FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19881

FusionGeneSummary for LMBRD1_ZBTB45

check button Fusion gene summary
Fusion gene informationFusion gene name: LMBRD1_ZBTB45
Fusion gene ID: 19881
HgeneTgene
Gene symbol

LMBRD1

ZBTB45

Gene ID

55788

84878

Gene nameLMBR1 domain containing 1zinc finger and BTB domain containing 45
SynonymsC6orf209|LMBD1|MAHCF|NESIZNF499
Cytomap

6q13

19q13.43

Type of geneprotein-codingprotein-coding
Descriptionprobable lysosomal cobalamin transporterHDAg-L-interacting protein NESIhepatitis delta antigen-L interacting proteinliver regeneration p-53 related proteinnuclear export signal-interacting proteinzinc finger and BTB domain-containing protein 45zinc finger protein 499
Modification date2018052220180519
UniProtAcc

Q9NUN5

Q96K62

Ensembl transtripts involved in fusion geneENST00000370577, ENST00000370570, 
ENST00000354590, ENST00000594051, 
ENST00000600990, 
Fusion gene scores* DoF score5 X 4 X 5=1004 X 2 X 5=40
# samples 55
** MAII scorelog2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/40*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: LMBRD1 [Title/Abstract] AND ZBTB45 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-TM-A7CF-01ALMBRD1chr6

70506705

-ZBTB45chr19

59029040

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000370577ENST00000354590LMBRD1chr6

70506705

-ZBTB45chr19

59029040

-
In-frameENST00000370577ENST00000594051LMBRD1chr6

70506705

-ZBTB45chr19

59029040

-
In-frameENST00000370577ENST00000600990LMBRD1chr6

70506705

-ZBTB45chr19

59029040

-
intron-3CDSENST00000370570ENST00000354590LMBRD1chr6

70506705

-ZBTB45chr19

59029040

-
intron-3CDSENST00000370570ENST00000594051LMBRD1chr6

70506705

-ZBTB45chr19

59029040

-
intron-3CDSENST00000370570ENST00000600990LMBRD1chr6

70506705

-ZBTB45chr19

59029040

-

Top

FusionProtFeatures for LMBRD1_ZBTB45


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LMBRD1

Q9NUN5

ZBTB45

Q96K62

Probable lysosomal cobalamin transporter. Required toexport cobalamin from lysosomes allowing its conversion tocofactors. {ECO:0000269|PubMed:19136951}. (Microbial infection) Isoform 3: May play a role in theassembly of hepatitis delta virus (HDV).{ECO:0000269|PubMed:15956556}. May be involved in transcriptional regulation(Probable). In the central nervous system, may play a role inglial cell differentiation (By similarity).{ECO:0000250|UniProtKB:Q52KG4, ECO:0000305}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-1161_1023541Topological domainExtracellular
TgeneZBTB45chr6:70506705chr19:59029040ENST00000354590-03128_1970512Compositional biasNote=Pro-rich
TgeneZBTB45chr6:70506705chr19:59029040ENST00000354590-03299_4010512Compositional biasNote=Pro-rich
TgeneZBTB45chr6:70506705chr19:59029040ENST00000594051-03128_1970512Compositional biasNote=Pro-rich
TgeneZBTB45chr6:70506705chr19:59029040ENST00000594051-03299_4010512Compositional biasNote=Pro-rich
TgeneZBTB45chr6:70506705chr19:59029040ENST00000600990-03128_1970512Compositional biasNote=Pro-rich
TgeneZBTB45chr6:70506705chr19:59029040ENST00000600990-03299_4010512Compositional biasNote=Pro-rich
TgeneZBTB45chr6:70506705chr19:59029040ENST00000354590-0333_960512DomainBTB
TgeneZBTB45chr6:70506705chr19:59029040ENST00000594051-0333_960512DomainBTB
TgeneZBTB45chr6:70506705chr19:59029040ENST00000600990-0333_960512DomainBTB
TgeneZBTB45chr6:70506705chr19:59029040ENST00000354590-03403_4250512Zinc fingerC2H2-type 1
TgeneZBTB45chr6:70506705chr19:59029040ENST00000354590-03431_4530512Zinc fingerC2H2-type 2
TgeneZBTB45chr6:70506705chr19:59029040ENST00000354590-03459_4810512Zinc fingerC2H2-type 3
TgeneZBTB45chr6:70506705chr19:59029040ENST00000354590-03486_5080512Zinc fingerC2H2-type 4
TgeneZBTB45chr6:70506705chr19:59029040ENST00000594051-03403_4250512Zinc fingerC2H2-type 1
TgeneZBTB45chr6:70506705chr19:59029040ENST00000594051-03431_4530512Zinc fingerC2H2-type 2
TgeneZBTB45chr6:70506705chr19:59029040ENST00000594051-03459_4810512Zinc fingerC2H2-type 3
TgeneZBTB45chr6:70506705chr19:59029040ENST00000594051-03486_5080512Zinc fingerC2H2-type 4
TgeneZBTB45chr6:70506705chr19:59029040ENST00000600990-03403_4250512Zinc fingerC2H2-type 1
TgeneZBTB45chr6:70506705chr19:59029040ENST00000600990-03431_4530512Zinc fingerC2H2-type 2
TgeneZBTB45chr6:70506705chr19:59029040ENST00000600990-03459_4810512Zinc fingerC2H2-type 3
TgeneZBTB45chr6:70506705chr19:59029040ENST00000600990-03486_5080512Zinc fingerC2H2-type 4

