FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19496

FusionGeneSummary for LASP1_ARHGAP23

check button Fusion gene summary
Fusion gene informationFusion gene name: LASP1_ARHGAP23
Fusion gene ID: 19496
HgeneTgene
Gene symbol

LASP1

ARHGAP23

Gene ID

3927

57636

Gene nameLIM and SH3 protein 1Rho GTPase activating protein 23
SynonymsLasp-1|MLN50-
Cytomap

17q12

17q12

Type of geneprotein-codingprotein-coding
DescriptionLIM and SH3 domain protein 1metastatic lymph node gene 50 proteinrho GTPase-activating protein 23rho-type GTPase-activating protein 23
Modification date2018052220180519
UniProtAcc

Q14847

Q9P227

Ensembl transtripts involved in fusion geneENST00000318008, ENST00000433206, 
ENST00000435347, 
ENST00000431231, 
ENST00000437668, ENST00000582409, 
ENST00000443378, 
Fusion gene scores* DoF score9 X 9 X 4=3246 X 2 X 4=48
# samples 116
** MAII scorelog2(11/324*10)=-1.55849028935997
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/48*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: LASP1 [Title/Abstract] AND ARHGAP23 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A8-A07I-01ALASP1chr17

37026511

+ARHGAP23chr17

36614346

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000318008ENST00000431231LASP1chr17

37026511

+ARHGAP23chr17

36614346

+
In-frameENST00000318008ENST00000437668LASP1chr17

37026511

+ARHGAP23chr17

36614346

+
5CDS-3UTRENST00000318008ENST00000582409LASP1chr17

37026511

+ARHGAP23chr17

36614346

+
5CDS-5UTRENST00000318008ENST00000443378LASP1chr17

37026511

+ARHGAP23chr17

36614346

+
5UTR-3CDSENST00000433206ENST00000431231LASP1chr17

37026511

+ARHGAP23chr17

36614346

+
5UTR-3CDSENST00000433206ENST00000437668LASP1chr17

37026511

+ARHGAP23chr17

36614346

+
5UTR-3UTRENST00000433206ENST00000582409LASP1chr17

37026511

+ARHGAP23chr17

36614346

+
5UTR-5UTRENST00000433206ENST00000443378LASP1chr17

37026511

+ARHGAP23chr17

36614346

+
In-frameENST00000435347ENST00000431231LASP1chr17

37026511

+ARHGAP23chr17

36614346

+
In-frameENST00000435347ENST00000437668LASP1chr17

37026511

+ARHGAP23chr17

36614346

+
5CDS-3UTRENST00000435347ENST00000582409LASP1chr17

37026511

+ARHGAP23chr17

36614346

+
5CDS-5UTRENST00000435347ENST00000443378LASP1chr17

37026511

+ARHGAP23chr17

36614346

+

Top

FusionProtFeatures for LASP1_ARHGAP23


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LASP1

Q14847

ARHGAP23

Q9P227

Plays an important role in the regulation of dynamicactin-based, cytoskeletal activities. Agonist-dependent changes inLASP1 phosphorylation may also serve to regulate actin-associatedion transport activities, not only in the parietal cell but alsoin certain other F-actin-rich secretory epithelial cell types (Bysimilarity). {ECO:0000250}. GTPase activator for the Rho-type GTPases by convertingthem to an inactive GDP-bound state. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneARHGAP23chr17:37026511chr17:36614346ENST00000431231+0241320_1405211492Compositional biasNote=Arg-rich
TgeneARHGAP23chr17:37026511chr17:36614346ENST00000431231+024183_279211492Compositional biasNote=Pro-rich
TgeneARHGAP23chr17:37026511chr17:36614346ENST00000437668+0251320_1405211145Compositional biasNote=Arg-rich
TgeneARHGAP23chr17:37026511chr17:36614346ENST00000437668+025183_279211145Compositional biasNote=Pro-rich
TgeneARHGAP23chr17:37026511chr17:36614346ENST00000431231+024688_808211492DomainPH
TgeneARHGAP23chr17:37026511chr17:36614346ENST00000431231+02471_155211492DomainPDZ
TgeneARHGAP23chr17:37026511chr17:36614346ENST00000431231+024905_1097211492DomainRho-GAP
TgeneARHGAP23chr17:37026511chr17:36614346ENST00000437668+025688_808211145DomainPH
TgeneARHGAP23chr17:37026511chr17:36614346ENST00000437668+02571_155211145DomainPDZ
TgeneARHGAP23chr17:37026511chr17:36614346ENST00000437668+025905_1097211145DomainRho-GAP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLASP1chr17:37026511chr17:36614346ENST00000318008+17201_20423262Compositional biasNote=Poly-Gly
HgeneLASP1chr17:37026511chr17:36614346ENST00000435347+18201_20423708Compositional biasNote=Poly-Gly
HgeneLASP1chr17:37026511chr17:36614346ENST00000318008+17202_26123262DomainSH3
HgeneLASP1chr17:37026511chr17:36614346ENST00000318008+175_5623262DomainLIM zinc-binding
HgeneLASP1chr17:37026511chr17:36614346ENST00000435347+18202_26123708DomainSH3
HgeneLASP1chr17:37026511chr17:36614346ENST00000435347+185_5623708DomainLIM zinc-binding
HgeneLASP1chr17:37026511chr17:36614346ENST00000318008+1761_9523262RepeatNote=Nebulin 1
HgeneLASP1chr17:37026511chr17:36614346ENST00000318008+1797_13123262RepeatNote=Nebulin 2
HgeneLASP1chr17:37026511chr17:36614346ENST00000435347+1861_9523708RepeatNote=Nebulin 1
HgeneLASP1chr17:37026511chr17:36614346ENST00000435347+1897_13123708RepeatNote=Nebulin 2


Top

FusionGeneSequence for LASP1_ARHGAP23


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LASP1_ENST00000318008_chr17_37026511_+_ARHGAP23_ENST00000431231_chr17_36614346_+_1494aa
MNPNCARCGKIVTPTEKVNCLDKLPLGPRDGCSPRRPFPWQGPRTLLLYKSPQDGFGFTLRHFIVYPPESAVHCSLKEEENGGRGGGPSP
RYRLEPMDTIFVKNVKEDGPAHRAGLRTGDRLVKVNGESVIGKTYSQVIALIQNSDDTLELSIMPKDEDILQLAYSQDAYLKGNEPTSGE
ARSIPEPPPICYPRKTYAPPARASTRATMVPEPTSALPSDPRSPAAWSDPGLRVPPAARAHLDNSSLGMSQPRPSPGAFPHLSSEPRTPR
AFPEPGSRVPPSRLECQQALSHWLSNQVPRRAGERRCPAMAPRARSASQDRLEEVAAPRPWPCSTSQDALSQLGQEGWHRARSDDYLSRA
TRSAEALGPGALVSPRFERCGWASQRSSARTPACPTRDLPGPQAPPPSGLQGLDDLGYIGYRSYSPSFQRRTGLLHALSFRDSPFGGLPT
FNLAQSPASFPPEASEPPRVVRPEPSTRALEPPAEDRGDEVVLRQKPPTGRKVQLTPARQMNLGFGDESPEPEASGRGERLGRKVAPLAT
TEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFTLGRHYSQDCSSIKAGRRSSYLLAITTERSKSCDDGL
NTFRDEGRVLRRLPNRIPSLRMLRSFFTDGSLDSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLTTKQILTKKGKKAGSGLRQWKRV
YAALRARSLSLSKERREPGPAAAGAAAAGAGEDEAAPVCIGSCLVDISYSETKRRHVFRLTTADFCETLFQAEDRDDMLGWIRAIRENSR
AEGEDPGCANQALISKKLNDTRKVSHSSGPKADSSPKGSRGLGGLKSEFLKQSAARGLRTQDLPAGSKDDSAAAPKTPWGINIIKKNKKA
APRAFGVRLEECQPATENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNRGPGDINLQDERWQDLNVISSLLKSFFRKL
PEPLFTDDKYNDFIEANRIEDARERMRTLRKLIRDLPGHYTETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTH
MPDRYKIVETLIQHSDWFFSDEEDKGERTPVGDKEPQAVPNIEYLLPNIGRTVPPGDPGSDSTTCSSAKSKGSWAPKKEPYAREMLAISF
ISAVNRKRKKRREARGLGSSTDDDSEQEAHKPGAGATAPGTQERPQGPLPGAVAPEAPGRLSPPAAPEERPAADTRSIVSGYSTLSTMDR
SVCSGASGRRAGAGDEADDERSELSHVETDTEGAAGAGPGGRLTRRPSFSSHHLMPCDTLARRRLARGRPDGEGAGRGGPRAPEPPGSAS
SSSQESLRPPAAALASRPSRMEALRLRLRGTADDMLAVRLRRPLSPETRRRRSSWRRHTVVVQSPLTDLNFNEWKELGGGGPPEPAGARA

>In-frame_LASP1_ENST00000318008_chr17_37026511_+_ARHGAP23_ENST00000437668_chr17_36614346_+_1147aa
MNPNCARCGKIVTPTEKVNCLDKLPLGPRDGCSPRRPFPWQGPRTLLLYKSPQDGFGFTLRHFIVYPPESAVHCSLKEEENGGRGGGPSP
RYRLEPMDTIFVKNVKEDGPAHRAGLRTGDRLVKVNGESVIGKTYSQVIALIQNSDDTLELSIMPKDEDILQLAYSQDAYLKGNEPTSGE
ARSIPEPPPICYPRKTYAPPARASTRATMVPEPTSALPSDPRSPAAWSDPGLRVPPAARAHLDNSSLGMSQPRPSPGAFPHLSSEPRTPR
AFPEPGSRVPPSRLECQQALSHWLSNQVPRRAGERRCPAMAPRARSASQDRLEEVAAPRPWPCSTSQDALSQLGQEGWHRARSDDYLSRA
TRSAEALGPGALVSPRFERCGWASQRSSARTPACPTRDLPGPQAPPPSGLQGLDDLGYIGYRSYSPSFQRRTGLLHALSFRDSPFGGLPT
FNLAQSPASFPPEASEPPRVVRPEPSTRALEPPAEDRGDEVVLRQKPPTGRKVQLTPARQMNLGFGDESPEPEASGRGERLGRKVAPLAT
TEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFTLGRHYSQDCSSIKAGRRSSYLLAITTERSKSCDDGL
NTFRDEGRVLRRLPNRIPSLRMLRSFFTDGSLDSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLTTKQILTKKGKKAGSGLRQWKRV
YAALRARSLSLSKERREPGPAAAGAAAAGAGEDEAAPVCIGSCLVDISYSETKRRHVFRLTTADFCETLFQAEDRDDMLGWIRAIRENSR
AEGEDPGCANQALISKKLNDTRKVSHSSGPKADSSPKGSRGLGGLKSEFLKQSAARGLRTQDLPAGSKDDSAAAPKTPWGINIIKKNKKA
APRAFGVRLEECQPATENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNRGPGDINLQDERWQDLNVISSLLKSFFRKL
PEPLFTDDKYNDFIEANRIEDARERMRTLRKLIRDLPGHYTETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTH

