FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19501

FusionGeneSummary for LASP1_RBX1

check button Fusion gene summary
Fusion gene informationFusion gene name: LASP1_RBX1
Fusion gene ID: 19501
HgeneTgene
Gene symbol

LASP1

RBX1

Gene ID

3927

9978

Gene nameLIM and SH3 protein 1ring-box 1
SynonymsLasp-1|MLN50BA554C12.1|RNF75|ROC1
Cytomap

17q12

22q13.2

Type of geneprotein-codingprotein-coding
DescriptionLIM and SH3 domain protein 1metastatic lymph node gene 50 proteinE3 ubiquitin-protein ligase RBX1E3 ubiquitin-protein transferase RBX1RING finger protein 75RING-box protein 1ZYP proteinregulator of cullins 1ring-box 1, E3 ubiquitin protein ligase
Modification date2018052220180523
UniProtAcc

Q14847

P62877

Ensembl transtripts involved in fusion geneENST00000318008, ENST00000433206, 
ENST00000435347, 
ENST00000216225, 
Fusion gene scores* DoF score9 X 9 X 4=3246 X 4 X 5=120
# samples 116
** MAII scorelog2(11/324*10)=-1.55849028935997
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: LASP1 [Title/Abstract] AND RBX1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneRBX1

GO:0006513

protein monoubiquitination

22358839

TgeneRBX1

GO:0016567

protein ubiquitination

15103331|17543862|20389280

TgeneRBX1

GO:0031146

SCF-dependent proteasomal ubiquitin-dependent protein catabolic process

15103331

TgeneRBX1

GO:0043161

proteasome-mediated ubiquitin-dependent protein catabolic process

20389280

TgeneRBX1

GO:0045116

protein neddylation

19250909


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPAADTCGA-FB-AAQ3-01ALASP1chr17

37046757

+RBX1chr22

41349559

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000318008ENST00000216225LASP1chr17

37046757

+RBX1chr22

41349559

+
intron-3CDSENST00000433206ENST00000216225LASP1chr17

37046757

+RBX1chr22

41349559

+
In-frameENST00000435347ENST00000216225LASP1chr17

37046757

+RBX1chr22

41349559

+

Top

FusionProtFeatures for LASP1_RBX1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LASP1

Q14847

RBX1

P62877

Plays an important role in the regulation of dynamicactin-based, cytoskeletal activities. Agonist-dependent changes inLASP1 phosphorylation may also serve to regulate actin-associatedion transport activities, not only in the parietal cell but alsoin certain other F-actin-rich secretory epithelial cell types (Bysimilarity). {ECO:0000250}. E3 ubiquitin ligase component of multiple cullin-RING-based E3 ubiquitin-protein ligase (CRLs) complexes which mediatethe ubiquitination and subsequent proteasomal degradation oftarget proteins, including proteins involved in cell cycleprogression, signal transduction, transcription and transcription-coupled nucleotide excision repair. CRLs complexes and ARIH1collaborate in tandem to mediate ubiquitination of targetproteins, ARIH1 mediating addition of the first ubiquitin on CRLstargets (PubMed:27565346). The functional specificity of the E3ubiquitin-protein ligase complexes depends on the variablesubstrate recognition components. As a component of the CSAcomplex promotes the ubiquitination of ERCC6 resulting inproteasomal degradation. Through the RING-type zinc finger, seemsto recruit the E2 ubiquitination enzyme, like CDC34, to thecomplex and brings it into close proximity to the substrate.Probably also stimulates CDC34 autoubiquitination. May be requiredfor histone H3 and histone H4 ubiquitination in response toultraviolet and for subsequent DNA repair. Promotes theneddylation of CUL1, CUL2, CUL4 and CUL4 via its interaction withUBE2M. Involved in the ubiquitination of KEAP1, ENC1 and KLHL41.In concert with ATF2 and CUL3, promotes degradation of KAT5thereby attenuating its ability to acetylate and activate ATM.{ECO:0000269|PubMed:10579999, ECO:0000269|PubMed:11027288,ECO:0000269|PubMed:15983046, ECO:0000269|PubMed:16678110,ECO:0000269|PubMed:16751180, ECO:0000269|PubMed:18397884,ECO:0000269|PubMed:19112177, ECO:0000269|PubMed:19679664,ECO:0000269|PubMed:23455478, ECO:0000269|PubMed:27565346,ECO:0000269|PubMed:29769719}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLASP1chr17:37046757chr22:41349559ENST00000318008+375_5683262DomainLIM zinc-binding
HgeneLASP1chr17:37046757chr22:41349559ENST00000435347+385_5683708DomainLIM zinc-binding
TgeneRBX1chr17:37046757chr22:41349559ENST00000216225+0553_9826109Zinc fingerRING-type