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-115122_144-115468Topological domainCytoplasmic
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-115166_188-115468Topological domainExtracellular
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-1151_10-115468Topological domainExtracellular
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-115210_305-115468Topological domainCytoplasmic
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-115327_364-115468Topological domainExtracellular
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-11532_50-115468Topological domainCytoplasmic
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-115386_408-115468Topological domainCytoplasmic
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-115430_486-115468Topological domainExtracellular
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-115508_540-115468Topological domainCytoplasmic
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-11572_100-115468Topological domainExtracellular
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-116122_14423541Topological domainCytoplasmic
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-116166_18823541Topological domainExtracellular
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-116210_30523541Topological domainCytoplasmic
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-116327_36423541Topological domainExtracellular
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-11632_5023541Topological domainCytoplasmic
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-116386_40823541Topological domainCytoplasmic
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-116430_48623541Topological domainExtracellular
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-116508_54023541Topological domainCytoplasmic
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-11672_10023541Topological domainExtracellular
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-115101_121-115468TransmembraneHelical%3B Name%3D3
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-11511_31-115468TransmembraneHelical%3B Name%3D1
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-115145_165-115468TransmembraneHelical%3B Name%3D4
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-115189_209-115468TransmembraneHelical%3B Name%3D5
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-115306_326-115468TransmembraneHelical%3B Name%3D6
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-115365_385-115468TransmembraneHelical%3B Name%3D7
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-115409_429-115468TransmembraneHelical%3B Name%3D8
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-115487_507-115468TransmembraneHelical%3B Name%3D9
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370570-11551_71-115468TransmembraneHelical%3B Name%3D2
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-116101_12123541TransmembraneHelical%3B Name%3D3
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-11611_3123541TransmembraneHelical%3B Name%3D1
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-116145_16523541TransmembraneHelical%3B Name%3D4
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-116189_20923541TransmembraneHelical%3B Name%3D5
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-116306_32623541TransmembraneHelical%3B Name%3D6
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-116365_38523541TransmembraneHelical%3B Name%3D7
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-116409_42923541TransmembraneHelical%3B Name%3D8
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-116487_50723541TransmembraneHelical%3B Name%3D9
HgeneLMBRD1chr6:70506705chr19:59029040ENST00000370577-11651_7123541TransmembraneHelical%3B Name%3D2


Top

FusionGeneSequence for LMBRD1_ZBTB45


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LMBRD1_ENST00000370577_chr6_70506705_-_ZBTB45_ENST00000354590_chr19_59029040_-_535aa
MATSGAASAELVIGWCIFGLLLLMAAAEAVHHIHLQNFSRSLLETLNGQRLGGHFCDVTVRIREASLRAHRCVLAAGSPFFQDKLLLGHS
EIRVPPVVPAQTVRQLVEFLYSGSLVVAQGEALQVLTAASVLRIQTVIDECTQIIARARAPGTSAPTPLPTPVPPPLAPAQLRHRLRHLL
AARPPGHPGAAHSRKQRQPARLQLPAPPTPAKAEGPDADPSLSAAPDDRGDEDDEESDDETDGEDGEGGGPGEGQAPPSFPDCAAGFLTA
AADSACEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSTVSTWHDEDGAVPEGCPTETPVQPDCILSGSRPPGVKTPGPPVALFPFHLG
APGPPAPPPSAPSGPAPAPPPAFYPTLQPEAAPSTQLGEVPAPSAAPTTAPSGTPARTPGAEPPTTECSHCRKTFSSRKNYTKHMFIHSG

>In-frame_LMBRD1_ENST00000370577_chr6_70506705_-_ZBTB45_ENST00000594051_chr19_59029040_-_535aa
MATSGAASAELVIGWCIFGLLLLMAAAEAVHHIHLQNFSRSLLETLNGQRLGGHFCDVTVRIREASLRAHRCVLAAGSPFFQDKLLLGHS
EIRVPPVVPAQTVRQLVEFLYSGSLVVAQGEALQVLTAASVLRIQTVIDECTQIIARARAPGTSAPTPLPTPVPPPLAPAQLRHRLRHLL
AARPPGHPGAAHSRKQRQPARLQLPAPPTPAKAEGPDADPSLSAAPDDRGDEDDEESDDETDGEDGEGGGPGEGQAPPSFPDCAAGFLTA
AADSACEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSTVSTWHDEDGAVPEGCPTETPVQPDCILSGSRPPGVKTPGPPVALFPFHLG
APGPPAPPPSAPSGPAPAPPPAFYPTLQPEAAPSTQLGEVPAPSAAPTTAPSGTPARTPGAEPPTTECSHCRKTFSSRKNYTKHMFIHSG