>In-frame_LASP1_ENST00000435347_chr17_37026511_+_ARHGAP23_ENST00000431231_chr17_36614346_+_1494aa
MNPNCARCGKIVTPTEKVNCLDKLPLGPRDGCSPRRPFPWQGPRTLLLYKSPQDGFGFTLRHFIVYPPESAVHCSLKEEENGGRGGGPSP
RYRLEPMDTIFVKNVKEDGPAHRAGLRTGDRLVKVNGESVIGKTYSQVIALIQNSDDTLELSIMPKDEDILQLAYSQDAYLKGNEPTSGE
ARSIPEPPPICYPRKTYAPPARASTRATMVPEPTSALPSDPRSPAAWSDPGLRVPPAARAHLDNSSLGMSQPRPSPGAFPHLSSEPRTPR
AFPEPGSRVPPSRLECQQALSHWLSNQVPRRAGERRCPAMAPRARSASQDRLEEVAAPRPWPCSTSQDALSQLGQEGWHRARSDDYLSRA
TRSAEALGPGALVSPRFERCGWASQRSSARTPACPTRDLPGPQAPPPSGLQGLDDLGYIGYRSYSPSFQRRTGLLHALSFRDSPFGGLPT
FNLAQSPASFPPEASEPPRVVRPEPSTRALEPPAEDRGDEVVLRQKPPTGRKVQLTPARQMNLGFGDESPEPEASGRGERLGRKVAPLAT
TEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFTLGRHYSQDCSSIKAGRRSSYLLAITTERSKSCDDGL
NTFRDEGRVLRRLPNRIPSLRMLRSFFTDGSLDSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLTTKQILTKKGKKAGSGLRQWKRV
YAALRARSLSLSKERREPGPAAAGAAAAGAGEDEAAPVCIGSCLVDISYSETKRRHVFRLTTADFCETLFQAEDRDDMLGWIRAIRENSR
AEGEDPGCANQALISKKLNDTRKVSHSSGPKADSSPKGSRGLGGLKSEFLKQSAARGLRTQDLPAGSKDDSAAAPKTPWGINIIKKNKKA
APRAFGVRLEECQPATENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNRGPGDINLQDERWQDLNVISSLLKSFFRKL
PEPLFTDDKYNDFIEANRIEDARERMRTLRKLIRDLPGHYTETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTH
MPDRYKIVETLIQHSDWFFSDEEDKGERTPVGDKEPQAVPNIEYLLPNIGRTVPPGDPGSDSTTCSSAKSKGSWAPKKEPYAREMLAISF
ISAVNRKRKKRREARGLGSSTDDDSEQEAHKPGAGATAPGTQERPQGPLPGAVAPEAPGRLSPPAAPEERPAADTRSIVSGYSTLSTMDR
SVCSGASGRRAGAGDEADDERSELSHVETDTEGAAGAGPGGRLTRRPSFSSHHLMPCDTLARRRLARGRPDGEGAGRGGPRAPEPPGSAS
SSSQESLRPPAAALASRPSRMEALRLRLRGTADDMLAVRLRRPLSPETRRRRSSWRRHTVVVQSPLTDLNFNEWKELGGGGPPEPAGARA

>In-frame_LASP1_ENST00000435347_chr17_37026511_+_ARHGAP23_ENST00000437668_chr17_36614346_+_1147aa
MNPNCARCGKIVTPTEKVNCLDKLPLGPRDGCSPRRPFPWQGPRTLLLYKSPQDGFGFTLRHFIVYPPESAVHCSLKEEENGGRGGGPSP
RYRLEPMDTIFVKNVKEDGPAHRAGLRTGDRLVKVNGESVIGKTYSQVIALIQNSDDTLELSIMPKDEDILQLAYSQDAYLKGNEPTSGE
ARSIPEPPPICYPRKTYAPPARASTRATMVPEPTSALPSDPRSPAAWSDPGLRVPPAARAHLDNSSLGMSQPRPSPGAFPHLSSEPRTPR
AFPEPGSRVPPSRLECQQALSHWLSNQVPRRAGERRCPAMAPRARSASQDRLEEVAAPRPWPCSTSQDALSQLGQEGWHRARSDDYLSRA
TRSAEALGPGALVSPRFERCGWASQRSSARTPACPTRDLPGPQAPPPSGLQGLDDLGYIGYRSYSPSFQRRTGLLHALSFRDSPFGGLPT
FNLAQSPASFPPEASEPPRVVRPEPSTRALEPPAEDRGDEVVLRQKPPTGRKVQLTPARQMNLGFGDESPEPEASGRGERLGRKVAPLAT
TEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFTLGRHYSQDCSSIKAGRRSSYLLAITTERSKSCDDGL
NTFRDEGRVLRRLPNRIPSLRMLRSFFTDGSLDSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLTTKQILTKKGKKAGSGLRQWKRV
YAALRARSLSLSKERREPGPAAAGAAAAGAGEDEAAPVCIGSCLVDISYSETKRRHVFRLTTADFCETLFQAEDRDDMLGWIRAIRENSR
AEGEDPGCANQALISKKLNDTRKVSHSSGPKADSSPKGSRGLGGLKSEFLKQSAARGLRTQDLPAGSKDDSAAAPKTPWGINIIKKNKKA
APRAFGVRLEECQPATENQRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNRGPGDINLQDERWQDLNVISSLLKSFFRKL
PEPLFTDDKYNDFIEANRIEDARERMRTLRKLIRDLPGHYTETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LASP1_ENST00000318008_chr17_37026511_+_ARHGAP23_ENST00000431231_chr17_36614346_+_4482nt
ATGAACCCCAACTGCGCCCGGTGCGGCAAGATCGTGTATCCCACGGAGAAGGTGAACTGTCTGGATAAGCTGCCACTGGGCCCAAGAGAT
GGGTGCTCTCCTAGGCGCCCCTTCCCCTGGCAGGGGCCGAGGACGCTGCTGCTGTACAAAAGTCCCCAGGACGGCTTTGGCTTCACTCTG
CGCCACTTCATCGTGTACCCACCCGAGTCGGCCGTGCACTGCAGCCTGAAGGAGGAAGAGAATGGAGGCCGTGGAGGAGGACCCTCCCCC
CGGTACCGCCTGGAGCCCATGGACACCATCTTTGTCAAGAATGTGAAGGAAGACGGCCCTGCCCATAGGGCGGGGCTTCGCACAGGAGAC
CGGCTGGTAAAGGTGAATGGGGAAAGCGTCATTGGGAAGACCTACTCTCAGGTCATAGCTCTGATCCAGAATAGTGATGACACTCTGGAG
CTGTCTATCATGCCCAAGGACGAGGACATCCTCCAGCTGGCCTACTCCCAGGATGCCTACCTGAAAGGGAACGAGCCGTATTCTGGAGAG
GCCCGCAGCATCCCAGAGCCACCGCCGATCTGCTACCCCCGCAAGACCTACGCCCCTCCTGCCCGGGCCTCCACCAGGGCCACTATGGTG
CCTGAGCCCACCTCAGCACTGCCCAGTGACCCCCGGAGTCCTGCTGCCTGGAGTGACCCGGGGCTCCGTGTGCCACCTGCTGCCCGTGCC
CACCTGGACAACTCTTCCTTGGGGATGAGCCAGCCCCGCCCCAGCCCTGGTGCCTTCCCCCACCTCTCCTCGGAGCCCCGGACGCCCCGT
GCCTTCCCAGAGCCTGGCAGCCGGGTGCCCCCCAGCAGACTGGAGTGCCAGCAGGCCTTGTCACACTGGCTGTCAAACCAGGTACCCCGC
CGGGCGGGGGAGAGACGGTGCCCAGCCATGGCCCCCCGGGCCCGCAGCGCCTCCCAGGACCGGTTGGAGGAGGTGGCTGCCCCCCGCCCG
TGGCCCTGCTCCACCTCCCAGGATGCTTTGAGCCAGCTGGGCCAGGAGGGCTGGCACCGAGCTCGCTCAGATGACTACTTGAGCCGGGCC
ACCCGTTCTGCCGAGGCACTGGGGCCAGGGGCACTGGTGTCACCCCGCTTTGAGCGGTGTGGCTGGGCTTCCCAGCGTTCGTCTGCCCGC
ACCCCCGCCTGCCCAACTCGGGACCTGCCAGGGCCCCAGGCCCCACCCCCGTCTGGCCTGCAGGGCCTGGATGACCTCGGGTACATCGGC
TACCGGAGCTACAGCCCATCATTCCAGCGCCGGACCGGCCTCCTCCATGCGCTCTCCTTCCGGGACTCACCCTTTGGGGGGCTGCCTACC
TTCAACCTGGCCCAGTCCCCTGCGTCATTCCCACCAGAGGCCTCCGAGCCACCCAGGGTTGTACGGCCGGAACCCAGCACCCGGGCCCTG
GAGCCTCCTGCGGAGGATCGCGGCGATGAGGTGGTCCTGAGGCAGAAGCCCCCGACGGGCCGCAAGGTTCAGCTGACCCCCGCAAGACAG
ATGAACCTTGGATTTGGTGACGAGTCCCCAGAGCCAGAGGCCAGTGGGCGAGGGGAACGCCTGGGCAGGAAGGTGGCCCCTTTGGCCACC
ACCGAAGACTCTCTGGCTTCCATCCCCTTTATTGATGAGCCCACCAGCCCCAGCATTGACCTCCAAGCCAAGCACGTCCCTGCCTCTGCT
GTGGTCTCCAGTGCCATGAACTCAGCCCCTGTCCTGGGCACCAGCCCATCTTCCCCGACCTTCACTTTCACCCTCGGACGCCATTACTCG
CAGGACTGCAGCAGCATCAAGGCTGGCCGCCGCTCCTCCTACCTGCTGGCCATCACCACGGAGCGCTCCAAGTCCTGCGATGATGGACTC
AACACCTTCCGCGACGAGGGCCGGGTTCTGCGGCGCCTGCCAAACCGCATACCCAGCCTGCGGATGCTCCGGAGCTTCTTCACCGACGGG
TCCTTGGATAGCTGGGGCACCTCTGAAGATGCTGACGCTCCTTCTAAGCGACACTCAACCTCTGACCTCTCAGATGCGACCTTCAGCGAT
ATCAGGAGAGAAGGCTGGTTGTATTATAAGCAGATTCTCACCAAGAAGGGGAAGAAAGCGGGCAGCGGCCTGCGCCAGTGGAAGCGGGTG
TACGCCGCGCTGCGGGCGCGCTCGCTCTCGCTGAGCAAGGAGCGGCGGGAGCCCGGGCCGGCGGCGGCGGGGGCTGCGGCGGCCGGCGCA
GGTGAGGACGAGGCGGCGCCCGTCTGCATCGGCTCCTGCCTCGTGGACATCTCCTACAGCGAGACCAAGAGGAGGCACGTGTTCCGGCTG
ACCACCGCTGACTTCTGTGAATATCTCTTTCAGGCTGAGGACCGGGATGACATGCTGGGCTGGATCAGAGCGATCCGGGAGAACAGCAGG
GCCGAGGGCGAGGACCCCGGCTGTGCCAACCAAGCTCTGATCAGCAAGAAGCTTAACGATTATCGCAAAGTGAGCCATAGCTCTGGGCCC
AAAGCTGATTCCTCCCCCAAAGGCTCTCGCGGCCTGGGGGGCCTCAAGTCTGAGTTCCTCAAGCAGAGTGCGGCACGTGGCCTCAGGACT
CAGGACCTGCCCGCAGGGAGCAAGGATGACAGTGCTGCAGCCCCCAAAACCCCCTGGGGCATCAACATCATCAAGAAAAATAAGAAGGCC
GCTCCGAGGGCGTTTGGGGTCAGGCTGGAGGAGTGCCAGCCAGCCACGGAGAACCAGCGCGTCCCCTTAATCGTGGCTGCATGCTGTCGC
ATTGTGGAGGCACGAGGGCTGGAGTCCACAGGCATTTACCGAGTGCCCGGCAACAATGCAGTGGTGTCCAGCCTACAGGAGCAGCTCAAC
CGCGGGCCTGGTGACATCAACCTGCAGGATGAGCGCTGGCAAGACCTCAATGTGATCAGCAGCCTGCTCAAGTCCTTCTTCCGAAAGCTG
CCCGAGCCTCTTTTCACTGATGACAAATACAACGACTTCATCGAGGCCAACCGCATTGAGGACGCACGGGAGCGAATGAGGACGCTGCGG
AAGCTGATCCGGGATCTCCCAGGACACTACTATGAAACGCTCAAATTCCTTGTGGGCCATCTCAAGACCATCGCTGACCACTCTGAGAAA
AACAAGATGGAACCCCGGAACCTGGCCCTGGTCTTTGGGCCGACACTGGTGAGGACGTCTGAGGACAACATGACAGACATGGTGACCCAC
ATGCCTGACCGCTACAAGATCGTGGAGACACTGATCCAGCACTCAGACTGGTTCTTCAGTGACGAAGAGGACAAGGGAGAGAGAACCCCT
GTGGGCGACAAGGAGCCTCAGGCAGTGCCCAACATTGAGTACCTCCTGCCCAACATTGGCAGGACAGTGCCCCCTGGCGACCCGGGGTCA
GATTCTACCACCTGTAGTTCAGCCAAGTCCAAGGGTTCGTGGGCCCCCAAGAAGGAGCCGTACGCCCGGGAGATGCTGGCGATCTCCTTC
ATCTCGGCCGTCAACCGCAAGCGCAAGAAGCGGCGGGAGGCGCGGGGGCTGGGCAGCAGCACCGACGACGACTCGGAGCAGGAGGCGCAC
AAGCCTGGGGCGGGGGCCACAGCGCCGGGGACTCAGGAGCGGCCGCAGGGGCCGCTGCCTGGCGCCGTCGCCCCCGAGGCCCCCGGACGC
CTCAGTCCCCCGGCGGCGCCGGAGGAGCGGCCGGCCGCGGACACGCGCTCCATTGTGTCGGGCTACTCCACCCTGTCCACCATGGACCGC
AGCGTGTGCTCGGGCGCTAGCGGTCGGCGGGCAGGGGCGGGGGATGAGGCGGACGACGAGCGTAGCGAGCTGAGCCACGTGGAGACGGAC
ACTGAGGGCGCGGCGGGCGCGGGGCCTGGGGGGCGCCTGACACGCCGGCCGTCCTTCAGCTCGCACCACCTCATGCCCTGCGACACTCTG
GCGCGCCGCCGCCTGGCCCGGGGCCGCCCAGACGGCGAGGGCGCGGGCCGGGGCGGTCCCCGCGCCCCGGAGCCGCCCGGCTCGGCGTCG
TCCAGCAGCCAGGAGTCGCTGCGGCCCCCGGCGGCGGCGCTGGCCTCCCGGCCCTCGCGCATGGAGGCGCTGCGTCTAAGGCTCCGCGGC
ACGGCGGACGACATGCTCGCCGTGCGCCTGCGGCGGCCGCTGTCGCCCGAGACCCGGCGGCGCCGGAGCAGCTGGCGCCGCCACACCGTG
GTGGTGCAGAGCCCGCTGACTGACCTCAACTTCAACGAGTGGAAGGAGCTGGGCGGAGGGGGCCCCCCGGAGCCTGCGGGCGCGCGGGCG
CACAGTGACAACAAGGACTCCGGACTCAGCAGCCTGGAGTCCACCAAGGCGCGGGCCCCGTCGTCCGCTGCCTCGCAGCCGCCCGCGCCC

