAACCGTGTCCTACTGGCCGAGGAGAAAGCCTGGGACGCCAAGGGGCGCTTGGAGGAAAGCCGGGCTGGGGAGCTGGCCGC
CTATGTGCAGGAGAACCTGGAGGCCGCACAGCTGGCTGGCGAGCTGGCCCGGCAGGAGATGCATGGAGAGCTGGTGCTGCTCCGAGAGAA
GAGCCGGGCTCTGGAGGCATCCGTGGCGCAGCTGGCCGGGCAGTTAAAGGAGCTGAGTGGCCATCTCCCGGCTCTGAGCAGCCGGCTCGA
TCTGCAGGAGCAGATGCTGGGCCTCAGGCTGTCCGAGGCAAAGACCGAATGGGAAGGTGCAGAGAGGAAGTCCCTGGAGGACCTGGCCAG
GTGGCGGAAGGAGGTGACCGAACACCTGCGAGGGGTGCGGGAGAAGGTGGATGGCCTCCCCCAGCAGATAGAGAGTGTCTCCGACAAGTG
CCTGCTTCATAAGAGCGACTCAGACCTCAGGATTTCCGCCGAAGGCAAGGCCAGGGAGTTCAAGGTTGGGGCCCTGCGGCAGGAGCTGGC
CACGCTACTATCATCCGTGCAGCTGCTAAAGGAAGACAACCCTGGGCGGAAGATCGCGGAGATGCAGGGCAAGCTGGCCACGTTTCAGAA
CCAAATAATGAAGCTGGAAAACTGCGTCCAGGCCAACAAGACCATCCAGAACCTCAGGTTCAACACTGAGGCCCGGCTGCGCACGCAGGA
GATGGCCACCCTGTGGGAGAGTGTGCTCCGGCTGTGGAGTGAGGAGGGCCCGCGGACGCCGCTGGGCAGCTGGAAGGCGCTCCCATCCCT
GGTGAGGCCGCGGGTCTTCATCAAGGACATGGCGCCTGGCAAGGTGGTGCCCATGAACTGCTGGGGCGTGTACCAGGCTGTGAGGTGGCT
GCGCTGGAAGGCGTCCCTCATAAAGCTCAGGGCCCTGCGGAGGCCAGGAGGGGTCCTGGAGAAGCCCCACAGCCAGGAGCAGGTGCAGCA

>In-frame_LMF1_ENST00000262301_chr16_960931_-_CCDC154_ENST00000389176_chr16_1489127_-_2052nt
GAGTGCGCCCTCCCCGCACATGCGCCCTGACAGCCCAACAATGGCGGCGCCCGCGGAGTCGCTGAGGAGGCGGAAGACTGGGTACTCGGA
TCCGGAGCCTGAGTCGCCGCCCGCGCCGGGGCGTGGCCCCGCAGGCTCTCCGGCCCATCTCCACACGGGCACCTTCTGGCTGACCCGGAT
CGTGCTCCTGAAGGCCCTAGCCTTCGTGTACTTCGTGGCATTCCTGGTGGCTTTCCATCAGAACAAGCAGCTCATCGGTGACAGGGGGCT
GCTTCCCTGCAGAGTGTTCCTGAAGAACTTCCAGCAGTACTTCCAGGACAGGACGAGCTGGGAAGTCTTCAGCTACATGCCCACCATCCT
CTGGCTGATGGACTGGTCAGACATGAACTCCAACCTGGACTTGCTGGCTCTTCTCGGACTGGGCATCTCGTCTTTCGTACTGATCACGGG
CTGCGCCAACATGCTTCTCATGGCTGCCCTGTGGGGCCTCTACATGTCCCTGGTTAATGTGGGCCATGTCTGGTACTCTTTCGGATGGGA
GTCCCAGCTTCTGGAGACGGGGTTCCTGGGGATCTTCCTGTGCCCTCTGTGGACGCTGTCAAGGCTGCCCCAGCATACCCCCACATCCCG
GATTGTCCTGTGGGGCTTCCGGTGGCTGATCTTCAGGATCATGCTTGGAGCAGCCCAGGTGACCAAGCTCGGCGAAGAGGTGAGCCTGCG
CTTCCTGAAGAGGGAGGCCAAGCTGTGCGGCTTCCTGCAGAAGAGCTTCCTGGCCCTGGAGAAGAGAATGAAGGCCTCGGAGAGCTCACG
GCTGAAGCTGGAGGGCAGCCTGCGGGGCGAGCTGGAGAGCCGGTGGGAGAAGCTTCGGGGGCTGATGGAGGAGCGCCTGCGGGCCCTGCA