>In-frame_LMBRD1_ENST00000370577_chr6_70506705_-_ZBTB45_ENST00000600990_chr19_59029040_-_535aa
MATSGAASAELVIGWCIFGLLLLMAAAEAVHHIHLQNFSRSLLETLNGQRLGGHFCDVTVRIREASLRAHRCVLAAGSPFFQDKLLLGHS
EIRVPPVVPAQTVRQLVEFLYSGSLVVAQGEALQVLTAASVLRIQTVIDECTQIIARARAPGTSAPTPLPTPVPPPLAPAQLRHRLRHLL
AARPPGHPGAAHSRKQRQPARLQLPAPPTPAKAEGPDADPSLSAAPDDRGDEDDEESDDETDGEDGEGGGPGEGQAPPSFPDCAAGFLTA
AADSACEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSTVSTWHDEDGAVPEGCPTETPVQPDCILSGSRPPGVKTPGPPVALFPFHLG
APGPPAPPPSAPSGPAPAPPPAFYPTLQPEAAPSTQLGEVPAPSAAPTTAPSGTPARTPGAEPPTTECSHCRKTFSSRKNYTKHMFIHSG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LMBRD1_ENST00000370577_chr6_70506705_-_ZBTB45_ENST00000354590_chr19_59029040_-_1605nt
ATGGCGACTTCTGGCGCGGCCTCGGCGGAGCTGGTGATCGGCTGGTGCATATTCGGCCTCTTACTACTGATGGCGGCTGCAGAGGCTGTG
CATCACATACACCTGCAGAACTTCTCACGCTCTCTGCTTGAGACCCTCAATGGGCAGAGGCTTGGGGGACACTTCTGTGACGTGACTGTG
CGCATTCGTGAAGCTTCGCTGCGTGCCCACCGCTGCGTGCTGGCGGCCGGCTCACCCTTCTTCCAAGACAAGCTGCTGCTCGGCCACTCT
GAGATCCGTGTGCCTCCGGTGGTGCCCGCGCAGACAGTGCGACAGCTGGTAGAGTTCCTGTACAGCGGTTCGCTCGTTGTGGCGCAGGGT
GAAGCCCTGCAGGTGCTCACGGCCGCGTCAGTGCTTCGCATACAGACAGTTATCGACGAATGCACGCAGATTATCGCCCGCGCTCGAGCC
CCGGGCACCTCTGCGCCCACGCCCCTGCCCACCCCTGTGCCCCCGCCACTCGCACCTGCGCAGCTGCGTCACCGCCTGCGCCACCTGCTG
GCTGCACGTCCCCCGGGGCACCCCGGTGCTGCACACAGCCGTAAGCAGCGCCAGCCCGCGCGTTTGCAGCTGCCAGCGCCCCCAACACCT
GCCAAGGCTGAGGGGCCTGATGCTGACCCCTCACTGTCCGCGGCCCCTGATGACCGAGGTGACGAGGATGACGAGGAAAGTGACGATGAG
ACCGATGGCGAGGATGGCGAAGGTGGCGGCCCAGGCGAGGGCCAGGCACCTCCTTCCTTCCCAGACTGTGCTGCTGGCTTCCTCACTGCT
GCTGCTGACAGCGCGTGCGAGGAGCCCCCTGCACCCACTGGCCTCGCTGACTACAGTGGTGCCGGGAGAGATTTTCTTCGGGGAGCTGGG
TCAGCTGAGGACGTATTTCCAGACAGCTATGTATCCACTTGGCACGACGAGGATGGCGCTGTCCCCGAAGGCTGTCCCACTGAGACCCCT
GTCCAGCCCGACTGCATACTGTCTGGATCCCGCCCGCCTGGTGTGAAGACCCCAGGGCCGCCCGTTGCACTCTTCCCCTTTCACTTGGGT
GCCCCTGGGCCACCCGCACCACCCCCTTCAGCACCATCGGGGCCAGCCCCTGCGCCCCCACCCGCCTTCTACCCCACACTCCAGCCCGAG
GCAGCCCCCAGTACTCAGCTGGGGGAGGTCCCGGCTCCCTCTGCTGCTCCCACCACGGCCCCCTCAGGCACCCCTGCTCGCACCCCAGGT
GCTGAGCCACCTACGTATGAGTGCAGCCACTGTCGCAAGACGTTCAGCTCCCGGAAAAACTACACCAAGCACATGTTCATCCACTCGGGG
GAGAAGCCGCACCAGTGCGCCGTGTGCTGGCGATCCTTCTCTCTACGCGACTACCTGCTCAAACACATGGTCACGCACACCGGCGTGCGC
GCCTTCCAGTGCGCCGTCTGCGCCAAGCGCTTCACGCAGAAGAGCTCGCTCAACGTGCACATGCGCACTCACCGGCCCGAGCGCGCGCCC