>In-frame_LASP1_ENST00000318008_chr17_37026511_+_ARHGAP23_ENST00000437668_chr17_36614346_+_3441nt
ATGAACCCCAACTGCGCCCGGTGCGGCAAGATCGTGTATCCCACGGAGAAGGTGAACTGTCTGGATAAGCTGCCACTGGGCCCAAGAGAT
GGGTGCTCTCCTAGGCGCCCCTTCCCCTGGCAGGGGCCGAGGACGCTGCTGCTGTACAAAAGTCCCCAGGACGGCTTTGGCTTCACTCTG
CGCCACTTCATCGTGTACCCACCCGAGTCGGCCGTGCACTGCAGCCTGAAGGAGGAAGAGAATGGAGGCCGTGGAGGAGGACCCTCCCCC
CGGTACCGCCTGGAGCCCATGGACACCATCTTTGTCAAGAATGTGAAGGAAGACGGCCCTGCCCATAGGGCGGGGCTTCGCACAGGAGAC
CGGCTGGTAAAGGTGAATGGGGAAAGCGTCATTGGGAAGACCTACTCTCAGGTCATAGCTCTGATCCAGAATAGTGATGACACTCTGGAG
CTGTCTATCATGCCCAAGGACGAGGACATCCTCCAGCTGGCCTACTCCCAGGATGCCTACCTGAAAGGGAACGAGCCGTATTCTGGAGAG
GCCCGCAGCATCCCAGAGCCACCGCCGATCTGCTACCCCCGCAAGACCTACGCCCCTCCTGCCCGGGCCTCCACCAGGGCCACTATGGTG
CCTGAGCCCACCTCAGCACTGCCCAGTGACCCCCGGAGTCCTGCTGCCTGGAGTGACCCGGGGCTCCGTGTGCCACCTGCTGCCCGTGCC
CACCTGGACAACTCTTCCTTGGGGATGAGCCAGCCCCGCCCCAGCCCTGGTGCCTTCCCCCACCTCTCCTCGGAGCCCCGGACGCCCCGT
GCCTTCCCAGAGCCTGGCAGCCGGGTGCCCCCCAGCAGACTGGAGTGCCAGCAGGCCTTGTCACACTGGCTGTCAAACCAGGTACCCCGC
CGGGCGGGGGAGAGACGGTGCCCAGCCATGGCCCCCCGGGCCCGCAGCGCCTCCCAGGACCGGTTGGAGGAGGTGGCTGCCCCCCGCCCG
TGGCCCTGCTCCACCTCCCAGGATGCTTTGAGCCAGCTGGGCCAGGAGGGCTGGCACCGAGCTCGCTCAGATGACTACTTGAGCCGGGCC
ACCCGTTCTGCCGAGGCACTGGGGCCAGGGGCACTGGTGTCACCCCGCTTTGAGCGGTGTGGCTGGGCTTCCCAGCGTTCGTCTGCCCGC
ACCCCCGCCTGCCCAACTCGGGACCTGCCAGGGCCCCAGGCCCCACCCCCGTCTGGCCTGCAGGGCCTGGATGACCTCGGGTACATCGGC
TACCGGAGCTACAGCCCATCATTCCAGCGCCGGACCGGCCTCCTCCATGCGCTCTCCTTCCGGGACTCACCCTTTGGGGGGCTGCCTACC
TTCAACCTGGCCCAGTCCCCTGCGTCATTCCCACCAGAGGCCTCCGAGCCACCCAGGGTTGTACGGCCGGAACCCAGCACCCGGGCCCTG
GAGCCTCCTGCGGAGGATCGCGGCGATGAGGTGGTCCTGAGGCAGAAGCCCCCGACGGGCCGCAAGGTTCAGCTGACCCCCGCAAGACAG
ATGAACCTTGGATTTGGTGACGAGTCCCCAGAGCCAGAGGCCAGTGGGCGAGGGGAACGCCTGGGCAGGAAGGTGGCCCCTTTGGCCACC
ACCGAAGACTCTCTGGCTTCCATCCCCTTTATTGATGAGCCCACCAGCCCCAGCATTGACCTCCAAGCCAAGCACGTCCCTGCCTCTGCT
GTGGTCTCCAGTGCCATGAACTCAGCCCCTGTCCTGGGCACCAGCCCATCTTCCCCGACCTTCACTTTCACCCTCGGACGCCATTACTCG
CAGGACTGCAGCAGCATCAAGGCTGGCCGCCGCTCCTCCTACCTGCTGGCCATCACCACGGAGCGCTCCAAGTCCTGCGATGATGGACTC
AACACCTTCCGCGACGAGGGCCGGGTTCTGCGGCGCCTGCCAAACCGCATACCCAGCCTGCGGATGCTCCGGAGCTTCTTCACCGACGGG
TCCTTGGATAGCTGGGGCACCTCTGAAGATGCTGACGCTCCTTCTAAGCGACACTCAACCTCTGACCTCTCAGATGCGACCTTCAGCGAT
ATCAGGAGAGAAGGCTGGTTGTATTATAAGCAGATTCTCACCAAGAAGGGGAAGAAAGCGGGCAGCGGCCTGCGCCAGTGGAAGCGGGTG
TACGCCGCGCTGCGGGCGCGCTCGCTCTCGCTGAGCAAGGAGCGGCGGGAGCCCGGGCCGGCGGCGGCGGGGGCTGCGGCGGCCGGCGCA
GGTGAGGACGAGGCGGCGCCCGTCTGCATCGGCTCCTGCCTCGTGGACATCTCCTACAGCGAGACCAAGAGGAGGCACGTGTTCCGGCTG
ACCACCGCTGACTTCTGTGAATATCTCTTTCAGGCTGAGGACCGGGATGACATGCTGGGCTGGATCAGAGCGATCCGGGAGAACAGCAGG
GCCGAGGGCGAGGACCCCGGCTGTGCCAACCAAGCTCTGATCAGCAAGAAGCTTAACGATTATCGCAAAGTGAGCCATAGCTCTGGGCCC
AAAGCTGATTCCTCCCCCAAAGGCTCTCGCGGCCTGGGGGGCCTCAAGTCTGAGTTCCTCAAGCAGAGTGCGGCACGTGGCCTCAGGACT
CAGGACCTGCCCGCAGGGAGCAAGGATGACAGTGCTGCAGCCCCCAAAACCCCCTGGGGCATCAACATCATCAAGAAAAATAAGAAGGCC
GCTCCGAGGGCGTTTGGGGTCAGGCTGGAGGAGTGCCAGCCAGCCACGGAGAACCAGCGCGTCCCCTTAATCGTGGCTGCATGCTGTCGC
ATTGTGGAGGCACGAGGGCTGGAGTCCACAGGCATTTACCGAGTGCCCGGCAACAATGCAGTGGTGTCCAGCCTACAGGAGCAGCTCAAC
CGCGGGCCTGGTGACATCAACCTGCAGGATGAGCGCTGGCAAGACCTCAATGTGATCAGCAGCCTGCTCAAGTCCTTCTTCCGAAAGCTG
CCCGAGCCTCTTTTCACTGATGACAAATACAACGACTTCATCGAGGCCAACCGCATTGAGGACGCACGGGAGCGAATGAGGACGCTGCGG
AAGCTGATCCGGGATCTCCCAGGACACTACTATGAAACGCTCAAATTCCTTGTGGGCCATCTCAAGACCATCGCTGACCACTCTGAGAAA
AACAAGATGGAACCCCGGAACCTGGCCCTGGTCTTTGGGCCGACACTGGTGAGGACGTCTGAGGACAACATGACAGACATGGTGACCCAC
ATGCCTGACCGCTACAAGATCGTGGAGACACTGATCCAGCACTCAGACTGGTTCTTCAGTGACGAAGAGGACAAGGGAGAGAGAACCCCT
GTGGGCGACAAGGAGCCTCAGGCAGTGCCCAACATTGAGTACCTCCTGCCCAACATTGGCAGGACAGTGCCCCCTGGCGACCCGGGGTCA