GGGGCAGCATGAGGTGGGGCCGGGCGGGCGGCGGGCAGAGGAGAGCCACCTCCTGGAGCAGTGCCAGGGCCTGGATGCTGCCGTGGCCCA
GCTGACCAAGTTTGTGCAGCAGAACCAGGCGTCGCTGAACCGTGTCCTACTGGCCGAGGAGAAAGCCTGGGACGCCAAGGGGCGCTTGGA
GGAAAGCCGGGCTGGGGAGCTGGCCGCCTATGTGCAGGAGAACCTGGAGGCCGCACAGCTGGCTGGCGAGCTGGCCCGGCAGGAGATGCA
TGGAGAGCTGGTGCTGCTCCGAGAGAAGAGCCGGGCTCTGGAGGCATCCGTGGCGCAGCTGGCCGGGCAGTTAAAGGAGCTGAGTGGCCA
TCTCCCGGCTCTGAGCAGCCGGCTCGATCTGCAGGAGCAGATGCTGGGCCTCAGGCTGTCCGAGGCAAAGACCGAATGGGAAGGTGCAGA
GAGGAAGTCCCTGGAGGACCTGGCCAGGTGGCGGAAGGAGGTGACCGAACACCTGCGAGGGGTGCGGGAGAAGGTGGATGGCCTCCCCCA
GCAGATAGAGAGTGTCTCCGACAAGTGCCTGCTTCATAAGAGCGACTCAGACCTCAGGATTTCCGCCGAAGGCAAGGCCAGGGAGTTCAA
GGTTGGGGCCCTGCGGCAGGAGCTGGCCACGCTACTATCATCCGTGCAGCTGCTAAAGGAAGACAACCCTGGGCGGAAGATCGCGGAGAT
GCAGGGCAAGCTGGCCACGAACCAAATAATGAAGCTGGAAAACTGCGTCCAGGCCAACAAGACCATCCAGAACCTCAGGTTCAACACTGA
GGCCCGGCTGCGCACGCAGGAGATGGCCACCCTGTGGGAGAGTGTGCTCCGGCTGTGGAGTGAGGAGGGCCCGCGGACGCCGCTGGGCAG
CTGGAAGGCGCTCCCATCCCTGGTGAGGCCGCGGGTCTTCATCAAGGACATGGCGCCTGGCAAGGTGGTGCCCATGAACTGCTGGGGCGT
GTACCAGGCTGTGAGGTGGCTGCGCTGGAAGGCGTCCCTCATAAAGCTCAGGGCCCTGCGGAGGCCAGGAGGGGTCCTGGAGAAGCCCCA

>In-frame_LMF1_ENST00000399843_chr16_960931_-_CCDC154_ENST00000409671_chr16_1489127_-_2017nt
ACATGCGCCCTGACAGCCCAACAATGGCGGCGCCCGCGGAGTCGCTGAGGAGGCGGAAGACTGGGTACTCGGATCCGGAGCCTGAGTCGC
CGCCCGCGCCGGGGCGTGGCCCCGCAGGCTCTCCGGCCCATCTCCACACGGGCACCTTCTGGCTGACCCGGATCGTGCTCCTGAAGGCCC
TAGCCTTCGTGTACTTCGTGGCATTCCTGGTGGCTTTCCATCAGAACAAGCAGCTCATCGGTGACAGGGGGCTGCTTCCCTGCAGAGTGT
TCCTGAAGAACTTCCAGCAGTACTTCCAGGACAGGACGAGCTGGGAAGTCTTCAGCTACATGCCCACCATCCTCTGGCTGATGGACTGGT
CAGACATGAACTCCAACCTGGACTTGCTGGCTCTTCTCGGACTGGGCATCTCGTCTTTCGTACTGATCACGGGCTGCGCCAACATGCTTC
TCATGGCTGCCCTGTGGGGCCTCTACATGTCCCTGGTTAATGTGGGCCATGTCTGGTATTCCTTCAGATGGGAGTCCCAGCTTCTGGAGA
CGGGGTTCCTGGGGATCTTCCTGTGCCCTCTGTGGACGCTGTCAAGGCTGCCCCAGCATACCCCCACATCCCGGATTGTCCTGTGGGGCT
TCCGGTGGCTGATCTTCAGGATCATGCTTGGAGCAGCCCAGGTGACCAAGCTCGGCGAAGAGGTGAGCCTGCGCTTCCTGAAGAGGGAGG