>In-frame_LMBRD1_ENST00000370577_chr6_70506705_-_ZBTB45_ENST00000594051_chr19_59029040_-_1605nt
ATGGCGACTTCTGGCGCGGCCTCGGCGGAGCTGGTGATCGGCTGGTGCATATTCGGCCTCTTACTACTGATGGCGGCTGCAGAGGCTGTG
CATCACATACACCTGCAGAACTTCTCACGCTCTCTGCTTGAGACCCTCAATGGGCAGAGGCTTGGGGGACACTTCTGTGACGTGACTGTG
CGCATTCGTGAAGCTTCGCTGCGTGCCCACCGCTGCGTGCTGGCGGCCGGCTCACCCTTCTTCCAAGACAAGCTGCTGCTCGGCCACTCT
GAGATCCGTGTGCCTCCGGTGGTGCCCGCGCAGACAGTGCGACAGCTGGTAGAGTTCCTGTACAGCGGTTCGCTCGTTGTGGCGCAGGGT
GAAGCCCTGCAGGTGCTCACGGCCGCGTCAGTGCTTCGCATACAGACAGTTATCGACGAATGCACGCAGATTATCGCCCGCGCTCGAGCC
CCGGGCACCTCTGCGCCCACGCCCCTGCCCACCCCTGTGCCCCCGCCACTCGCACCTGCGCAGCTGCGTCACCGCCTGCGCCACCTGCTG
GCTGCACGTCCCCCGGGGCACCCCGGTGCTGCACACAGCCGTAAGCAGCGCCAGCCCGCGCGTTTGCAGCTGCCAGCGCCCCCAACACCT
GCCAAGGCTGAGGGGCCTGATGCTGACCCCTCACTGTCCGCGGCCCCTGATGACCGAGGTGACGAGGATGACGAGGAAAGTGACGATGAG
ACCGATGGCGAGGATGGCGAAGGTGGCGGCCCAGGCGAGGGCCAGGCACCTCCTTCCTTCCCAGACTGTGCTGCTGGCTTCCTCACTGCT
GCTGCTGACAGCGCGTGCGAGGAGCCCCCTGCACCCACTGGCCTCGCTGACTACAGTGGTGCCGGGAGAGATTTTCTTCGGGGAGCTGGG
TCAGCTGAGGACGTATTTCCAGACAGCTATGTATCCACTTGGCACGACGAGGATGGCGCTGTCCCCGAAGGCTGTCCCACTGAGACCCCT
GTCCAGCCCGACTGCATACTGTCTGGATCCCGCCCGCCTGGTGTGAAGACCCCAGGGCCGCCCGTTGCACTCTTCCCCTTTCACTTGGGT
GCCCCTGGGCCACCCGCACCACCCCCTTCAGCACCATCGGGGCCAGCCCCTGCGCCCCCACCCGCCTTCTACCCCACACTCCAGCCCGAG
GCAGCCCCCAGTACTCAGCTGGGGGAGGTCCCGGCTCCCTCTGCTGCTCCCACCACGGCCCCCTCAGGCACCCCTGCTCGCACCCCAGGT
GCTGAGCCACCTACGTATGAGTGCAGCCACTGTCGCAAGACGTTCAGCTCCCGGAAAAACTACACCAAGCACATGTTCATCCACTCGGGG
GAGAAGCCGCACCAGTGCGCCGTGTGCTGGCGATCCTTCTCTCTACGCGACTACCTGCTCAAACACATGGTCACGCACACCGGCGTGCGC
GCCTTCCAGTGCGCCGTCTGCGCCAAGCGCTTCACGCAGAAGAGCTCGCTCAACGTGCACATGCGCACTCACCGGCCCGAGCGCGCGCCC