>In-frame_LASP1_ENST00000435347_chr17_37026511_+_ARHGAP23_ENST00000431231_chr17_36614346_+_4482nt
ATGAACCCCAACTGCGCCCGGTGCGGCAAGATCGTGTATCCCACGGAGAAGGTGAACTGTCTGGATAAGCTGCCACTGGGCCCAAGAGAT
GGGTGCTCTCCTAGGCGCCCCTTCCCCTGGCAGGGGCCGAGGACGCTGCTGCTGTACAAAAGTCCCCAGGACGGCTTTGGCTTCACTCTG
CGCCACTTCATCGTGTACCCACCCGAGTCGGCCGTGCACTGCAGCCTGAAGGAGGAAGAGAATGGAGGCCGTGGAGGAGGACCCTCCCCC
CGGTACCGCCTGGAGCCCATGGACACCATCTTTGTCAAGAATGTGAAGGAAGACGGCCCTGCCCATAGGGCGGGGCTTCGCACAGGAGAC
CGGCTGGTAAAGGTGAATGGGGAAAGCGTCATTGGGAAGACCTACTCTCAGGTCATAGCTCTGATCCAGAATAGTGATGACACTCTGGAG
CTGTCTATCATGCCCAAGGACGAGGACATCCTCCAGCTGGCCTACTCCCAGGATGCCTACCTGAAAGGGAACGAGCCGTATTCTGGAGAG
GCCCGCAGCATCCCAGAGCCACCGCCGATCTGCTACCCCCGCAAGACCTACGCCCCTCCTGCCCGGGCCTCCACCAGGGCCACTATGGTG
CCTGAGCCCACCTCAGCACTGCCCAGTGACCCCCGGAGTCCTGCTGCCTGGAGTGACCCGGGGCTCCGTGTGCCACCTGCTGCCCGTGCC
CACCTGGACAACTCTTCCTTGGGGATGAGCCAGCCCCGCCCCAGCCCTGGTGCCTTCCCCCACCTCTCCTCGGAGCCCCGGACGCCCCGT
GCCTTCCCAGAGCCTGGCAGCCGGGTGCCCCCCAGCAGACTGGAGTGCCAGCAGGCCTTGTCACACTGGCTGTCAAACCAGGTACCCCGC
CGGGCGGGGGAGAGACGGTGCCCAGCCATGGCCCCCCGGGCCCGCAGCGCCTCCCAGGACCGGTTGGAGGAGGTGGCTGCCCCCCGCCCG
TGGCCCTGCTCCACCTCCCAGGATGCTTTGAGCCAGCTGGGCCAGGAGGGCTGGCACCGAGCTCGCTCAGATGACTACTTGAGCCGGGCC
ACCCGTTCTGCCGAGGCACTGGGGCCAGGGGCACTGGTGTCACCCCGCTTTGAGCGGTGTGGCTGGGCTTCCCAGCGTTCGTCTGCCCGC
ACCCCCGCCTGCCCAACTCGGGACCTGCCAGGGCCCCAGGCCCCACCCCCGTCTGGCCTGCAGGGCCTGGATGACCTCGGGTACATCGGC
TACCGGAGCTACAGCCCATCATTCCAGCGCCGGACCGGCCTCCTCCATGCGCTCTCCTTCCGGGACTCACCCTTTGGGGGGCTGCCTACC
TTCAACCTGGCCCAGTCCCCTGCGTCATTCCCACCAGAGGCCTCCGAGCCACCCAGGGTTGTACGGCCGGAACCCAGCACCCGGGCCCTG
GAGCCTCCTGCGGAGGATCGCGGCGATGAGGTGGTCCTGAGGCAGAAGCCCCCGACGGGCCGCAAGGTTCAGCTGACCCCCGCAAGACAG
ATGAACCTTGGATTTGGTGACGAGTCCCCAGAGCCAGAGGCCAGTGGGCGAGGGGAACGCCTGGGCAGGAAGGTGGCCCCTTTGGCCACC
ACCGAAGACTCTCTGGCTTCCATCCCCTTTATTGATGAGCCCACCAGCCCCAGCATTGACCTCCAAGCCAAGCACGTCCCTGCCTCTGCT
GTGGTCTCCAGTGCCATGAACTCAGCCCCTGTCCTGGGCACCAGCCCATCTTCCCCGACCTTCACTTTCACCCTCGGACGCCATTACTCG
CAGGACTGCAGCAGCATCAAGGCTGGCCGCCGCTCCTCCTACCTGCTGGCCATCACCACGGAGCGCTCCAAGTCCTGCGATGATGGACTC
AACACCTTCCGCGACGAGGGCCGGGTTCTGCGGCGCCTGCCAAACCGCATACCCAGCCTGCGGATGCTCCGGAGCTTCTTCACCGACGGG
TCCTTGGATAGCTGGGGCACCTCTGAAGATGCTGACGCTCCTTCTAAGCGACACTCAACCTCTGACCTCTCAGATGCGACCTTCAGCGAT
ATCAGGAGAGAAGGCTGGTTGTATTATAAGCAGATTCTCACCAAGAAGGGGAAGAAAGCGGGCAGCGGCCTGCGCCAGTGGAAGCGGGTG
TACGCCGCGCTGCGGGCGCGCTCGCTCTCGCTGAGCAAGGAGCGGCGGGAGCCCGGGCCGGCGGCGGCGGGGGCTGCGGCGGCCGGCGCA
GGTGAGGACGAGGCGGCGCCCGTCTGCATCGGCTCCTGCCTCGTGGACATCTCCTACAGCGAGACCAAGAGGAGGCACGTGTTCCGGCTG
ACCACCGCTGACTTCTGTGAATATCTCTTTCAGGCTGAGGACCGGGATGACATGCTGGGCTGGATCAGAGCGATCCGGGAGAACAGCAGG
GCCGAGGGCGAGGACCCCGGCTGTGCCAACCAAGCTCTGATCAGCAAGAAGCTTAACGATTATCGCAAAGTGAGCCATAGCTCTGGGCCC
AAAGCTGATTCCTCCCCCAAAGGCTCTCGCGGCCTGGGGGGCCTCAAGTCTGAGTTCCTCAAGCAGAGTGCGGCACGTGGCCTCAGGACT
CAGGACCTGCCCGCAGGGAGCAAGGATGACAGTGCTGCAGCCCCCAAAACCCCCTGGGGCATCAACATCATCAAGAAAAATAAGAAGGCC
GCTCCGAGGGCGTTTGGGGTCAGGCTGGAGGAGTGCCAGCCAGCCACGGAGAACCAGCGCGTCCCCTTAATCGTGGCTGCATGCTGTCGC
ATTGTGGAGGCACGAGGGCTGGAGTCCACAGGCATTTACCGAGTGCCCGGCAACAATGCAGTGGTGTCCAGCCTACAGGAGCAGCTCAAC
CGCGGGCCTGGTGACATCAACCTGCAGGATGAGCGCTGGCAAGACCTCAATGTGATCAGCAGCCTGCTCAAGTCCTTCTTCCGAAAGCTG
CCCGAGCCTCTTTTCACTGATGACAAATACAACGACTTCATCGAGGCCAACCGCATTGAGGACGCACGGGAGCGAATGAGGACGCTGCGG
AAGCTGATCCGGGATCTCCCAGGACACTACTATGAAACGCTCAAATTCCTTGTGGGCCATCTCAAGACCATCGCTGACCACTCTGAGAAA
AACAAGATGGAACCCCGGAACCTGGCCCTGGTCTTTGGGCCGACACTGGTGAGGACGTCTGAGGACAACATGACAGACATGGTGACCCAC
ATGCCTGACCGCTACAAGATCGTGGAGACACTGATCCAGCACTCAGACTGGTTCTTCAGTGACGAAGAGGACAAGGGAGAGAGAACCCCT
GTGGGCGACAAGGAGCCTCAGGCAGTGCCCAACATTGAGTACCTCCTGCCCAACATTGGCAGGACAGTGCCCCCTGGCGACCCGGGGTCA
GATTCTACCACCTGTAGTTCAGCCAAGTCCAAGGGTTCGTGGGCCCCCAAGAAGGAGCCGTACGCCCGGGAGATGCTGGCGATCTCCTTC
ATCTCGGCCGTCAACCGCAAGCGCAAGAAGCGGCGGGAGGCGCGGGGGCTGGGCAGCAGCACCGACGACGACTCGGAGCAGGAGGCGCAC
AAGCCTGGGGCGGGGGCCACAGCGCCGGGGACTCAGGAGCGGCCGCAGGGGCCGCTGCCTGGCGCCGTCGCCCCCGAGGCCCCCGGACGC
CTCAGTCCCCCGGCGGCGCCGGAGGAGCGGCCGGCCGCGGACACGCGCTCCATTGTGTCGGGCTACTCCACCCTGTCCACCATGGACCGC
AGCGTGTGCTCGGGCGCTAGCGGTCGGCGGGCAGGGGCGGGGGATGAGGCGGACGACGAGCGTAGCGAGCTGAGCCACGTGGAGACGGAC
ACTGAGGGCGCGGCGGGCGCGGGGCCTGGGGGGCGCCTGACACGCCGGCCGTCCTTCAGCTCGCACCACCTCATGCCCTGCGACACTCTG
GCGCGCCGCCGCCTGGCCCGGGGCCGCCCAGACGGCGAGGGCGCGGGCCGGGGCGGTCCCCGCGCCCCGGAGCCGCCCGGCTCGGCGTCG
TCCAGCAGCCAGGAGTCGCTGCGGCCCCCGGCGGCGGCGCTGGCCTCCCGGCCCTCGCGCATGGAGGCGCTGCGTCTAAGGCTCCGCGGC
ACGGCGGACGACATGCTCGCCGTGCGCCTGCGGCGGCCGCTGTCGCCCGAGACCCGGCGGCGCCGGAGCAGCTGGCGCCGCCACACCGTG
GTGGTGCAGAGCCCGCTGACTGACCTCAACTTCAACGAGTGGAAGGAGCTGGGCGGAGGGGGCCCCCCGGAGCCTGCGGGCGCGCGGGCG
CACAGTGACAACAAGGACTCCGGACTCAGCAGCCTGGAGTCCACCAAGGCGCGGGCCCCGTCGTCCGCTGCCTCGCAGCCGCCCGCGCCC