CCAAGCTGTGCGGCTTCCTGCAGAAGAGCTTCCTGGCCCTGGAGAAGAGAATGAAGGCCTCGGAGAGCTCACGGCTGAAGCTGGAGGGCA
GCCTGCGGGGCGAGCTGGAGAGCCGGTGGGAGAAGCTTCGGGGGCTGATGGAGGAGCGCCTGCGGGCCCTGCAGGGGCAGCATGAGGAGA
GCCACCTCCTGGAGCAGTGCCAGGGCCTGGATGCTGCCGTGGCCCAGCTGACCAAGTTTGTGCAGCAGAACCAGGCGTCGCTGAACCGTG
TCCTACTGGCCGAGGAGAAAGCCTGGGACGCCAAGGGGCGCTTGGAGGAAAGCCGGGCTGGGGAGCTGGCCGCCTATGTGCAGGAGAACC
TGGAGGCCGCACAGCTGGCTGGCGAGCTGGCCCGGCAGGAGATGCATGGAGAGCTGGTGCTGCTCCGAGAGAAGAGCCGGGCTCTGGAGG
CATCCGTGGCGCAGCTGGCCGGGCAGTTAAAGGAGCTGAGTGGCCATCTCCCGGCTCTGAGCAGCCGGCTCGATCTGCAGGAGCAGATGC
TGGGCCTCAGGCTGTCCGAGGCAAAGACCGAATGGGAAGGTGCAGAGAGGAAGTCCCTGGAGGACCTGGCCAGGTGGCGGAAGGAGGTGA
CCGAACACCTGCGAGGGGTGCGGGAGAAGGTGGATGGCCTCCCCCAGCAGATAGAGAGTGTCTCCGACAAGTGCCTGCTTCATAAGAGCG
ACTCAGACCTCAGGATTTCCGCCGAAGGCAAGGCCAGGGAGTTCAAGGTTGGGGCCCTGCGGCAGGAGCTGGCCACGCTACTATCATCCG
TGCAGCTGCTAAAGGAAGACAACCCTGGGCGGAAGATCGCGGAGATGCAGGGCAAGCTGGCCACGTTTCAGAACCAAATAATGAAGCTGG
AAAACTGCGTCCAGGCCAACAAGACCATCCAGAACCTCAGGTTCAACACTGAGGCCCGGCTGCGCACGCAGGAGATGGCCACCCTGTGGG
AGAGTGTGCTCCGGCTGTGGAGTGAGGAGGGCCCGCGGACGCCGCTGGGCAGCTGGAAGGCGCTCCCATCCCTGGTGAGGCCGCGGGTCT
TCATCAAGGACATGGCGCCTGGCAAGGTGGTGCCCATGAACTGCTGGGGCGTGTACCAGGCTGTGAGGTGGCTGCGCTGGAAGGCGTCCC
TCATAAAGCTCAGGGCCCTGCGGAGGCCAGGAGGGGTCCTGGAGAAGCCCCACAGCCAGGAGCAGGTGCAGCAGCTCACACCCTCACTGT

>In-frame_LMF1_ENST00000399843_chr16_960931_-_CCDC154_ENST00000389176_chr16_1489127_-_2035nt
ACATGCGCCCTGACAGCCCAACAATGGCGGCGCCCGCGGAGTCGCTGAGGAGGCGGAAGACTGGGTACTCGGATCCGGAGCCTGAGTCGC
CGCCCGCGCCGGGGCGTGGCCCCGCAGGCTCTCCGGCCCATCTCCACACGGGCACCTTCTGGCTGACCCGGATCGTGCTCCTGAAGGCCC
TAGCCTTCGTGTACTTCGTGGCATTCCTGGTGGCTTTCCATCAGAACAAGCAGCTCATCGGTGACAGGGGGCTGCTTCCCTGCAGAGTGT
TCCTGAAGAACTTCCAGCAGTACTTCCAGGACAGGACGAGCTGGGAAGTCTTCAGCTACATGCCCACCATCCTCTGGCTGATGGACTGGT
CAGACATGAACTCCAACCTGGACTTGCTGGCTCTTCTCGGACTGGGCATCTCGTCTTTCGTACTGATCACGGGCTGCGCCAACATGCTTC
TCATGGCTGCCCTGTGGGGCCTCTACATGTCCCTGGTTAATGTGGGCCATGTCTGGTATTCCTTCAGATGGGAGTCCCAGCTTCTGGAGA
CGGGGTTCCTGGGGATCTTCCTGTGCCCTCTGTGGACGCTGTCAAGGCTGCCCCAGCATACCCCCACATCCCGGATTGTCCTGTGGGGCT