>In-frame_LMBRD1_ENST00000370577_chr6_70506705_-_ZBTB45_ENST00000600990_chr19_59029040_-_1605nt
ATGGCGACTTCTGGCGCGGCCTCGGCGGAGCTGGTGATCGGCTGGTGCATATTCGGCCTCTTACTACTGATGGCGGCTGCAGAGGCTGTG
CATCACATACACCTGCAGAACTTCTCACGCTCTCTGCTTGAGACCCTCAATGGGCAGAGGCTTGGGGGACACTTCTGTGACGTGACTGTG
CGCATTCGTGAAGCTTCGCTGCGTGCCCACCGCTGCGTGCTGGCGGCCGGCTCACCCTTCTTCCAAGACAAGCTGCTGCTCGGCCACTCT
GAGATCCGTGTGCCTCCGGTGGTGCCCGCGCAGACAGTGCGACAGCTGGTAGAGTTCCTGTACAGCGGTTCGCTCGTTGTGGCGCAGGGT
GAAGCCCTGCAGGTGCTCACGGCCGCGTCAGTGCTTCGCATACAGACAGTTATCGACGAATGCACGCAGATTATCGCCCGCGCTCGAGCC
CCGGGCACCTCTGCGCCCACGCCCCTGCCCACCCCTGTGCCCCCGCCACTCGCACCTGCGCAGCTGCGTCACCGCCTGCGCCACCTGCTG
GCTGCACGTCCCCCGGGGCACCCCGGTGCTGCACACAGCCGTAAGCAGCGCCAGCCCGCGCGTTTGCAGCTGCCAGCGCCCCCAACACCT
GCCAAGGCTGAGGGGCCTGATGCTGACCCCTCACTGTCCGCGGCCCCTGATGACCGAGGTGACGAGGATGACGAGGAAAGTGACGATGAG
ACCGATGGCGAGGATGGCGAAGGTGGCGGCCCAGGCGAGGGCCAGGCACCTCCTTCCTTCCCAGACTGTGCTGCTGGCTTCCTCACTGCT
GCTGCTGACAGCGCGTGCGAGGAGCCCCCTGCACCCACTGGCCTCGCTGACTACAGTGGTGCCGGGAGAGATTTTCTTCGGGGAGCTGGG
TCAGCTGAGGACGTATTTCCAGACAGCTATGTATCCACTTGGCACGACGAGGATGGCGCTGTCCCCGAAGGCTGTCCCACTGAGACCCCT
GTCCAGCCCGACTGCATACTGTCTGGATCCCGCCCGCCTGGTGTGAAGACCCCAGGGCCGCCCGTTGCACTCTTCCCCTTTCACTTGGGT
GCCCCTGGGCCACCCGCACCACCCCCTTCAGCACCATCGGGGCCAGCCCCTGCGCCCCCACCCGCCTTCTACCCCACACTCCAGCCCGAG
GCAGCCCCCAGTACTCAGCTGGGGGAGGTCCCGGCTCCCTCTGCTGCTCCCACCACGGCCCCCTCAGGCACCCCTGCTCGCACCCCAGGT
GCTGAGCCACCTACGTATGAGTGCAGCCACTGTCGCAAGACGTTCAGCTCCCGGAAAAACTACACCAAGCACATGTTCATCCACTCGGGG
GAGAAGCCGCACCAGTGCGCCGTGTGCTGGCGATCCTTCTCTCTACGCGACTACCTGCTCAAACACATGGTCACGCACACCGGCGTGCGC
GCCTTCCAGTGCGCCGTCTGCGCCAAGCGCTTCACGCAGAAGAGCTCGCTCAACGTGCACATGCGCACTCACCGGCCCGAGCGCGCGCCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_LMBRD1_ENST00000370577_chr6_70506705_-_ZBTB45_ENST00000354590_chr19_59029040_-_2359nt
ACTGCGTCCGCACGCGCCCCGCCCCTGAGCAGTCCTTGCTGCCCCGCCCCCGCTCGGCTCGCCGCCAGGGGACGCTAGTGGGTCCAGTCT
CCTTGGCAACCACTTGCTCCTCCCCCTCCGCCCCTTTAACCTTTAGGGTGCGCGGGTGCAGTATATCTCGCGCTCTCTCCCCTTTCCCCC
TCCCCTTTCCCCACCCCGGGCGCTCAGGTTGGTCTGGACCGGAAGCGAAGATGGCGACTTCTGGCGCGGCCTCGGCGGAGCTGGTGATCG