>In-frame_LASP1_ENST00000435347_chr17_37026511_+_ARHGAP23_ENST00000437668_chr17_36614346_+_3441nt
ATGAACCCCAACTGCGCCCGGTGCGGCAAGATCGTGTATCCCACGGAGAAGGTGAACTGTCTGGATAAGCTGCCACTGGGCCCAAGAGAT
GGGTGCTCTCCTAGGCGCCCCTTCCCCTGGCAGGGGCCGAGGACGCTGCTGCTGTACAAAAGTCCCCAGGACGGCTTTGGCTTCACTCTG
CGCCACTTCATCGTGTACCCACCCGAGTCGGCCGTGCACTGCAGCCTGAAGGAGGAAGAGAATGGAGGCCGTGGAGGAGGACCCTCCCCC
CGGTACCGCCTGGAGCCCATGGACACCATCTTTGTCAAGAATGTGAAGGAAGACGGCCCTGCCCATAGGGCGGGGCTTCGCACAGGAGAC
CGGCTGGTAAAGGTGAATGGGGAAAGCGTCATTGGGAAGACCTACTCTCAGGTCATAGCTCTGATCCAGAATAGTGATGACACTCTGGAG
CTGTCTATCATGCCCAAGGACGAGGACATCCTCCAGCTGGCCTACTCCCAGGATGCCTACCTGAAAGGGAACGAGCCGTATTCTGGAGAG
GCCCGCAGCATCCCAGAGCCACCGCCGATCTGCTACCCCCGCAAGACCTACGCCCCTCCTGCCCGGGCCTCCACCAGGGCCACTATGGTG
CCTGAGCCCACCTCAGCACTGCCCAGTGACCCCCGGAGTCCTGCTGCCTGGAGTGACCCGGGGCTCCGTGTGCCACCTGCTGCCCGTGCC
CACCTGGACAACTCTTCCTTGGGGATGAGCCAGCCCCGCCCCAGCCCTGGTGCCTTCCCCCACCTCTCCTCGGAGCCCCGGACGCCCCGT
GCCTTCCCAGAGCCTGGCAGCCGGGTGCCCCCCAGCAGACTGGAGTGCCAGCAGGCCTTGTCACACTGGCTGTCAAACCAGGTACCCCGC
CGGGCGGGGGAGAGACGGTGCCCAGCCATGGCCCCCCGGGCCCGCAGCGCCTCCCAGGACCGGTTGGAGGAGGTGGCTGCCCCCCGCCCG
TGGCCCTGCTCCACCTCCCAGGATGCTTTGAGCCAGCTGGGCCAGGAGGGCTGGCACCGAGCTCGCTCAGATGACTACTTGAGCCGGGCC
ACCCGTTCTGCCGAGGCACTGGGGCCAGGGGCACTGGTGTCACCCCGCTTTGAGCGGTGTGGCTGGGCTTCCCAGCGTTCGTCTGCCCGC
ACCCCCGCCTGCCCAACTCGGGACCTGCCAGGGCCCCAGGCCCCACCCCCGTCTGGCCTGCAGGGCCTGGATGACCTCGGGTACATCGGC
TACCGGAGCTACAGCCCATCATTCCAGCGCCGGACCGGCCTCCTCCATGCGCTCTCCTTCCGGGACTCACCCTTTGGGGGGCTGCCTACC
TTCAACCTGGCCCAGTCCCCTGCGTCATTCCCACCAGAGGCCTCCGAGCCACCCAGGGTTGTACGGCCGGAACCCAGCACCCGGGCCCTG
GAGCCTCCTGCGGAGGATCGCGGCGATGAGGTGGTCCTGAGGCAGAAGCCCCCGACGGGCCGCAAGGTTCAGCTGACCCCCGCAAGACAG
ATGAACCTTGGATTTGGTGACGAGTCCCCAGAGCCAGAGGCCAGTGGGCGAGGGGAACGCCTGGGCAGGAAGGTGGCCCCTTTGGCCACC
ACCGAAGACTCTCTGGCTTCCATCCCCTTTATTGATGAGCCCACCAGCCCCAGCATTGACCTCCAAGCCAAGCACGTCCCTGCCTCTGCT
GTGGTCTCCAGTGCCATGAACTCAGCCCCTGTCCTGGGCACCAGCCCATCTTCCCCGACCTTCACTTTCACCCTCGGACGCCATTACTCG
CAGGACTGCAGCAGCATCAAGGCTGGCCGCCGCTCCTCCTACCTGCTGGCCATCACCACGGAGCGCTCCAAGTCCTGCGATGATGGACTC
AACACCTTCCGCGACGAGGGCCGGGTTCTGCGGCGCCTGCCAAACCGCATACCCAGCCTGCGGATGCTCCGGAGCTTCTTCACCGACGGG
TCCTTGGATAGCTGGGGCACCTCTGAAGATGCTGACGCTCCTTCTAAGCGACACTCAACCTCTGACCTCTCAGATGCGACCTTCAGCGAT
ATCAGGAGAGAAGGCTGGTTGTATTATAAGCAGATTCTCACCAAGAAGGGGAAGAAAGCGGGCAGCGGCCTGCGCCAGTGGAAGCGGGTG
TACGCCGCGCTGCGGGCGCGCTCGCTCTCGCTGAGCAAGGAGCGGCGGGAGCCCGGGCCGGCGGCGGCGGGGGCTGCGGCGGCCGGCGCA
GGTGAGGACGAGGCGGCGCCCGTCTGCATCGGCTCCTGCCTCGTGGACATCTCCTACAGCGAGACCAAGAGGAGGCACGTGTTCCGGCTG
ACCACCGCTGACTTCTGTGAATATCTCTTTCAGGCTGAGGACCGGGATGACATGCTGGGCTGGATCAGAGCGATCCGGGAGAACAGCAGG
GCCGAGGGCGAGGACCCCGGCTGTGCCAACCAAGCTCTGATCAGCAAGAAGCTTAACGATTATCGCAAAGTGAGCCATAGCTCTGGGCCC
AAAGCTGATTCCTCCCCCAAAGGCTCTCGCGGCCTGGGGGGCCTCAAGTCTGAGTTCCTCAAGCAGAGTGCGGCACGTGGCCTCAGGACT
CAGGACCTGCCCGCAGGGAGCAAGGATGACAGTGCTGCAGCCCCCAAAACCCCCTGGGGCATCAACATCATCAAGAAAAATAAGAAGGCC
GCTCCGAGGGCGTTTGGGGTCAGGCTGGAGGAGTGCCAGCCAGCCACGGAGAACCAGCGCGTCCCCTTAATCGTGGCTGCATGCTGTCGC
ATTGTGGAGGCACGAGGGCTGGAGTCCACAGGCATTTACCGAGTGCCCGGCAACAATGCAGTGGTGTCCAGCCTACAGGAGCAGCTCAAC
CGCGGGCCTGGTGACATCAACCTGCAGGATGAGCGCTGGCAAGACCTCAATGTGATCAGCAGCCTGCTCAAGTCCTTCTTCCGAAAGCTG
CCCGAGCCTCTTTTCACTGATGACAAATACAACGACTTCATCGAGGCCAACCGCATTGAGGACGCACGGGAGCGAATGAGGACGCTGCGG
AAGCTGATCCGGGATCTCCCAGGACACTACTATGAAACGCTCAAATTCCTTGTGGGCCATCTCAAGACCATCGCTGACCACTCTGAGAAA
AACAAGATGGAACCCCGGAACCTGGCCCTGGTCTTTGGGCCGACACTGGTGAGGACGTCTGAGGACAACATGACAGACATGGTGACCCAC
ATGCCTGACCGCTACAAGATCGTGGAGACACTGATCCAGCACTCAGACTGGTTCTTCAGTGACGAAGAGGACAAGGGAGAGAGAACCCCT
GTGGGCGACAAGGAGCCTCAGGCAGTGCCCAACATTGAGTACCTCCTGCCCAACATTGGCAGGACAGTGCCCCCTGGCGACCCGGGGTCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_LASP1_ENST00000318008_chr17_37026511_+_ARHGAP23_ENST00000431231_chr17_36614346_+_6233nt
GCAGTCAGCCTGAGAGCGCTGAGGCGCCAGCACCGCGGGCCCCGCCGTCCCCCCAGGAACCCGCCCCCGCGCAGCCCCACGTCGCCCGGA
GAGCGCGCCTCGCTGCGCGTGCCCTTGCCCGCGCCCGAGGCGCGTGCCCGCCCCAGTGCAGCCCCTCCTCCCCGCTGTGTTTATTAGGGG
AAGGAGGGCGGAGGCGGAGGCCAGTTCCCCAGCTCCAGCCGCCGTCGCTGCTGCCTGTGTAGTTGCAGCCGCGGCCGCCTCCCGCCAGCT
CGCCTCGGGGAACAGGACGCGCGTGAGCTCAGGCGTCCCCGCCCCAGCTTTTCTCGGAACCATGAACCCCAACTGCGCCCGGTGCGGCAA
GATCGTGTATCCCACGGAGAAGGTGAACTGTCTGGATAAGCTGCCACTGGGCCCAAGAGATGGGTGCTCTCCTAGGCGCCCCTTCCCCTG
GCAGGGGCCGAGGACGCTGCTGCTGTACAAAAGTCCCCAGGACGGCTTTGGCTTCACTCTGCGCCACTTCATCGTGTACCCACCCGAGTC
GGCCGTGCACTGCAGCCTGAAGGAGGAAGAGAATGGAGGCCGTGGAGGAGGACCCTCCCCCCGGTACCGCCTGGAGCCCATGGACACCAT
CTTTGTCAAGAATGTGAAGGAAGACGGCCCTGCCCATAGGGCGGGGCTTCGCACAGGAGACCGGCTGGTAAAGGTGAATGGGGAAAGCGT
CATTGGGAAGACCTACTCTCAGGTCATAGCTCTGATCCAGAATAGTGATGACACTCTGGAGCTGTCTATCATGCCCAAGGACGAGGACAT
CCTCCAGCTGGCCTACTCCCAGGATGCCTACCTGAAAGGGAACGAGCCGTATTCTGGAGAGGCCCGCAGCATCCCAGAGCCACCGCCGAT
CTGCTACCCCCGCAAGACCTACGCCCCTCCTGCCCGGGCCTCCACCAGGGCCACTATGGTGCCTGAGCCCACCTCAGCACTGCCCAGTGA
CCCCCGGAGTCCTGCTGCCTGGAGTGACCCGGGGCTCCGTGTGCCACCTGCTGCCCGTGCCCACCTGGACAACTCTTCCTTGGGGATGAG
CCAGCCCCGCCCCAGCCCTGGTGCCTTCCCCCACCTCTCCTCGGAGCCCCGGACGCCCCGTGCCTTCCCAGAGCCTGGCAGCCGGGTGCC
CCCCAGCAGACTGGAGTGCCAGCAGGCCTTGTCACACTGGCTGTCAAACCAGGTACCCCGCCGGGCGGGGGAGAGACGGTGCCCAGCCAT
GGCCCCCCGGGCCCGCAGCGCCTCCCAGGACCGGTTGGAGGAGGTGGCTGCCCCCCGCCCGTGGCCCTGCTCCACCTCCCAGGATGCTTT
GAGCCAGCTGGGCCAGGAGGGCTGGCACCGAGCTCGCTCAGATGACTACTTGAGCCGGGCCACCCGTTCTGCCGAGGCACTGGGGCCAGG
GGCACTGGTGTCACCCCGCTTTGAGCGGTGTGGCTGGGCTTCCCAGCGTTCGTCTGCCCGCACCCCCGCCTGCCCAACTCGGGACCTGCC
AGGGCCCCAGGCCCCACCCCCGTCTGGCCTGCAGGGCCTGGATGACCTCGGGTACATCGGCTACCGGAGCTACAGCCCATCATTCCAGCG
CCGGACCGGCCTCCTCCATGCGCTCTCCTTCCGGGACTCACCCTTTGGGGGGCTGCCTACCTTCAACCTGGCCCAGTCCCCTGCGTCATT
CCCACCAGAGGCCTCCGAGCCACCCAGGGTTGTACGGCCGGAACCCAGCACCCGGGCCCTGGAGCCTCCTGCGGAGGATCGCGGCGATGA
GGTGGTCCTGAGGCAGAAGCCCCCGACGGGCCGCAAGGTTCAGCTGACCCCCGCAAGACAGATGAACCTTGGATTTGGTGACGAGTCCCC
AGAGCCAGAGGCCAGTGGGCGAGGGGAACGCCTGGGCAGGAAGGTGGCCCCTTTGGCCACCACCGAAGACTCTCTGGCTTCCATCCCCTT
TATTGATGAGCCCACCAGCCCCAGCATTGACCTCCAAGCCAAGCACGTCCCTGCCTCTGCTGTGGTCTCCAGTGCCATGAACTCAGCCCC
TGTCCTGGGCACCAGCCCATCTTCCCCGACCTTCACTTTCACCCTCGGACGCCATTACTCGCAGGACTGCAGCAGCATCAAGGCTGGCCG
CCGCTCCTCCTACCTGCTGGCCATCACCACGGAGCGCTCCAAGTCCTGCGATGATGGACTCAACACCTTCCGCGACGAGGGCCGGGTTCT
GCGGCGCCTGCCAAACCGCATACCCAGCCTGCGGATGCTCCGGAGCTTCTTCACCGACGGGTCCTTGGATAGCTGGGGCACCTCTGAAGA
TGCTGACGCTCCTTCTAAGCGACACTCAACCTCTGACCTCTCAGATGCGACCTTCAGCGATATCAGGAGAGAAGGCTGGTTGTATTATAA
GCAGATTCTCACCAAGAAGGGGAAGAAAGCGGGCAGCGGCCTGCGCCAGTGGAAGCGGGTGTACGCCGCGCTGCGGGCGCGCTCGCTCTC
GCTGAGCAAGGAGCGGCGGGAGCCCGGGCCGGCGGCGGCGGGGGCTGCGGCGGCCGGCGCAGGTGAGGACGAGGCGGCGCCCGTCTGCAT
CGGCTCCTGCCTCGTGGACATCTCCTACAGCGAGACCAAGAGGAGGCACGTGTTCCGGCTGACCACCGCTGACTTCTGTGAATATCTCTT
TCAGGCTGAGGACCGGGATGACATGCTGGGCTGGATCAGAGCGATCCGGGAGAACAGCAGGGCCGAGGGCGAGGACCCCGGCTGTGCCAA
CCAAGCTCTGATCAGCAAGAAGCTTAACGATTATCGCAAAGTGAGCCATAGCTCTGGGCCCAAAGCTGATTCCTCCCCCAAAGGCTCTCG
CGGCCTGGGGGGCCTCAAGTCTGAGTTCCTCAAGCAGAGTGCGGCACGTGGCCTCAGGACTCAGGACCTGCCCGCAGGGAGCAAGGATGA
CAGTGCTGCAGCCCCCAAAACCCCCTGGGGCATCAACATCATCAAGAAAAATAAGAAGGCCGCTCCGAGGGCGTTTGGGGTCAGGCTGGA
GGAGTGCCAGCCAGCCACGGAGAACCAGCGCGTCCCCTTAATCGTGGCTGCATGCTGTCGCATTGTGGAGGCACGAGGGCTGGAGTCCAC
AGGCATTTACCGAGTGCCCGGCAACAATGCAGTGGTGTCCAGCCTACAGGAGCAGCTCAACCGCGGGCCTGGTGACATCAACCTGCAGGA
TGAGCGCTGGCAAGACCTCAATGTGATCAGCAGCCTGCTCAAGTCCTTCTTCCGAAAGCTGCCCGAGCCTCTTTTCACTGATGACAAATA
CAACGACTTCATCGAGGCCAACCGCATTGAGGACGCACGGGAGCGAATGAGGACGCTGCGGAAGCTGATCCGGGATCTCCCAGGACACTA
CTATGAAACGCTCAAATTCCTTGTGGGCCATCTCAAGACCATCGCTGACCACTCTGAGAAAAACAAGATGGAACCCCGGAACCTGGCCCT
GGTCTTTGGGCCGACACTGGTGAGGACGTCTGAGGACAACATGACAGACATGGTGACCCACATGCCTGACCGCTACAAGATCGTGGAGAC
ACTGATCCAGCACTCAGACTGGTTCTTCAGTGACGAAGAGGACAAGGGAGAGAGAACCCCTGTGGGCGACAAGGAGCCTCAGGCAGTGCC
CAACATTGAGTACCTCCTGCCCAACATTGGCAGGACAGTGCCCCCTGGCGACCCGGGGTCAGATTCTACCACCTGTAGTTCAGCCAAGTC
CAAGGGTTCGTGGGCCCCCAAGAAGGAGCCGTACGCCCGGGAGATGCTGGCGATCTCCTTCATCTCGGCCGTCAACCGCAAGCGCAAGAA
GCGGCGGGAGGCGCGGGGGCTGGGCAGCAGCACCGACGACGACTCGGAGCAGGAGGCGCACAAGCCTGGGGCGGGGGCCACAGCGCCGGG
GACTCAGGAGCGGCCGCAGGGGCCGCTGCCTGGCGCCGTCGCCCCCGAGGCCCCCGGACGCCTCAGTCCCCCGGCGGCGCCGGAGGAGCG
GCCGGCCGCGGACACGCGCTCCATTGTGTCGGGCTACTCCACCCTGTCCACCATGGACCGCAGCGTGTGCTCGGGCGCTAGCGGTCGGCG
GGCAGGGGCGGGGGATGAGGCGGACGACGAGCGTAGCGAGCTGAGCCACGTGGAGACGGACACTGAGGGCGCGGCGGGCGCGGGGCCTGG
GGGGCGCCTGACACGCCGGCCGTCCTTCAGCTCGCACCACCTCATGCCCTGCGACACTCTGGCGCGCCGCCGCCTGGCCCGGGGCCGCCC
AGACGGCGAGGGCGCGGGCCGGGGCGGTCCCCGCGCCCCGGAGCCGCCCGGCTCGGCGTCGTCCAGCAGCCAGGAGTCGCTGCGGCCCCC
GGCGGCGGCGCTGGCCTCCCGGCCCTCGCGCATGGAGGCGCTGCGTCTAAGGCTCCGCGGCACGGCGGACGACATGCTCGCCGTGCGCCT
GCGGCGGCCGCTGTCGCCCGAGACCCGGCGGCGCCGGAGCAGCTGGCGCCGCCACACCGTGGTGGTGCAGAGCCCGCTGACTGACCTCAA
CTTCAACGAGTGGAAGGAGCTGGGCGGAGGGGGCCCCCCGGAGCCTGCGGGCGCGCGGGCGCACAGTGACAACAAGGACTCCGGACTCAG
CAGCCTGGAGTCCACCAAGGCGCGGGCCCCGTCGTCCGCTGCCTCGCAGCCGCCCGCGCCCGGGGACACGGGGTCCCTGCAGAGCCAGCC
CCCGCGCCGCTCGGCCGCCTCCCGCCTGCATCAGTGTCTGTGATCCCCACCTCCCGCGCCGCTCGGGCGCCACCCCTCCCTAGAGCCCCT
TTGGAACCAGGAGGCTTCACCAGCCTGCACCTCCTCTTCTGTGGCCCCTGGGTGCATGGTGTGGGTGGAGGGCGCAGCAGGCAGTGTCTC
TAGTTGGTGTGCTGGAACTGGCAGGGCAGAGGAGAAGGCTGGGGCCGGACTAATTGAATGGAAGGGGGTTCCAGAGGTGATGAGCAGAAG
AGGAGGGGGCGTGGGCTGCTGGGGTCTGTGTCCCTGCACACATGCGCCCGATAGGTCCTTCTGAGCCTTTCTGTGGCTGCACTTGGGGAC
CCTTGTGGACCATGGGGTGTGGCTAGGGAACCCCTAAGTTTCAGACTAAAGGAAAGATCCTGGGTGATGCTGGCTTTTTGCTTCTTTCTT
CTGCCCTCCCACCTCAGCTTGTAAGCGGGGATGTGTGTATGTCTGGGGAGAGGAGGTGTAGGGTGCGTATGTCCATGGGGGGAGGGGCTT
GTGTGTGCAGTCATTGTCCCAAGGTGTTTCCAGTAGCGACTTCTGTCCCCCTATCCCCACCCTGGTCCCCACTTTGCGCCCCCGGGCTCC
CTGCCTTTGGTGCACACAGGATCCTGCCCGCCCCCCTTGCCAGAGCCAGAGAAGGGGGTTGGGGCCATTCCAAGGAGGCAGGACTGAAAC
CCTCACCAGGGTTACTCCCCAACATCCTTTTGCCTGAGTCACCCTCTAAGCGCTTTAACCACGGGCAGCTGCCTGTTCCCCAGACAGTTT
TTGGTGGGGGGGGTCCAGGGTCCCCCTTGCTGGTACCTCCCTCACCCCTCTTTTTGTTTTTCCATCTGTGCCTGTTCCTTCCACAGCCCA
GGCACACAGAAGCCCACCTTCTTCCCCTTAGGAGGAGGGATAGTCAACACCCCTGCTGTCTCTCTGTCACTCACACACTGATTTATGGGG
TCTGAGCTGGGCTGTTCCTGCAGGATGGACAGGACCCAGCGCCCTCTTCTCCCCACAGGCTGTAAATAGACTTCCAATCACCAGGCCAGC
CCCCACACACCCTCACTCATTCCAGGGAAGCCCAGGTAGGTGGTGAACCCGCTGCCACGTCTATCAGTCCTCTTGTTTTATGCAAAGATT
TACTGTAAAGTAGATTTCTTTCCCTCCCTCCCCCATTCTTTTATTGTAAATATTGTCTCTAAATGTGTAACATATTATAAAGAATTTATA
AGGATTTTTAAAGATGTTTTGCTCATTTACAAAAGTGTTGTAACAGTGTTGGACAAAGCCTTCCACCCCATGTCCGCATGGCTCCTTTCA
CTGTGTCCTTGACACACCTCTCTGGCAACAACTAAAATTTCCTGCTTCTGAAAAGTCCTGTCTTAAAAGTACAGTCTATATCTTGGAAAT