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLASP1chr17:37046757chr22:41349559ENST00000318008+37201_20483262Compositional biasNote=Poly-Gly
HgeneLASP1chr17:37046757chr22:41349559ENST00000435347+38201_20483708Compositional biasNote=Poly-Gly
HgeneLASP1chr17:37046757chr22:41349559ENST00000318008+37202_26183262DomainSH3
HgeneLASP1chr17:37046757chr22:41349559ENST00000435347+38202_26183708DomainSH3
HgeneLASP1chr17:37046757chr22:41349559ENST00000318008+3761_9583262RepeatNote=Nebulin 1
HgeneLASP1chr17:37046757chr22:41349559ENST00000318008+3797_13183262RepeatNote=Nebulin 2
HgeneLASP1chr17:37046757chr22:41349559ENST00000435347+3861_9583708RepeatNote=Nebulin 1
HgeneLASP1chr17:37046757chr22:41349559ENST00000435347+3897_13183708RepeatNote=Nebulin 2


Top

FusionGeneSequence for LASP1_RBX1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LASP1_ENST00000318008_chr17_37046757_+_RBX1_ENST00000216225_chr22_41349559_+_166aa
MNPNCARCGKIVTPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQWNAVALW

>In-frame_LASP1_ENST00000435347_chr17_37046757_+_RBX1_ENST00000216225_chr22_41349559_+_166aa
MNPNCARCGKIVTPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQSFTMVADTPENLRLKQQSELQSQWNAVALW


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LASP1_ENST00000318008_chr17_37046757_+_RBX1_ENST00000216225_chr22_41349559_+_498nt
ATGAACCCCAACTGCGCCCGGTGCGGCAAGATCGTGTATCCCACGGAGAAGGTGAACTGTCTGGATAAGTTCTGGCATAAAGCATGCTTC
CATTGCGAGACCTGCAAGATGACACTGAACATGAAGAACTACAAGGGCTACGAGAAGAAGCCCTACTGCAACGCACACTACCCCAAGCAG
TCCTTCACCATGGTGGCGGACACCCCGGAAAACCTTCGCCTCAAGCAACAGAGTGAGCTCCAGAGTCAGTGGAATGCAGTAGCCCTCTGG
GCCTGGGATATTGTGGTTGATAACTGTGCCATCTGCAGGAACCACATTATGGATCTTTGCATAGAATGTCAAGCTAACCAGGCGTCCGCT
ACTTCAGAAGAGTGTACTGTCGCATGGGGAGTCTGTAACCATGCTTTTCACTTCCACTGCATCTCTCGCTGGCTCAAAACACGACAGGTG

>In-frame_LASP1_ENST00000435347_chr17_37046757_+_RBX1_ENST00000216225_chr22_41349559_+_498nt
ATGAACCCCAACTGCGCCCGGTGCGGCAAGATCGTGTATCCCACGGAGAAGGTGAACTGTCTGGATAAGTTCTGGCATAAAGCATGCTTC
CATTGCGAGACCTGCAAGATGACACTGAACATGAAGAACTACAAGGGCTACGAGAAGAAGCCCTACTGCAACGCACACTACCCCAAGCAG
TCCTTCACCATGGTGGCGGACACCCCGGAAAACCTTCGCCTCAAGCAACAGAGTGAGCTCCAGAGTCAGTGGAATGCAGTAGCCCTCTGG
GCCTGGGATATTGTGGTTGATAACTGTGCCATCTGCAGGAACCACATTATGGATCTTTGCATAGAATGTCAAGCTAACCAGGCGTCCGCT
ACTTCAGAAGAGTGTACTGTCGCATGGGGAGTCTGTAACCATGCTTTTCACTTCCACTGCATCTCTCGCTGGCTCAAAACACGACAGGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_LASP1_ENST00000318008_chr17_37046757_+_RBX1_ENST00000216225_chr22_41349559_+_1650nt
GCAGTCAGCCTGAGAGCGCTGAGGCGCCAGCACCGCGGGCCCCGCCGTCCCCCCAGGAACCCGCCCCCGCGCAGCCCCACGTCGCCCGGA
GAGCGCGCCTCGCTGCGCGTGCCCTTGCCCGCGCCCGAGGCGCGTGCCCGCCCCAGTGCAGCCCCTCCTCCCCGCTGTGTTTATTAGGGG
AAGGAGGGCGGAGGCGGAGGCCAGTTCCCCAGCTCCAGCCGCCGTCGCTGCTGCCTGTGTAGTTGCAGCCGCGGCCGCCTCCCGCCAGCT
CGCCTCGGGGAACAGGACGCGCGTGAGCTCAGGCGTCCCCGCCCCAGCTTTTCTCGGAACCATGAACCCCAACTGCGCCCGGTGCGGCAA
GATCGTGTATCCCACGGAGAAGGTGAACTGTCTGGATAAGTTCTGGCATAAAGCATGCTTCCATTGCGAGACCTGCAAGATGACACTGAA
CATGAAGAACTACAAGGGCTACGAGAAGAAGCCCTACTGCAACGCACACTACCCCAAGCAGTCCTTCACCATGGTGGCGGACACCCCGGA
AAACCTTCGCCTCAAGCAACAGAGTGAGCTCCAGAGTCAGTGGAATGCAGTAGCCCTCTGGGCCTGGGATATTGTGGTTGATAACTGTGC
CATCTGCAGGAACCACATTATGGATCTTTGCATAGAATGTCAAGCTAACCAGGCGTCCGCTACTTCAGAAGAGTGTACTGTCGCATGGGG
AGTCTGTAACCATGCTTTTCACTTCCACTGCATCTCTCGCTGGCTCAAAACACGACAGGTGTGTCCATTGGACAACAGAGAGTGGGAATT
CCAAAAGTATGGGCACTAGGAAAAGACTTCTTCCATCAAGCTTAATTGTTTTGTTATTCATTTAATGACTTTCCCTGCTGTTACCTAATT
ACAAATTGGATGGAACTGTGTTTTTTTCTGCTTTGTTTTTTCAGTTTGCTGTTTCTGTAGCCATATTGTATTCTGTGTCAAATAAAGTCC
AGTTGGATTCTGGAACGGATGCTCTCTCTTGTGTATGTGAACAAAGTGAACATAAATGAAGAGTCTCCCCTTCCAAGGCTGAAAACTCAG
CTTTTGAAAGTGAAATGTTTGTTCATCGGGGCCAGAGCAGGGTTGTCCTCTGAGCGCATCACTTAGTGACGAGGAATCCAACAGCTCAAG
GCAGAGTGTGGATCACCGGCTCCCGAAAACAGCAGTCAGCCCTTCTTTCTCCTGTGTGACAGCAGTGGGCAGCTGAAAGAGGGAAGAATG
TGGGATTCAGTCATCAAACCCAGTTCTGAGTCCTGGTTCCACAGCTTGGGTACTGATGGCAATCTTGGCCAAGTTGTCTCTCTACTCTGA
ACTTTCCTCCTCTGTACTGTGGGCTTCTGAGGACTAAGTGGCATCATGTGGGCACAGAGAGAAGCTTTGTAAAATGTAAAACCGCTATAC
AAATGTGACCTTTGGTTGTGTATGACAGCAGTCCCCAACCTTTTTGCCACCAGGGATTGGTTTCATGGAAGACGATTTTTCCATGGACCG
GGGGTGGGGCGGGGGTGTGCTTGGGGATGGTTTTGGAACTGTTCCACCTGAGATCATGAGGCAGTAGATGGACCGCGCAACCTAGATCCC

>In-frame_LASP1_ENST00000435347_chr17_37046757_+_RBX1_ENST00000216225_chr22_41349559_+_1366nt
GGACGCGCGTGAGCTCAGGCGTCCCCGCCCCAGCTTTTCTCGGAACCATGAACCCCAACTGCGCCCGGTGCGGCAAGATCGTGTATCCCA
CGGAGAAGGTGAACTGTCTGGATAAGTTCTGGCATAAAGCATGCTTCCATTGCGAGACCTGCAAGATGACACTGAACATGAAGAACTACA
AGGGCTACGAGAAGAAGCCCTACTGCAACGCACACTACCCCAAGCAGTCCTTCACCATGGTGGCGGACACCCCGGAAAACCTTCGCCTCA
AGCAACAGAGTGAGCTCCAGAGTCAGTGGAATGCAGTAGCCCTCTGGGCCTGGGATATTGTGGTTGATAACTGTGCCATCTGCAGGAACC
ACATTATGGATCTTTGCATAGAATGTCAAGCTAACCAGGCGTCCGCTACTTCAGAAGAGTGTACTGTCGCATGGGGAGTCTGTAACCATG
CTTTTCACTTCCACTGCATCTCTCGCTGGCTCAAAACACGACAGGTGTGTCCATTGGACAACAGAGAGTGGGAATTCCAAAAGTATGGGC
ACTAGGAAAAGACTTCTTCCATCAAGCTTAATTGTTTTGTTATTCATTTAATGACTTTCCCTGCTGTTACCTAATTACAAATTGGATGGA
ACTGTGTTTTTTTCTGCTTTGTTTTTTCAGTTTGCTGTTTCTGTAGCCATATTGTATTCTGTGTCAAATAAAGTCCAGTTGGATTCTGGA
ACGGATGCTCTCTCTTGTGTATGTGAACAAAGTGAACATAAATGAAGAGTCTCCCCTTCCAAGGCTGAAAACTCAGCTTTTGAAAGTGAA
ATGTTTGTTCATCGGGGCCAGAGCAGGGTTGTCCTCTGAGCGCATCACTTAGTGACGAGGAATCCAACAGCTCAAGGCAGAGTGTGGATC
ACCGGCTCCCGAAAACAGCAGTCAGCCCTTCTTTCTCCTGTGTGACAGCAGTGGGCAGCTGAAAGAGGGAAGAATGTGGGATTCAGTCAT
CAAACCCAGTTCTGAGTCCTGGTTCCACAGCTTGGGTACTGATGGCAATCTTGGCCAAGTTGTCTCTCTACTCTGAACTTTCCTCCTCTG
TACTGTGGGCTTCTGAGGACTAAGTGGCATCATGTGGGCACAGAGAGAAGCTTTGTAAAATGTAAAACCGCTATACAAATGTGACCTTTG
GTTGTGTATGACAGCAGTCCCCAACCTTTTTGCCACCAGGGATTGGTTTCATGGAAGACGATTTTTCCATGGACCGGGGGTGGGGCGGGG
GTGTGCTTGGGGATGGTTTTGGAACTGTTCCACCTGAGATCATGAGGCAGTAGATGGACCGCGCAACCTAGATCCCTCACATGCACGGTT