GCTGGTGCATATTCGGCCTCTTACTACTGATGGCGGCTGCAGAGGCTGTGCATCACATACACCTGCAGAACTTCTCACGCTCTCTGCTTG
AGACCCTCAATGGGCAGAGGCTTGGGGGACACTTCTGTGACGTGACTGTGCGCATTCGTGAAGCTTCGCTGCGTGCCCACCGCTGCGTGC
TGGCGGCCGGCTCACCCTTCTTCCAAGACAAGCTGCTGCTCGGCCACTCTGAGATCCGTGTGCCTCCGGTGGTGCCCGCGCAGACAGTGC
GACAGCTGGTAGAGTTCCTGTACAGCGGTTCGCTCGTTGTGGCGCAGGGTGAAGCCCTGCAGGTGCTCACGGCCGCGTCAGTGCTTCGCA
TACAGACAGTTATCGACGAATGCACGCAGATTATCGCCCGCGCTCGAGCCCCGGGCACCTCTGCGCCCACGCCCCTGCCCACCCCTGTGC
CCCCGCCACTCGCACCTGCGCAGCTGCGTCACCGCCTGCGCCACCTGCTGGCTGCACGTCCCCCGGGGCACCCCGGTGCTGCACACAGCC
GTAAGCAGCGCCAGCCCGCGCGTTTGCAGCTGCCAGCGCCCCCAACACCTGCCAAGGCTGAGGGGCCTGATGCTGACCCCTCACTGTCCG
CGGCCCCTGATGACCGAGGTGACGAGGATGACGAGGAAAGTGACGATGAGACCGATGGCGAGGATGGCGAAGGTGGCGGCCCAGGCGAGG
GCCAGGCACCTCCTTCCTTCCCAGACTGTGCTGCTGGCTTCCTCACTGCTGCTGCTGACAGCGCGTGCGAGGAGCCCCCTGCACCCACTG
GCCTCGCTGACTACAGTGGTGCCGGGAGAGATTTTCTTCGGGGAGCTGGGTCAGCTGAGGACGTATTTCCAGACAGCTATGTATCCACTT
GGCACGACGAGGATGGCGCTGTCCCCGAAGGCTGTCCCACTGAGACCCCTGTCCAGCCCGACTGCATACTGTCTGGATCCCGCCCGCCTG
GTGTGAAGACCCCAGGGCCGCCCGTTGCACTCTTCCCCTTTCACTTGGGTGCCCCTGGGCCACCCGCACCACCCCCTTCAGCACCATCGG
GGCCAGCCCCTGCGCCCCCACCCGCCTTCTACCCCACACTCCAGCCCGAGGCAGCCCCCAGTACTCAGCTGGGGGAGGTCCCGGCTCCCT
CTGCTGCTCCCACCACGGCCCCCTCAGGCACCCCTGCTCGCACCCCAGGTGCTGAGCCACCTACGTATGAGTGCAGCCACTGTCGCAAGA
CGTTCAGCTCCCGGAAAAACTACACCAAGCACATGTTCATCCACTCGGGGGAGAAGCCGCACCAGTGCGCCGTGTGCTGGCGATCCTTCT
CTCTACGCGACTACCTGCTCAAACACATGGTCACGCACACCGGCGTGCGCGCCTTCCAGTGCGCCGTCTGCGCCAAGCGCTTCACGCAGA
AGAGCTCGCTCAACGTGCACATGCGCACTCACCGGCCCGAGCGCGCGCCCTGCCCCGCCTGCGGCAAGGTCTTCTCGCACCGCGCGCTGC
TGGAGCGCCACCTGGCGGCGCACCCTGCGCCCTGATGGCGCTGGGGCCTGGCCTCGCCCACGGTGGATCCGGGGCCTCCCGCACAGTCGG
CCACGCCCGCTGCGGGACCCGTGGTTCCCGCCACTAGACCACGCTCCCTCCTGAGCGCAGGTCCTCTCTCTCCCTTCACCCTTTCTCCAT
ACCAGGGCCTAAGTCCGCCTTACTCCTCTCCTCCATGTACTTGAACCCTCCAGGTGGTGCCGGGCTGGGGCTGGGGCTGGTTAGACCACT
TCTGAGAACTGGACTATTTCCTGCGTAAACCGGGCGCTCAGGCGCTTGGACCCGGCCCAAGATTTGACTCCGGTTCTCACCCCGCCCTCT
CCTGGGGTGGTGGTGGGGGCTGGGGGGCCGCTTGCCTGCCCCAGGGTCAGGCTGGGCAAGGTCCCTAGCTCTCTACCCAAGCTGTTACTC
CCTCATGGGGCGCCTAAGGAGACTCAAGTGGACCCATCATATATGGGGGCTGGGCCTCGGGACTCTCGCTCTAATAAAGGACTGTAGGCC