TCCGGTGGCTGATCTTCAGGATCATGCTTGGAGCAGCCCAGGTGACCAAGCTCGGCGAAGAGGTGAGCCTGCGCTTCCTGAAGAGGGAGG
CCAAGCTGTGCGGCTTCCTGCAGAAGAGCTTCCTGGCCCTGGAGAAGAGAATGAAGGCCTCGGAGAGCTCACGGCTGAAGCTGGAGGGCA
GCCTGCGGGGCGAGCTGGAGAGCCGGTGGGAGAAGCTTCGGGGGCTGATGGAGGAGCGCCTGCGGGCCCTGCAGGGGCAGCATGAGGTGG
GGCCGGGCGGGCGGCGGGCAGAGGAGAGCCACCTCCTGGAGCAGTGCCAGGGCCTGGATGCTGCCGTGGCCCAGCTGACCAAGTTTGTGC
AGCAGAACCAGGCGTCGCTGAACCGTGTCCTACTGGCCGAGGAGAAAGCCTGGGACGCCAAGGGGCGCTTGGAGGAAAGCCGGGCTGGGG
AGCTGGCCGCCTATGTGCAGGAGAACCTGGAGGCCGCACAGCTGGCTGGCGAGCTGGCCCGGCAGGAGATGCATGGAGAGCTGGTGCTGC
TCCGAGAGAAGAGCCGGGCTCTGGAGGCATCCGTGGCGCAGCTGGCCGGGCAGTTAAAGGAGCTGAGTGGCCATCTCCCGGCTCTGAGCA
GCCGGCTCGATCTGCAGGAGCAGATGCTGGGCCTCAGGCTGTCCGAGGCAAAGACCGAATGGGAAGGTGCAGAGAGGAAGTCCCTGGAGG
ACCTGGCCAGGTGGCGGAAGGAGGTGACCGAACACCTGCGAGGGGTGCGGGAGAAGGTGGATGGCCTCCCCCAGCAGATAGAGAGTGTCT
CCGACAAGTGCCTGCTTCATAAGAGCGACTCAGACCTCAGGATTTCCGCCGAAGGCAAGGCCAGGGAGTTCAAGGTTGGGGCCCTGCGGC
AGGAGCTGGCCACGCTACTATCATCCGTGCAGCTGCTAAAGGAAGACAACCCTGGGCGGAAGATCGCGGAGATGCAGGGCAAGCTGGCCA
CGAACCAAATAATGAAGCTGGAAAACTGCGTCCAGGCCAACAAGACCATCCAGAACCTCAGGTTCAACACTGAGGCCCGGCTGCGCACGC
AGGAGATGGCCACCCTGTGGGAGAGTGTGCTCCGGCTGTGGAGTGAGGAGGGCCCGCGGACGCCGCTGGGCAGCTGGAAGGCGCTCCCAT
CCCTGGTGAGGCCGCGGGTCTTCATCAAGGACATGGCGCCTGGCAAGGTGGTGCCCATGAACTGCTGGGGCGTGTACCAGGCTGTGAGGT
GGCTGCGCTGGAAGGCGTCCCTCATAAAGCTCAGGGCCCTGCGGAGGCCAGGAGGGGTCCTGGAGAAGCCCCACAGCCAGGAGCAGGTGC

>In-frame_LMF1_ENST00000568897_chr16_960931_-_CCDC154_ENST00000409671_chr16_1489127_-_1894nt
GGCTCTCCGGCCCATCTCCACACGGGCACCTTCTGGCTGACCCGGATCGTGCTCCTGAAGGCCCTAGCCTTCGTGTACTTCGTGGCATTC
CTGGTGGCTTTCCATCAGAACAAGCAGCTCATCGGTGACAGGGGGCTGCTTCCCTGCAGAGTGTTCCTGAAGAACTTCCAGCAGTACTTC
CAGGACAGGACGAGCTGGGAAGTCTTCAGCTACATGCCCACCATCCTCTGGCTGATGGACTGGTCAGACATGAACTCCAACCTGGACTTG
CTGGCTCTTCTCGGACTGGGCATCTCGTCTTTCGTACTGATCACGGGCTGCGCCAACATGCTTCTCATGGCTGCCCTGTGGGGCCTCTAC
ATGTCCCTGGTTAATGTGGGCCATGTCTGGTGAGATGGGAGTCCCAGCTTCTGGAGACGGGGTTCCTGGGGATCTTCCTGTGCCCTCTGT