Top

FusionGenePPI for LASP1_RBX1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LASP1TRIP13, PLSCR1, FHL3, MDFI, ZYX, TERF1, TINF2, ACD, POT1, ATXN1, FN1, DAZAP2, CD81, GOLGA2, PSMA3, REL, TRIM27, TCF4, FXR2, SPRY2, ARHGEF15, ZC2HC1A, THAP1, SEPT3, LZTS2, RHOXF2, KRTAP4-2, ZBTB9, ZDHHC17, CCDC8, ILK, HAX1, DNAAF2, THAP8, FYTTD1, NFYA, OR10H3, RDH12, SLC25A32, SLC25A44, C11orf65, TAS2R41, AHNAK, ARFGAP1, DDB1, EIF4B, HSPB1, HSPE1, LGALS1, MAP4, NXF1, CRK, STAT3, SH2D2A, CEP170, FBF1, SCLT1, DCTN1, U2AF2, CDH1, ZNF764, SNRNP27, PGK1, EZR, SPTAN1, NCL, UHRF1, NAT10, PDIA5, API5, KRT18, KRT2, G3BP2, AP3M1, NCOR2, CDK12, MYO1C, ACTR3, CLTC, DNMT1, EHMT2, SNAI1, HIST1H3A, TRIM25, TESRBX1VHL, DET1, RFWD2, SKP1, CAND1, CUL1, CCND1, CCND2, CCND3, CUL7, CUL2, CUL4A, CUL4B, NEDD8, CUL3, HSPA8, FBXO3, FBXO22, TUBA1B, ACTG1, HSPA1A, FBXW8, CDC34, FBXO18, DCUN1D1, SKP2, CUL5, ABTB2, RPS6KB1, PTGS2, FBXO11, PGAM5, PSMA6, DDB1, DDB2, FBXO31, ZC3HC1, KEAP1, GAN, ENC1, KLHL41, DIO2, ARID1B, TCEB2, SMAD3, FBXW11, CASP3, ING3, VPRBP, CORO7, UBXN7, TRPC4AP, FBXO42, CRBN, RICTOR, CSNK1E, MAPK8IP2, MAP3K7, TAB1, FRZB, ZAK, RAG1, MED8, TCEB1, HOXB4, GLMN, ELAVL1, MCM10, PRAME, BTRC, FBXW7, CUL9, FBXW2, FBXL5, FBXO2, FBXO6, FBXO44, FBXO17, FBXO27, PSMA2, KLHL7, ERCC8, FBXO25, CCNF, FBXL12, PML, HINT1, GRK5, MKNK2, UBE2D1, LRR1, LRRC14, DDA1, COPS3, COPS4, COPS6, COPS5, COPS7A, UBE2D3, UBE2D2, UBE2M, UBE2G1, MYB, APP, SESN2, SESN1, KLHL3, UBE2G2, FEM1B, HIF1A, UBE2R2, FBXL15, UBE2L3, TRIM27, RNF126, TRIM74, HAX1, SERTAD1, OS9, RHOBTB3, DCUN1D5, GFPT1, HIST1H4A, MTSS1, VRK2, NEDD4, MAP4K1, DCUN1D3, DAB2IP, TP53, UBE2L6, ESR1, IP6K1, GPS1, UBE2E3, RBX1, HIST1H1A, HIST1H1C, CDKN1B, SAMHD1, EEF1A1, HSPB1, KBTBD6, KBTBD7, FBXO21, IBTK, EZH2, GATA2, GHR, MAGEC2, KDM2B, RHOB, CREB3L3, DCUN1D2, DCUN1D4, KCTD17, DTL, UBE2E2, UVRAG, FBXO7, KLHL18, AIRE, FBXO32, ERBB2IP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LASP1_RBX1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LASP1_RBX1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLASP1C0004352Autistic Disorder1CTD_human
HgeneLASP1C0036341Schizophrenia1PSYGENET
TgeneRBX1C0038325Stevens-Johnson Syndrome1CTD_human