>In-frame_LMBRD1_ENST00000370577_chr6_70506705_-_ZBTB45_ENST00000594051_chr19_59029040_-_2359nt
ACTGCGTCCGCACGCGCCCCGCCCCTGAGCAGTCCTTGCTGCCCCGCCCCCGCTCGGCTCGCCGCCAGGGGACGCTAGTGGGTCCAGTCT
CCTTGGCAACCACTTGCTCCTCCCCCTCCGCCCCTTTAACCTTTAGGGTGCGCGGGTGCAGTATATCTCGCGCTCTCTCCCCTTTCCCCC
TCCCCTTTCCCCACCCCGGGCGCTCAGGTTGGTCTGGACCGGAAGCGAAGATGGCGACTTCTGGCGCGGCCTCGGCGGAGCTGGTGATCG
GCTGGTGCATATTCGGCCTCTTACTACTGATGGCGGCTGCAGAGGCTGTGCATCACATACACCTGCAGAACTTCTCACGCTCTCTGCTTG
AGACCCTCAATGGGCAGAGGCTTGGGGGACACTTCTGTGACGTGACTGTGCGCATTCGTGAAGCTTCGCTGCGTGCCCACCGCTGCGTGC
TGGCGGCCGGCTCACCCTTCTTCCAAGACAAGCTGCTGCTCGGCCACTCTGAGATCCGTGTGCCTCCGGTGGTGCCCGCGCAGACAGTGC
GACAGCTGGTAGAGTTCCTGTACAGCGGTTCGCTCGTTGTGGCGCAGGGTGAAGCCCTGCAGGTGCTCACGGCCGCGTCAGTGCTTCGCA
TACAGACAGTTATCGACGAATGCACGCAGATTATCGCCCGCGCTCGAGCCCCGGGCACCTCTGCGCCCACGCCCCTGCCCACCCCTGTGC
CCCCGCCACTCGCACCTGCGCAGCTGCGTCACCGCCTGCGCCACCTGCTGGCTGCACGTCCCCCGGGGCACCCCGGTGCTGCACACAGCC
GTAAGCAGCGCCAGCCCGCGCGTTTGCAGCTGCCAGCGCCCCCAACACCTGCCAAGGCTGAGGGGCCTGATGCTGACCCCTCACTGTCCG
CGGCCCCTGATGACCGAGGTGACGAGGATGACGAGGAAAGTGACGATGAGACCGATGGCGAGGATGGCGAAGGTGGCGGCCCAGGCGAGG
GCCAGGCACCTCCTTCCTTCCCAGACTGTGCTGCTGGCTTCCTCACTGCTGCTGCTGACAGCGCGTGCGAGGAGCCCCCTGCACCCACTG
GCCTCGCTGACTACAGTGGTGCCGGGAGAGATTTTCTTCGGGGAGCTGGGTCAGCTGAGGACGTATTTCCAGACAGCTATGTATCCACTT
GGCACGACGAGGATGGCGCTGTCCCCGAAGGCTGTCCCACTGAGACCCCTGTCCAGCCCGACTGCATACTGTCTGGATCCCGCCCGCCTG
GTGTGAAGACCCCAGGGCCGCCCGTTGCACTCTTCCCCTTTCACTTGGGTGCCCCTGGGCCACCCGCACCACCCCCTTCAGCACCATCGG
GGCCAGCCCCTGCGCCCCCACCCGCCTTCTACCCCACACTCCAGCCCGAGGCAGCCCCCAGTACTCAGCTGGGGGAGGTCCCGGCTCCCT
CTGCTGCTCCCACCACGGCCCCCTCAGGCACCCCTGCTCGCACCCCAGGTGCTGAGCCACCTACGTATGAGTGCAGCCACTGTCGCAAGA
CGTTCAGCTCCCGGAAAAACTACACCAAGCACATGTTCATCCACTCGGGGGAGAAGCCGCACCAGTGCGCCGTGTGCTGGCGATCCTTCT
CTCTACGCGACTACCTGCTCAAACACATGGTCACGCACACCGGCGTGCGCGCCTTCCAGTGCGCCGTCTGCGCCAAGCGCTTCACGCAGA
AGAGCTCGCTCAACGTGCACATGCGCACTCACCGGCCCGAGCGCGCGCCCTGCCCCGCCTGCGGCAAGGTCTTCTCGCACCGCGCGCTGC
TGGAGCGCCACCTGGCGGCGCACCCTGCGCCCTGATGGCGCTGGGGCCTGGCCTCGCCCACGGTGGATCCGGGGCCTCCCGCACAGTCGG
CCACGCCCGCTGCGGGACCCGTGGTTCCCGCCACTAGACCACGCTCCCTCCTGAGCGCAGGTCCTCTCTCTCCCTTCACCCTTTCTCCAT
ACCAGGGCCTAAGTCCGCCTTACTCCTCTCCTCCATGTACTTGAACCCTCCAGGTGGTGCCGGGCTGGGGCTGGGGCTGGTTAGACCACT
TCTGAGAACTGGACTATTTCCTGCGTAAACCGGGCGCTCAGGCGCTTGGACCCGGCCCAAGATTTGACTCCGGTTCTCACCCCGCCCTCT
CCTGGGGTGGTGGTGGGGGCTGGGGGGCCGCTTGCCTGCCCCAGGGTCAGGCTGGGCAAGGTCCCTAGCTCTCTACCCAAGCTGTTACTC
CCTCATGGGGCGCCTAAGGAGACTCAAGTGGACCCATCATATATGGGGGCTGGGCCTCGGGACTCTCGCTCTAATAAAGGACTGTAGGCC