GGACGCTGTCAAGGCTGCCCCAGCATACCCCCACATCCCGGATTGTCCTGTGGGGCTTCCGGTGGCTGATCTTCAGGATCATGCTTGGAG
CAGCCCAGGTGACCAAGCTCGGCGAAGAGGTGAGCCTGCGCTTCCTGAAGAGGGAGGCCAAGCTGTGCGGCTTCCTGCAGAAGAGCTTCC
TGGCCCTGGAGAAGAGAATGAAGGCCTCGGAGAGCTCACGGCTGAAGCTGGAGGGCAGCCTGCGGGGCGAGCTGGAGAGCCGGTGGGAGA
AGCTTCGGGGGCTGATGGAGGAGCGCCTGCGGGCCCTGCAGGGGCAGCATGAGGAGAGCCACCTCCTGGAGCAGTGCCAGGGCCTGGATG
CTGCCGTGGCCCAGCTGACCAAGTTTGTGCAGCAGAACCAGGCGTCGCTGAACCGTGTCCTACTGGCCGAGGAGAAAGCCTGGGACGCCA
AGGGGCGCTTGGAGGAAAGCCGGGCTGGGGAGCTGGCCGCCTATGTGCAGGAGAACCTGGAGGCCGCACAGCTGGCTGGCGAGCTGGCCC
GGCAGGAGATGCATGGAGAGCTGGTGCTGCTCCGAGAGAAGAGCCGGGCTCTGGAGGCATCCGTGGCGCAGCTGGCCGGGCAGTTAAAGG
AGCTGAGTGGCCATCTCCCGGCTCTGAGCAGCCGGCTCGATCTGCAGGAGCAGATGCTGGGCCTCAGGCTGTCCGAGGCAAAGACCGAAT
GGGAAGGTGCAGAGAGGAAGTCCCTGGAGGACCTGGCCAGGTGGCGGAAGGAGGTGACCGAACACCTGCGAGGGGTGCGGGAGAAGGTGG
ATGGCCTCCCCCAGCAGATAGAGAGTGTCTCCGACAAGTGCCTGCTTCATAAGAGCGACTCAGACCTCAGGATTTCCGCCGAAGGCAAGG
CCAGGGAGTTCAAGGTTGGGGCCCTGCGGCAGGAGCTGGCCACGCTACTATCATCCGTGCAGCTGCTAAAGGAAGACAACCCTGGGCGGA
AGATCGCGGAGATGCAGGGCAAGCTGGCCACGTTTCAGAACCAAATAATGAAGCTGGAAAACTGCGTCCAGGCCAACAAGACCATCCAGA
ACCTCAGGTTCAACACTGAGGCCCGGCTGCGCACGCAGGAGATGGCCACCCTGTGGGAGAGTGTGCTCCGGCTGTGGAGTGAGGAGGGCC
CGCGGACGCCGCTGGGCAGCTGGAAGGCGCTCCCATCCCTGGTGAGGCCGCGGGTCTTCATCAAGGACATGGCGCCTGGCAAGGTGGTGC
CCATGAACTGCTGGGGCGTGTACCAGGCTGTGAGGTGGCTGCGCTGGAAGGCGTCCCTCATAAAGCTCAGGGCCCTGCGGAGGCCAGGAG
GGGTCCTGGAGAAGCCCCACAGCCAGGAGCAGGTGCAGCAGCTCACACCCTCACTGTTTATCCAGAAATAAACGTGCTGGCTTTGTACTC

>In-frame_LMF1_ENST00000568897_chr16_960931_-_CCDC154_ENST00000389176_chr16_1489127_-_1912nt
GGCTCTCCGGCCCATCTCCACACGGGCACCTTCTGGCTGACCCGGATCGTGCTCCTGAAGGCCCTAGCCTTCGTGTACTTCGTGGCATTC
CTGGTGGCTTTCCATCAGAACAAGCAGCTCATCGGTGACAGGGGGCTGCTTCCCTGCAGAGTGTTCCTGAAGAACTTCCAGCAGTACTTC
CAGGACAGGACGAGCTGGGAAGTCTTCAGCTACATGCCCACCATCCTCTGGCTGATGGACTGGTCAGACATGAACTCCAACCTGGACTTG
CTGGCTCTTCTCGGACTGGGCATCTCGTCTTTCGTACTGATCACGGGCTGCGCCAACATGCTTCTCATGGCTGCCCTGTGGGGCCTCTAC
ATGTCCCTGGTTAATGTGGGCCATGTCTGGTGAGATGGGAGTCCCAGCTTCTGGAGACGGGGTTCCTGGGGATCTTCCTGTGCCCTCTGT
GGACGCTGTCAAGGCTGCCCCAGCATACCCCCACATCCCGGATTGTCCTGTGGGGCTTCCGGTGGCTGATCTTCAGGATCATGCTTGGAG
CAGCCCAGGTGACCAAGCTCGGCGAAGAGGTGAGCCTGCGCTTCCTGAAGAGGGAGGCCAAGCTGTGCGGCTTCCTGCAGAAGAGCTTCC
TGGCCCTGGAGAAGAGAATGAAGGCCTCGGAGAGCTCACGGCTGAAGCTGGAGGGCAGCCTGCGGGGCGAGCTGGAGAGCCGGTGGGAGA
AGCTTCGGGGGCTGATGGAGGAGCGCCTGCGGGCCCTGCAGGGGCAGCATGAGGTGGGGCCGGGCGGGCGGCGGGCAGAGGAGAGCCACC
TCCTGGAGCAGTGCCAGGGCCTGGATGCTGCCGTGGCCCAGCTGACCAAGTTTGTGCAGCAGAACCAGGCGTCGCTGAACCGTGTCCTAC
TGGCCGAGGAGAAAGCCTGGGACGCCAAGGGGCGCTTGGAGGAAAGCCGGGCTGGGGAGCTGGCCGCCTATGTGCAGGAGAACCTGGAGG
CCGCACAGCTGGCTGGCGAGCTGGCCCGGCAGGAGATGCATGGAGAGCTGGTGCTGCTCCGAGAGAAGAGCCGGGCTCTGGAGGCATCCG
TGGCGCAGCTGGCCGGGCAGTTAAAGGAGCTGAGTGGCCATCTCCCGGCTCTGAGCAGCCGGCTCGATCTGCAGGAGCAGATGCTGGGCC
TCAGGCTGTCCGAGGCAAAGACCGAATGGGAAGGTGCAGAGAGGAAGTCCCTGGAGGACCTGGCCAGGTGGCGGAAGGAGGTGACCGAAC
ACCTGCGAGGGGTGCGGGAGAAGGTGGATGGCCTCCCCCAGCAGATAGAGAGTGTCTCCGACAAGTGCCTGCTTCATAAGAGCGACTCAG
ACCTCAGGATTTCCGCCGAAGGCAAGGCCAGGGAGTTCAAGGTTGGGGCCCTGCGGCAGGAGCTGGCCACGCTACTATCATCCGTGCAGC
TGCTAAAGGAAGACAACCCTGGGCGGAAGATCGCGGAGATGCAGGGCAAGCTGGCCACGAACCAAATAATGAAGCTGGAAAACTGCGTCC
AGGCCAACAAGACCATCCAGAACCTCAGGTTCAACACTGAGGCCCGGCTGCGCACGCAGGAGATGGCCACCCTGTGGGAGAGTGTGCTCC
GGCTGTGGAGTGAGGAGGGCCCGCGGACGCCGCTGGGCAGCTGGAAGGCGCTCCCATCCCTGGTGAGGCCGCGGGTCTTCATCAAGGACA
TGGCGCCTGGCAAGGTGGTGCCCATGAACTGCTGGGGCGTGTACCAGGCTGTGAGGTGGCTGCGCTGGAAGGCGTCCCTCATAAAGCTCA
GGGCCCTGCGGAGGCCAGGAGGGGTCCTGGAGAAGCCCCACAGCCAGGAGCAGGTGCAGCAGCTCACACCCTCACTGTTTATCCAGAAAT


Top

FusionGenePPI for LMF1_CCDC154


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LMF1LIPC, LPL, PNLIP, NXPH3, SPINT2, KLK8, TAZ, TMEM30A, FUT9, OGFOD3, ATP1B4, SERPINB11, B4GALT3, ENPP6, ITGB8, WNT4, HTR3C, LYPD6CCDC154AP3B1, EAF1, NOLC1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LMF1_CCDC154


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LMF1_CCDC154


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLMF1C0020557Hypertriglyceridemia1CTD_human