>In-frame_LASP1_ENST00000318008_chr17_37026511_+_ARHGAP23_ENST00000437668_chr17_36614346_+_4000nt
GCAGTCAGCCTGAGAGCGCTGAGGCGCCAGCACCGCGGGCCCCGCCGTCCCCCCAGGAACCCGCCCCCGCGCAGCCCCACGTCGCCCGGA
GAGCGCGCCTCGCTGCGCGTGCCCTTGCCCGCGCCCGAGGCGCGTGCCCGCCCCAGTGCAGCCCCTCCTCCCCGCTGTGTTTATTAGGGG
AAGGAGGGCGGAGGCGGAGGCCAGTTCCCCAGCTCCAGCCGCCGTCGCTGCTGCCTGTGTAGTTGCAGCCGCGGCCGCCTCCCGCCAGCT
CGCCTCGGGGAACAGGACGCGCGTGAGCTCAGGCGTCCCCGCCCCAGCTTTTCTCGGAACCATGAACCCCAACTGCGCCCGGTGCGGCAA
GATCGTGTATCCCACGGAGAAGGTGAACTGTCTGGATAAGCTGCCACTGGGCCCAAGAGATGGGTGCTCTCCTAGGCGCCCCTTCCCCTG
GCAGGGGCCGAGGACGCTGCTGCTGTACAAAAGTCCCCAGGACGGCTTTGGCTTCACTCTGCGCCACTTCATCGTGTACCCACCCGAGTC
GGCCGTGCACTGCAGCCTGAAGGAGGAAGAGAATGGAGGCCGTGGAGGAGGACCCTCCCCCCGGTACCGCCTGGAGCCCATGGACACCAT
CTTTGTCAAGAATGTGAAGGAAGACGGCCCTGCCCATAGGGCGGGGCTTCGCACAGGAGACCGGCTGGTAAAGGTGAATGGGGAAAGCGT
CATTGGGAAGACCTACTCTCAGGTCATAGCTCTGATCCAGAATAGTGATGACACTCTGGAGCTGTCTATCATGCCCAAGGACGAGGACAT
CCTCCAGCTGGCCTACTCCCAGGATGCCTACCTGAAAGGGAACGAGCCGTATTCTGGAGAGGCCCGCAGCATCCCAGAGCCACCGCCGAT
CTGCTACCCCCGCAAGACCTACGCCCCTCCTGCCCGGGCCTCCACCAGGGCCACTATGGTGCCTGAGCCCACCTCAGCACTGCCCAGTGA
CCCCCGGAGTCCTGCTGCCTGGAGTGACCCGGGGCTCCGTGTGCCACCTGCTGCCCGTGCCCACCTGGACAACTCTTCCTTGGGGATGAG
CCAGCCCCGCCCCAGCCCTGGTGCCTTCCCCCACCTCTCCTCGGAGCCCCGGACGCCCCGTGCCTTCCCAGAGCCTGGCAGCCGGGTGCC
CCCCAGCAGACTGGAGTGCCAGCAGGCCTTGTCACACTGGCTGTCAAACCAGGTACCCCGCCGGGCGGGGGAGAGACGGTGCCCAGCCAT
GGCCCCCCGGGCCCGCAGCGCCTCCCAGGACCGGTTGGAGGAGGTGGCTGCCCCCCGCCCGTGGCCCTGCTCCACCTCCCAGGATGCTTT
GAGCCAGCTGGGCCAGGAGGGCTGGCACCGAGCTCGCTCAGATGACTACTTGAGCCGGGCCACCCGTTCTGCCGAGGCACTGGGGCCAGG
GGCACTGGTGTCACCCCGCTTTGAGCGGTGTGGCTGGGCTTCCCAGCGTTCGTCTGCCCGCACCCCCGCCTGCCCAACTCGGGACCTGCC
AGGGCCCCAGGCCCCACCCCCGTCTGGCCTGCAGGGCCTGGATGACCTCGGGTACATCGGCTACCGGAGCTACAGCCCATCATTCCAGCG
CCGGACCGGCCTCCTCCATGCGCTCTCCTTCCGGGACTCACCCTTTGGGGGGCTGCCTACCTTCAACCTGGCCCAGTCCCCTGCGTCATT
CCCACCAGAGGCCTCCGAGCCACCCAGGGTTGTACGGCCGGAACCCAGCACCCGGGCCCTGGAGCCTCCTGCGGAGGATCGCGGCGATGA
GGTGGTCCTGAGGCAGAAGCCCCCGACGGGCCGCAAGGTTCAGCTGACCCCCGCAAGACAGATGAACCTTGGATTTGGTGACGAGTCCCC
AGAGCCAGAGGCCAGTGGGCGAGGGGAACGCCTGGGCAGGAAGGTGGCCCCTTTGGCCACCACCGAAGACTCTCTGGCTTCCATCCCCTT
TATTGATGAGCCCACCAGCCCCAGCATTGACCTCCAAGCCAAGCACGTCCCTGCCTCTGCTGTGGTCTCCAGTGCCATGAACTCAGCCCC
TGTCCTGGGCACCAGCCCATCTTCCCCGACCTTCACTTTCACCCTCGGACGCCATTACTCGCAGGACTGCAGCAGCATCAAGGCTGGCCG
CCGCTCCTCCTACCTGCTGGCCATCACCACGGAGCGCTCCAAGTCCTGCGATGATGGACTCAACACCTTCCGCGACGAGGGCCGGGTTCT
GCGGCGCCTGCCAAACCGCATACCCAGCCTGCGGATGCTCCGGAGCTTCTTCACCGACGGGTCCTTGGATAGCTGGGGCACCTCTGAAGA
TGCTGACGCTCCTTCTAAGCGACACTCAACCTCTGACCTCTCAGATGCGACCTTCAGCGATATCAGGAGAGAAGGCTGGTTGTATTATAA
GCAGATTCTCACCAAGAAGGGGAAGAAAGCGGGCAGCGGCCTGCGCCAGTGGAAGCGGGTGTACGCCGCGCTGCGGGCGCGCTCGCTCTC
GCTGAGCAAGGAGCGGCGGGAGCCCGGGCCGGCGGCGGCGGGGGCTGCGGCGGCCGGCGCAGGTGAGGACGAGGCGGCGCCCGTCTGCAT
CGGCTCCTGCCTCGTGGACATCTCCTACAGCGAGACCAAGAGGAGGCACGTGTTCCGGCTGACCACCGCTGACTTCTGTGAATATCTCTT
TCAGGCTGAGGACCGGGATGACATGCTGGGCTGGATCAGAGCGATCCGGGAGAACAGCAGGGCCGAGGGCGAGGACCCCGGCTGTGCCAA
CCAAGCTCTGATCAGCAAGAAGCTTAACGATTATCGCAAAGTGAGCCATAGCTCTGGGCCCAAAGCTGATTCCTCCCCCAAAGGCTCTCG
CGGCCTGGGGGGCCTCAAGTCTGAGTTCCTCAAGCAGAGTGCGGCACGTGGCCTCAGGACTCAGGACCTGCCCGCAGGGAGCAAGGATGA
CAGTGCTGCAGCCCCCAAAACCCCCTGGGGCATCAACATCATCAAGAAAAATAAGAAGGCCGCTCCGAGGGCGTTTGGGGTCAGGCTGGA
GGAGTGCCAGCCAGCCACGGAGAACCAGCGCGTCCCCTTAATCGTGGCTGCATGCTGTCGCATTGTGGAGGCACGAGGGCTGGAGTCCAC
AGGCATTTACCGAGTGCCCGGCAACAATGCAGTGGTGTCCAGCCTACAGGAGCAGCTCAACCGCGGGCCTGGTGACATCAACCTGCAGGA
TGAGCGCTGGCAAGACCTCAATGTGATCAGCAGCCTGCTCAAGTCCTTCTTCCGAAAGCTGCCCGAGCCTCTTTTCACTGATGACAAATA
CAACGACTTCATCGAGGCCAACCGCATTGAGGACGCACGGGAGCGAATGAGGACGCTGCGGAAGCTGATCCGGGATCTCCCAGGACACTA
CTATGAAACGCTCAAATTCCTTGTGGGCCATCTCAAGACCATCGCTGACCACTCTGAGAAAAACAAGATGGAACCCCGGAACCTGGCCCT
GGTCTTTGGGCCGACACTGGTGAGGACGTCTGAGGACAACATGACAGACATGGTGACCCACATGCCTGACCGCTACAAGATCGTGGAGAC
ACTGATCCAGCACTCAGACTGGTTCTTCAGTGACGAAGAGGACAAGGGAGAGAGAACCCCTGTGGGCGACAAGGAGCCTCAGGCAGTGCC
CAACATTGAGTACCTCCTGCCCAACATTGGCAGGACAGTGCCCCCTGGCGACCCGGGGTCAGCGGACCTGTTGGAGATTTAAAGGATTCT
ACCACCTGTAGTTCAGCCAAGTCCAAGGGTTCGTGGGCCCCCAAGAAGGAGCCGTACGCCCGGGAGATGCTGGCGATCTCCTTCATCTCG
GCCGTCAACCGCAAGCGCAAGAAGCGGCGGGAGGCGCGGGGGCTGGGCAGCAGCACCGACGACGACTCGGAGCAGGAGGCGCACAAGCCT

>In-frame_LASP1_ENST00000435347_chr17_37026511_+_ARHGAP23_ENST00000431231_chr17_36614346_+_5949nt
GGACGCGCGTGAGCTCAGGCGTCCCCGCCCCAGCTTTTCTCGGAACCATGAACCCCAACTGCGCCCGGTGCGGCAAGATCGTGTATCCCA
CGGAGAAGGTGAACTGTCTGGATAAGCTGCCACTGGGCCCAAGAGATGGGTGCTCTCCTAGGCGCCCCTTCCCCTGGCAGGGGCCGAGGA
CGCTGCTGCTGTACAAAAGTCCCCAGGACGGCTTTGGCTTCACTCTGCGCCACTTCATCGTGTACCCACCCGAGTCGGCCGTGCACTGCA
GCCTGAAGGAGGAAGAGAATGGAGGCCGTGGAGGAGGACCCTCCCCCCGGTACCGCCTGGAGCCCATGGACACCATCTTTGTCAAGAATG
TGAAGGAAGACGGCCCTGCCCATAGGGCGGGGCTTCGCACAGGAGACCGGCTGGTAAAGGTGAATGGGGAAAGCGTCATTGGGAAGACCT
ACTCTCAGGTCATAGCTCTGATCCAGAATAGTGATGACACTCTGGAGCTGTCTATCATGCCCAAGGACGAGGACATCCTCCAGCTGGCCT
ACTCCCAGGATGCCTACCTGAAAGGGAACGAGCCGTATTCTGGAGAGGCCCGCAGCATCCCAGAGCCACCGCCGATCTGCTACCCCCGCA
AGACCTACGCCCCTCCTGCCCGGGCCTCCACCAGGGCCACTATGGTGCCTGAGCCCACCTCAGCACTGCCCAGTGACCCCCGGAGTCCTG
CTGCCTGGAGTGACCCGGGGCTCCGTGTGCCACCTGCTGCCCGTGCCCACCTGGACAACTCTTCCTTGGGGATGAGCCAGCCCCGCCCCA
GCCCTGGTGCCTTCCCCCACCTCTCCTCGGAGCCCCGGACGCCCCGTGCCTTCCCAGAGCCTGGCAGCCGGGTGCCCCCCAGCAGACTGG
AGTGCCAGCAGGCCTTGTCACACTGGCTGTCAAACCAGGTACCCCGCCGGGCGGGGGAGAGACGGTGCCCAGCCATGGCCCCCCGGGCCC
GCAGCGCCTCCCAGGACCGGTTGGAGGAGGTGGCTGCCCCCCGCCCGTGGCCCTGCTCCACCTCCCAGGATGCTTTGAGCCAGCTGGGCC
AGGAGGGCTGGCACCGAGCTCGCTCAGATGACTACTTGAGCCGGGCCACCCGTTCTGCCGAGGCACTGGGGCCAGGGGCACTGGTGTCAC
CCCGCTTTGAGCGGTGTGGCTGGGCTTCCCAGCGTTCGTCTGCCCGCACCCCCGCCTGCCCAACTCGGGACCTGCCAGGGCCCCAGGCCC
CACCCCCGTCTGGCCTGCAGGGCCTGGATGACCTCGGGTACATCGGCTACCGGAGCTACAGCCCATCATTCCAGCGCCGGACCGGCCTCC
TCCATGCGCTCTCCTTCCGGGACTCACCCTTTGGGGGGCTGCCTACCTTCAACCTGGCCCAGTCCCCTGCGTCATTCCCACCAGAGGCCT
CCGAGCCACCCAGGGTTGTACGGCCGGAACCCAGCACCCGGGCCCTGGAGCCTCCTGCGGAGGATCGCGGCGATGAGGTGGTCCTGAGGC
AGAAGCCCCCGACGGGCCGCAAGGTTCAGCTGACCCCCGCAAGACAGATGAACCTTGGATTTGGTGACGAGTCCCCAGAGCCAGAGGCCA
GTGGGCGAGGGGAACGCCTGGGCAGGAAGGTGGCCCCTTTGGCCACCACCGAAGACTCTCTGGCTTCCATCCCCTTTATTGATGAGCCCA
CCAGCCCCAGCATTGACCTCCAAGCCAAGCACGTCCCTGCCTCTGCTGTGGTCTCCAGTGCCATGAACTCAGCCCCTGTCCTGGGCACCA
GCCCATCTTCCCCGACCTTCACTTTCACCCTCGGACGCCATTACTCGCAGGACTGCAGCAGCATCAAGGCTGGCCGCCGCTCCTCCTACC
TGCTGGCCATCACCACGGAGCGCTCCAAGTCCTGCGATGATGGACTCAACACCTTCCGCGACGAGGGCCGGGTTCTGCGGCGCCTGCCAA
ACCGCATACCCAGCCTGCGGATGCTCCGGAGCTTCTTCACCGACGGGTCCTTGGATAGCTGGGGCACCTCTGAAGATGCTGACGCTCCTT
CTAAGCGACACTCAACCTCTGACCTCTCAGATGCGACCTTCAGCGATATCAGGAGAGAAGGCTGGTTGTATTATAAGCAGATTCTCACCA
AGAAGGGGAAGAAAGCGGGCAGCGGCCTGCGCCAGTGGAAGCGGGTGTACGCCGCGCTGCGGGCGCGCTCGCTCTCGCTGAGCAAGGAGC
GGCGGGAGCCCGGGCCGGCGGCGGCGGGGGCTGCGGCGGCCGGCGCAGGTGAGGACGAGGCGGCGCCCGTCTGCATCGGCTCCTGCCTCG
TGGACATCTCCTACAGCGAGACCAAGAGGAGGCACGTGTTCCGGCTGACCACCGCTGACTTCTGTGAATATCTCTTTCAGGCTGAGGACC
GGGATGACATGCTGGGCTGGATCAGAGCGATCCGGGAGAACAGCAGGGCCGAGGGCGAGGACCCCGGCTGTGCCAACCAAGCTCTGATCA
GCAAGAAGCTTAACGATTATCGCAAAGTGAGCCATAGCTCTGGGCCCAAAGCTGATTCCTCCCCCAAAGGCTCTCGCGGCCTGGGGGGCC
TCAAGTCTGAGTTCCTCAAGCAGAGTGCGGCACGTGGCCTCAGGACTCAGGACCTGCCCGCAGGGAGCAAGGATGACAGTGCTGCAGCCC
CCAAAACCCCCTGGGGCATCAACATCATCAAGAAAAATAAGAAGGCCGCTCCGAGGGCGTTTGGGGTCAGGCTGGAGGAGTGCCAGCCAG
CCACGGAGAACCAGCGCGTCCCCTTAATCGTGGCTGCATGCTGTCGCATTGTGGAGGCACGAGGGCTGGAGTCCACAGGCATTTACCGAG
TGCCCGGCAACAATGCAGTGGTGTCCAGCCTACAGGAGCAGCTCAACCGCGGGCCTGGTGACATCAACCTGCAGGATGAGCGCTGGCAAG
ACCTCAATGTGATCAGCAGCCTGCTCAAGTCCTTCTTCCGAAAGCTGCCCGAGCCTCTTTTCACTGATGACAAATACAACGACTTCATCG
AGGCCAACCGCATTGAGGACGCACGGGAGCGAATGAGGACGCTGCGGAAGCTGATCCGGGATCTCCCAGGACACTACTATGAAACGCTCA
AATTCCTTGTGGGCCATCTCAAGACCATCGCTGACCACTCTGAGAAAAACAAGATGGAACCCCGGAACCTGGCCCTGGTCTTTGGGCCGA
CACTGGTGAGGACGTCTGAGGACAACATGACAGACATGGTGACCCACATGCCTGACCGCTACAAGATCGTGGAGACACTGATCCAGCACT
CAGACTGGTTCTTCAGTGACGAAGAGGACAAGGGAGAGAGAACCCCTGTGGGCGACAAGGAGCCTCAGGCAGTGCCCAACATTGAGTACC
TCCTGCCCAACATTGGCAGGACAGTGCCCCCTGGCGACCCGGGGTCAGATTCTACCACCTGTAGTTCAGCCAAGTCCAAGGGTTCGTGGG
CCCCCAAGAAGGAGCCGTACGCCCGGGAGATGCTGGCGATCTCCTTCATCTCGGCCGTCAACCGCAAGCGCAAGAAGCGGCGGGAGGCGC
GGGGGCTGGGCAGCAGCACCGACGACGACTCGGAGCAGGAGGCGCACAAGCCTGGGGCGGGGGCCACAGCGCCGGGGACTCAGGAGCGGC
CGCAGGGGCCGCTGCCTGGCGCCGTCGCCCCCGAGGCCCCCGGACGCCTCAGTCCCCCGGCGGCGCCGGAGGAGCGGCCGGCCGCGGACA
CGCGCTCCATTGTGTCGGGCTACTCCACCCTGTCCACCATGGACCGCAGCGTGTGCTCGGGCGCTAGCGGTCGGCGGGCAGGGGCGGGGG
ATGAGGCGGACGACGAGCGTAGCGAGCTGAGCCACGTGGAGACGGACACTGAGGGCGCGGCGGGCGCGGGGCCTGGGGGGCGCCTGACAC
GCCGGCCGTCCTTCAGCTCGCACCACCTCATGCCCTGCGACACTCTGGCGCGCCGCCGCCTGGCCCGGGGCCGCCCAGACGGCGAGGGCG
CGGGCCGGGGCGGTCCCCGCGCCCCGGAGCCGCCCGGCTCGGCGTCGTCCAGCAGCCAGGAGTCGCTGCGGCCCCCGGCGGCGGCGCTGG
CCTCCCGGCCCTCGCGCATGGAGGCGCTGCGTCTAAGGCTCCGCGGCACGGCGGACGACATGCTCGCCGTGCGCCTGCGGCGGCCGCTGT
CGCCCGAGACCCGGCGGCGCCGGAGCAGCTGGCGCCGCCACACCGTGGTGGTGCAGAGCCCGCTGACTGACCTCAACTTCAACGAGTGGA
AGGAGCTGGGCGGAGGGGGCCCCCCGGAGCCTGCGGGCGCGCGGGCGCACAGTGACAACAAGGACTCCGGACTCAGCAGCCTGGAGTCCA
CCAAGGCGCGGGCCCCGTCGTCCGCTGCCTCGCAGCCGCCCGCGCCCGGGGACACGGGGTCCCTGCAGAGCCAGCCCCCGCGCCGCTCGG
CCGCCTCCCGCCTGCATCAGTGTCTGTGATCCCCACCTCCCGCGCCGCTCGGGCGCCACCCCTCCCTAGAGCCCCTTTGGAACCAGGAGG
CTTCACCAGCCTGCACCTCCTCTTCTGTGGCCCCTGGGTGCATGGTGTGGGTGGAGGGCGCAGCAGGCAGTGTCTCTAGTTGGTGTGCTG
GAACTGGCAGGGCAGAGGAGAAGGCTGGGGCCGGACTAATTGAATGGAAGGGGGTTCCAGAGGTGATGAGCAGAAGAGGAGGGGGCGTGG
GCTGCTGGGGTCTGTGTCCCTGCACACATGCGCCCGATAGGTCCTTCTGAGCCTTTCTGTGGCTGCACTTGGGGACCCTTGTGGACCATG
GGGTGTGGCTAGGGAACCCCTAAGTTTCAGACTAAAGGAAAGATCCTGGGTGATGCTGGCTTTTTGCTTCTTTCTTCTGCCCTCCCACCT
CAGCTTGTAAGCGGGGATGTGTGTATGTCTGGGGAGAGGAGGTGTAGGGTGCGTATGTCCATGGGGGGAGGGGCTTGTGTGTGCAGTCAT
TGTCCCAAGGTGTTTCCAGTAGCGACTTCTGTCCCCCTATCCCCACCCTGGTCCCCACTTTGCGCCCCCGGGCTCCCTGCCTTTGGTGCA
CACAGGATCCTGCCCGCCCCCCTTGCCAGAGCCAGAGAAGGGGGTTGGGGCCATTCCAAGGAGGCAGGACTGAAACCCTCACCAGGGTTA
CTCCCCAACATCCTTTTGCCTGAGTCACCCTCTAAGCGCTTTAACCACGGGCAGCTGCCTGTTCCCCAGACAGTTTTTGGTGGGGGGGGT
CCAGGGTCCCCCTTGCTGGTACCTCCCTCACCCCTCTTTTTGTTTTTCCATCTGTGCCTGTTCCTTCCACAGCCCAGGCACACAGAAGCC
CACCTTCTTCCCCTTAGGAGGAGGGATAGTCAACACCCCTGCTGTCTCTCTGTCACTCACACACTGATTTATGGGGTCTGAGCTGGGCTG
TTCCTGCAGGATGGACAGGACCCAGCGCCCTCTTCTCCCCACAGGCTGTAAATAGACTTCCAATCACCAGGCCAGCCCCCACACACCCTC
ACTCATTCCAGGGAAGCCCAGGTAGGTGGTGAACCCGCTGCCACGTCTATCAGTCCTCTTGTTTTATGCAAAGATTTACTGTAAAGTAGA
TTTCTTTCCCTCCCTCCCCCATTCTTTTATTGTAAATATTGTCTCTAAATGTGTAACATATTATAAAGAATTTATAAGGATTTTTAAAGA
TGTTTTGCTCATTTACAAAAGTGTTGTAACAGTGTTGGACAAAGCCTTCCACCCCATGTCCGCATGGCTCCTTTCACTGTGTCCTTGACA
CACCTCTCTGGCAACAACTAAAATTTCCTGCTTCTGAAAAGTCCTGTCTTAAAAGTACAGTCTATATCTTGGAAATAAATAGCTTTCCTC

>In-frame_LASP1_ENST00000435347_chr17_37026511_+_ARHGAP23_ENST00000437668_chr17_36614346_+_3716nt
GGACGCGCGTGAGCTCAGGCGTCCCCGCCCCAGCTTTTCTCGGAACCATGAACCCCAACTGCGCCCGGTGCGGCAAGATCGTGTATCCCA
CGGAGAAGGTGAACTGTCTGGATAAGCTGCCACTGGGCCCAAGAGATGGGTGCTCTCCTAGGCGCCCCTTCCCCTGGCAGGGGCCGAGGA
CGCTGCTGCTGTACAAAAGTCCCCAGGACGGCTTTGGCTTCACTCTGCGCCACTTCATCGTGTACCCACCCGAGTCGGCCGTGCACTGCA
GCCTGAAGGAGGAAGAGAATGGAGGCCGTGGAGGAGGACCCTCCCCCCGGTACCGCCTGGAGCCCATGGACACCATCTTTGTCAAGAATG
TGAAGGAAGACGGCCCTGCCCATAGGGCGGGGCTTCGCACAGGAGACCGGCTGGTAAAGGTGAATGGGGAAAGCGTCATTGGGAAGACCT
ACTCTCAGGTCATAGCTCTGATCCAGAATAGTGATGACACTCTGGAGCTGTCTATCATGCCCAAGGACGAGGACATCCTCCAGCTGGCCT
ACTCCCAGGATGCCTACCTGAAAGGGAACGAGCCGTATTCTGGAGAGGCCCGCAGCATCCCAGAGCCACCGCCGATCTGCTACCCCCGCA
AGACCTACGCCCCTCCTGCCCGGGCCTCCACCAGGGCCACTATGGTGCCTGAGCCCACCTCAGCACTGCCCAGTGACCCCCGGAGTCCTG
CTGCCTGGAGTGACCCGGGGCTCCGTGTGCCACCTGCTGCCCGTGCCCACCTGGACAACTCTTCCTTGGGGATGAGCCAGCCCCGCCCCA
GCCCTGGTGCCTTCCCCCACCTCTCCTCGGAGCCCCGGACGCCCCGTGCCTTCCCAGAGCCTGGCAGCCGGGTGCCCCCCAGCAGACTGG
AGTGCCAGCAGGCCTTGTCACACTGGCTGTCAAACCAGGTACCCCGCCGGGCGGGGGAGAGACGGTGCCCAGCCATGGCCCCCCGGGCCC
GCAGCGCCTCCCAGGACCGGTTGGAGGAGGTGGCTGCCCCCCGCCCGTGGCCCTGCTCCACCTCCCAGGATGCTTTGAGCCAGCTGGGCC
AGGAGGGCTGGCACCGAGCTCGCTCAGATGACTACTTGAGCCGGGCCACCCGTTCTGCCGAGGCACTGGGGCCAGGGGCACTGGTGTCAC
CCCGCTTTGAGCGGTGTGGCTGGGCTTCCCAGCGTTCGTCTGCCCGCACCCCCGCCTGCCCAACTCGGGACCTGCCAGGGCCCCAGGCCC
CACCCCCGTCTGGCCTGCAGGGCCTGGATGACCTCGGGTACATCGGCTACCGGAGCTACAGCCCATCATTCCAGCGCCGGACCGGCCTCC
TCCATGCGCTCTCCTTCCGGGACTCACCCTTTGGGGGGCTGCCTACCTTCAACCTGGCCCAGTCCCCTGCGTCATTCCCACCAGAGGCCT
CCGAGCCACCCAGGGTTGTACGGCCGGAACCCAGCACCCGGGCCCTGGAGCCTCCTGCGGAGGATCGCGGCGATGAGGTGGTCCTGAGGC
AGAAGCCCCCGACGGGCCGCAAGGTTCAGCTGACCCCCGCAAGACAGATGAACCTTGGATTTGGTGACGAGTCCCCAGAGCCAGAGGCCA
GTGGGCGAGGGGAACGCCTGGGCAGGAAGGTGGCCCCTTTGGCCACCACCGAAGACTCTCTGGCTTCCATCCCCTTTATTGATGAGCCCA
CCAGCCCCAGCATTGACCTCCAAGCCAAGCACGTCCCTGCCTCTGCTGTGGTCTCCAGTGCCATGAACTCAGCCCCTGTCCTGGGCACCA
GCCCATCTTCCCCGACCTTCACTTTCACCCTCGGACGCCATTACTCGCAGGACTGCAGCAGCATCAAGGCTGGCCGCCGCTCCTCCTACC
TGCTGGCCATCACCACGGAGCGCTCCAAGTCCTGCGATGATGGACTCAACACCTTCCGCGACGAGGGCCGGGTTCTGCGGCGCCTGCCAA
ACCGCATACCCAGCCTGCGGATGCTCCGGAGCTTCTTCACCGACGGGTCCTTGGATAGCTGGGGCACCTCTGAAGATGCTGACGCTCCTT
CTAAGCGACACTCAACCTCTGACCTCTCAGATGCGACCTTCAGCGATATCAGGAGAGAAGGCTGGTTGTATTATAAGCAGATTCTCACCA
AGAAGGGGAAGAAAGCGGGCAGCGGCCTGCGCCAGTGGAAGCGGGTGTACGCCGCGCTGCGGGCGCGCTCGCTCTCGCTGAGCAAGGAGC
GGCGGGAGCCCGGGCCGGCGGCGGCGGGGGCTGCGGCGGCCGGCGCAGGTGAGGACGAGGCGGCGCCCGTCTGCATCGGCTCCTGCCTCG
TGGACATCTCCTACAGCGAGACCAAGAGGAGGCACGTGTTCCGGCTGACCACCGCTGACTTCTGTGAATATCTCTTTCAGGCTGAGGACC
GGGATGACATGCTGGGCTGGATCAGAGCGATCCGGGAGAACAGCAGGGCCGAGGGCGAGGACCCCGGCTGTGCCAACCAAGCTCTGATCA
GCAAGAAGCTTAACGATTATCGCAAAGTGAGCCATAGCTCTGGGCCCAAAGCTGATTCCTCCCCCAAAGGCTCTCGCGGCCTGGGGGGCC
TCAAGTCTGAGTTCCTCAAGCAGAGTGCGGCACGTGGCCTCAGGACTCAGGACCTGCCCGCAGGGAGCAAGGATGACAGTGCTGCAGCCC
CCAAAACCCCCTGGGGCATCAACATCATCAAGAAAAATAAGAAGGCCGCTCCGAGGGCGTTTGGGGTCAGGCTGGAGGAGTGCCAGCCAG
CCACGGAGAACCAGCGCGTCCCCTTAATCGTGGCTGCATGCTGTCGCATTGTGGAGGCACGAGGGCTGGAGTCCACAGGCATTTACCGAG
TGCCCGGCAACAATGCAGTGGTGTCCAGCCTACAGGAGCAGCTCAACCGCGGGCCTGGTGACATCAACCTGCAGGATGAGCGCTGGCAAG
ACCTCAATGTGATCAGCAGCCTGCTCAAGTCCTTCTTCCGAAAGCTGCCCGAGCCTCTTTTCACTGATGACAAATACAACGACTTCATCG
AGGCCAACCGCATTGAGGACGCACGGGAGCGAATGAGGACGCTGCGGAAGCTGATCCGGGATCTCCCAGGACACTACTATGAAACGCTCA
AATTCCTTGTGGGCCATCTCAAGACCATCGCTGACCACTCTGAGAAAAACAAGATGGAACCCCGGAACCTGGCCCTGGTCTTTGGGCCGA
CACTGGTGAGGACGTCTGAGGACAACATGACAGACATGGTGACCCACATGCCTGACCGCTACAAGATCGTGGAGACACTGATCCAGCACT
CAGACTGGTTCTTCAGTGACGAAGAGGACAAGGGAGAGAGAACCCCTGTGGGCGACAAGGAGCCTCAGGCAGTGCCCAACATTGAGTACC
TCCTGCCCAACATTGGCAGGACAGTGCCCCCTGGCGACCCGGGGTCAGCGGACCTGTTGGAGATTTAAAGGATTCTACCACCTGTAGTTC
AGCCAAGTCCAAGGGTTCGTGGGCCCCCAAGAAGGAGCCGTACGCCCGGGAGATGCTGGCGATCTCCTTCATCTCGGCCGTCAACCGCAA
GCGCAAGAAGCGGCGGGAGGCGCGGGGGCTGGGCAGCAGCACCGACGACGACTCGGAGCAGGAGGCGCACAAGCCTGGGGCGGGGGCCAC


Top

FusionGenePPI for LASP1_ARHGAP23


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LASP1TRIP13, PLSCR1, FHL3, MDFI, ZYX, TERF1, TINF2, ACD, POT1, ATXN1, FN1, DAZAP2, CD81, GOLGA2, PSMA3, REL, TRIM27, TCF4, FXR2, SPRY2, ARHGEF15, ZC2HC1A, THAP1, SEPT3, LZTS2, RHOXF2, KRTAP4-2, ZBTB9, ZDHHC17, CCDC8, ILK, HAX1, DNAAF2, THAP8, FYTTD1, NFYA, OR10H3, RDH12, SLC25A32, SLC25A44, C11orf65, TAS2R41, AHNAK, ARFGAP1, DDB1, EIF4B, HSPB1, HSPE1, LGALS1, MAP4, NXF1, CRK, STAT3, SH2D2A, CEP170, FBF1, SCLT1, DCTN1, U2AF2, CDH1, ZNF764, SNRNP27, PGK1, EZR, SPTAN1, NCL, UHRF1, NAT10, PDIA5, API5, KRT18, KRT2, G3BP2, AP3M1, NCOR2, CDK12, MYO1C, ACTR3, CLTC, DNMT1, EHMT2, SNAI1, HIST1H3A, TRIM25, TESARHGAP23RPAP1, HNRNPA1, MEPCE, YWHAQ, SAPCD1, CDH1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LASP1_ARHGAP23


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LASP1_ARHGAP23


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLASP1C0004352Autistic Disorder1CTD_human
HgeneLASP1C0036341Schizophrenia1PSYGENET
TgeneARHGAP23C0032460Polycystic Ovary Syndrome1CTD_human