>In-frame_LMBRD1_ENST00000370577_chr6_70506705_-_ZBTB45_ENST00000600990_chr19_59029040_-_2323nt
ACTGCGTCCGCACGCGCCCCGCCCCTGAGCAGTCCTTGCTGCCCCGCCCCCGCTCGGCTCGCCGCCAGGGGACGCTAGTGGGTCCAGTCT
CCTTGGCAACCACTTGCTCCTCCCCCTCCGCCCCTTTAACCTTTAGGGTGCGCGGGTGCAGTATATCTCGCGCTCTCTCCCCTTTCCCCC
TCCCCTTTCCCCACCCCGGGCGCTCAGGTTGGTCTGGACCGGAAGCGAAGATGGCGACTTCTGGCGCGGCCTCGGCGGAGCTGGTGATCG
GCTGGTGCATATTCGGCCTCTTACTACTGATGGCGGCTGCAGAGGCTGTGCATCACATACACCTGCAGAACTTCTCACGCTCTCTGCTTG
AGACCCTCAATGGGCAGAGGCTTGGGGGACACTTCTGTGACGTGACTGTGCGCATTCGTGAAGCTTCGCTGCGTGCCCACCGCTGCGTGC
TGGCGGCCGGCTCACCCTTCTTCCAAGACAAGCTGCTGCTCGGCCACTCTGAGATCCGTGTGCCTCCGGTGGTGCCCGCGCAGACAGTGC
GACAGCTGGTAGAGTTCCTGTACAGCGGTTCGCTCGTTGTGGCGCAGGGTGAAGCCCTGCAGGTGCTCACGGCCGCGTCAGTGCTTCGCA
TACAGACAGTTATCGACGAATGCACGCAGATTATCGCCCGCGCTCGAGCCCCGGGCACCTCTGCGCCCACGCCCCTGCCCACCCCTGTGC
CCCCGCCACTCGCACCTGCGCAGCTGCGTCACCGCCTGCGCCACCTGCTGGCTGCACGTCCCCCGGGGCACCCCGGTGCTGCACACAGCC
GTAAGCAGCGCCAGCCCGCGCGTTTGCAGCTGCCAGCGCCCCCAACACCTGCCAAGGCTGAGGGGCCTGATGCTGACCCCTCACTGTCCG
CGGCCCCTGATGACCGAGGTGACGAGGATGACGAGGAAAGTGACGATGAGACCGATGGCGAGGATGGCGAAGGTGGCGGCCCAGGCGAGG
GCCAGGCACCTCCTTCCTTCCCAGACTGTGCTGCTGGCTTCCTCACTGCTGCTGCTGACAGCGCGTGCGAGGAGCCCCCTGCACCCACTG
GCCTCGCTGACTACAGTGGTGCCGGGAGAGATTTTCTTCGGGGAGCTGGGTCAGCTGAGGACGTATTTCCAGACAGCTATGTATCCACTT
GGCACGACGAGGATGGCGCTGTCCCCGAAGGCTGTCCCACTGAGACCCCTGTCCAGCCCGACTGCATACTGTCTGGATCCCGCCCGCCTG
GTGTGAAGACCCCAGGGCCGCCCGTTGCACTCTTCCCCTTTCACTTGGGTGCCCCTGGGCCACCCGCACCACCCCCTTCAGCACCATCGG
GGCCAGCCCCTGCGCCCCCACCCGCCTTCTACCCCACACTCCAGCCCGAGGCAGCCCCCAGTACTCAGCTGGGGGAGGTCCCGGCTCCCT
CTGCTGCTCCCACCACGGCCCCCTCAGGCACCCCTGCTCGCACCCCAGGTGCTGAGCCACCTACGTATGAGTGCAGCCACTGTCGCAAGA
CGTTCAGCTCCCGGAAAAACTACACCAAGCACATGTTCATCCACTCGGGGGAGAAGCCGCACCAGTGCGCCGTGTGCTGGCGATCCTTCT
CTCTACGCGACTACCTGCTCAAACACATGGTCACGCACACCGGCGTGCGCGCCTTCCAGTGCGCCGTCTGCGCCAAGCGCTTCACGCAGA
AGAGCTCGCTCAACGTGCACATGCGCACTCACCGGCCCGAGCGCGCGCCCTGCCCCGCCTGCGGCAAGGTCTTCTCGCACCGCGCGCTGC
TGGAGCGCCACCTGGCGGCGCACCCTGCGCCCTGATGGCGCTGGGGCCTGGCCTCGCCCACGGTGGATCCGGGGCCTCCCGCACAGTCGG
CCACGCCCGCTGCGGGACCCGTGGTTCCCGCCACTAGACCACGCTCCCTCCTGAGCGCAGGTCCTCTCTCTCCCTTCACCCTTTCTCCAT
ACCAGGGCCTAAGTCCGCCTTACTCCTCTCCTCCATGTACTTGAACCCTCCAGGTGGTGCCGGGCTGGGGCTGGGGCTGGTTAGACCACT
TCTGAGAACTGGACTATTTCCTGCGTAAACCGGGCGCTCAGGCGCTTGGACCCGGCCCAAGATTTGACTCCGGTTCTCACCCCGCCCTCT
CCTGGGGTGGTGGTGGGGGCTGGGGGGCCGCTTGCCTGCCCCAGGGTCAGGCTGGGCAAGGTCCCTAGCTCTCTACCCAAGCTGTTACTC


Top

FusionGenePPI for LMBRD1_ZBTB45


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LMBRD1HNRNPC, CSGALNACT2, MBOAT7ZBTB45MED31, ZNF131


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LMBRD1_ZBTB45


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LMBRD1_ZBTB45


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource