FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19396

FusionGeneSummary for LAMB3_NAMPT

check button Fusion gene summary
Fusion gene informationFusion gene name: LAMB3_NAMPT
Fusion gene ID: 19396
HgeneTgene
Gene symbol

LAMB3

NAMPT

Gene ID

3914

10135

Gene namelaminin subunit beta 3nicotinamide phosphoribosyltransferase
SynonymsAI1A|BM600-125KDA|LAM5|LAMNB11110035O14Rik|PBEF|PBEF1|VF|VISFATIN
Cytomap

1q32.2

7q22.3

Type of geneprotein-codingprotein-coding
Descriptionlaminin subunit beta-3epiligrin subunit batakalinin B1 chainkalinin subunit betakalinin-140kDalaminin B1k chainlaminin S B3 chainlaminin beta 3laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD))laminin-5 subunit betanicein subunit bnicotinamide phosphoribosyltransferaseNAmPRTasepre-B cell-enhancing factorpre-B-cell colony-enhancing factor 1
Modification date2018052220180519
UniProtAcc

Q13751

P43490

Ensembl transtripts involved in fusion geneENST00000356082, ENST00000391911, 
ENST00000367030, 
ENST00000222553, 
ENST00000354289, ENST00000484527, 
Fusion gene scores* DoF score6 X 5 X 2=605 X 5 X 2=50
# samples 65
** MAII scorelog2(6/60*10)=0log2(5/50*10)=0
Context

PubMed: LAMB3 [Title/Abstract] AND NAMPT [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneNAMPT

GO:0008286

insulin receptor signaling pathway

17983582

TgeneNAMPT

GO:0045944

positive regulation of transcription by RNA polymerase II

23001182

TgeneNAMPT

GO:0051770

positive regulation of nitric-oxide synthase biosynthetic process

19727662

TgeneNAMPT

GO:0060612

adipose tissue development

17983582


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDHNSCTCGA-CV-7433-01ALAMB3chr1

209795881

-NAMPTchr7

105894950

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000356082ENST00000222553LAMB3chr1

209795881

-NAMPTchr7

105894950

-
5CDS-intronENST00000356082ENST00000354289LAMB3chr1

209795881

-NAMPTchr7

105894950

-
5CDS-intronENST00000356082ENST00000484527LAMB3chr1

209795881

-NAMPTchr7

105894950

-
Frame-shitENST00000391911ENST00000222553LAMB3chr1

209795881

-NAMPTchr7

105894950

-
5CDS-intronENST00000391911ENST00000354289LAMB3chr1

209795881

-NAMPTchr7

105894950

-
5CDS-intronENST00000391911ENST00000484527LAMB3chr1

209795881

-NAMPTchr7

105894950

-
In-frameENST00000367030ENST00000222553LAMB3chr1

209795881

-NAMPTchr7

105894950

-
5CDS-intronENST00000367030ENST00000354289LAMB3chr1

209795881

-NAMPTchr7

105894950

-
5CDS-intronENST00000367030ENST00000484527LAMB3chr1

209795881

-NAMPTchr7

105894950

-

Top

FusionProtFeatures for LAMB3_NAMPT


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
LAMB3

Q13751

NAMPT

P43490

Binding to cells via a high affinity receptor, lamininis thought to mediate the attachment, migration and organizationof cells into tissues during embryonic development by interactingwith other extracellular matrix components. Catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamidemononucleotide, an intermediate in the biosynthesis of NAD. It isthe rate limiting component in the mammalian NAD biosynthesispathway. The secreted form behaves both as a cytokine withimmunomodulating properties and an adipokine with anti-diabeticproperties, it has no enzymatic activity, partly because of lackof activation by ATP, which has a low level in extracellular spaceand plasma. Plays a role in the modulation of circadian clockfunction. NAMPT-dependent oscillatory production of NAD regulatesoscillation of clock target gene expression by releasing the coreclock component: CLOCK-ARNTL/BMAL1 heterodimer from NAD-dependentSIRT1-mediated suppression (By similarity).{ECO:0000250|UniProtKB:Q99KQ4, ECO:0000269|PubMed:24130902}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLAMB3chr1:209795881chr7:105894950ENST00000356082-1823723_7579001173Coiled coilOntology_term=ECO:0000255
HgeneLAMB3chr1:209795881chr7:105894950ENST00000356082-1823831_8849001173Coiled coilOntology_term=ECO:0000255
HgeneLAMB3chr1:209795881chr7:105894950ENST00000367030-1823723_7579001173Coiled coilOntology_term=ECO:0000255
HgeneLAMB3chr1:209795881chr7:105894950ENST00000367030-1823831_8849001173Coiled coilOntology_term=ECO:0000255
HgeneLAMB3chr1:209795881chr7:105894950ENST00000391911-1722723_7579001173Coiled coilOntology_term=ECO:0000255
HgeneLAMB3chr1:209795881chr7:105894950ENST00000391911-1722831_8849001173Coiled coilOntology_term=ECO:0000255
HgeneLAMB3chr1:209795881chr7:105894950ENST00000356082-182322_2499001173DomainLaminin N-terminal
HgeneLAMB3chr1:209795881chr7:105894950ENST00000356082-1823250_3159001173DomainLaminin EGF-like 1
HgeneLAMB3chr1:209795881chr7:105894950ENST00000356082-1823316_3789001173DomainLaminin EGF-like 2
HgeneLAMB3chr1:209795881chr7:105894950ENST00000356082-1823379_4309001173DomainLaminin EGF-like 3
HgeneLAMB3chr1:209795881chr7:105894950ENST00000356082-1823431_4809001173DomainLaminin EGF-like 4
HgeneLAMB3chr1:209795881chr7:105894950ENST00000356082-1823481_5339001173DomainLaminin EGF-like 5
HgeneLAMB3chr1:209795881chr7:105894950ENST00000356082-1823534_5809001173DomainLaminin EGF-like 6
HgeneLAMB3chr1:209795881chr7:105894950ENST00000367030-182322_2499001173DomainLaminin N-terminal
HgeneLAMB3chr1:209795881chr7:105894950ENST00000367030-1823250_3159001173DomainLaminin EGF-like 1
HgeneLAMB3chr1:209795881chr7:105894950ENST00000367030-1823316_3789001173DomainLaminin EGF-like 2
HgeneLAMB3chr1:209795881chr7:105894950ENST00000367030-1823379_4309001173DomainLaminin EGF-like 3
HgeneLAMB3chr1:209795881chr7:105894950ENST00000367030-1823431_4809001173DomainLaminin EGF-like 4
HgeneLAMB3chr1:209795881chr7:105894950ENST00000367030-1823481_5339001173DomainLaminin EGF-like 5
HgeneLAMB3chr1:209795881chr7:105894950ENST00000367030-1823534_5809001173DomainLaminin EGF-like 6
HgeneLAMB3chr1:209795881chr7:105894950ENST00000391911-172222_2499001173DomainLaminin N-terminal
HgeneLAMB3chr1:209795881chr7:105894950ENST00000391911-1722250_3159001173DomainLaminin EGF-like 1
HgeneLAMB3chr1:209795881chr7:105894950ENST00000391911-1722316_3789001173DomainLaminin EGF-like 2
HgeneLAMB3chr1:209795881chr7:105894950ENST00000391911-1722379_4309001173DomainLaminin EGF-like 3
HgeneLAMB3chr1:209795881chr7:105894950ENST00000391911-1722431_4809001173DomainLaminin EGF-like 4
HgeneLAMB3chr1:209795881chr7:105894950ENST00000391911-1722481_5339001173DomainLaminin EGF-like 5
HgeneLAMB3chr1:209795881chr7:105894950ENST00000391911-1722534_5809001173DomainLaminin EGF-like 6
HgeneLAMB3chr1:209795881chr7:105894950ENST00000356082-1823579_7859001173RegionNote=Domain II
HgeneLAMB3chr1:209795881chr7:105894950ENST00000356082-1823786_8169001173RegionNote=Domain alpha
HgeneLAMB3chr1:209795881chr7:105894950ENST00000367030-1823579_7859001173RegionNote=Domain II
HgeneLAMB3chr1:209795881chr7:105894950ENST00000367030-1823786_8169001173RegionNote=Domain alpha
HgeneLAMB3chr1:209795881chr7:105894950ENST00000391911-1722579_7859001173RegionNote=Domain II
HgeneLAMB3chr1:209795881chr7:105894950ENST00000391911-1722786_8169001173RegionNote=Domain alpha
TgeneNAMPTchr1:209795881chr7:105894950ENST00000354289-08311_313-13369RegionNote=Nicotinamide ribonucleotide binding
TgeneNAMPTchr1:209795881chr7:105894950ENST00000354289-08353_354-13369RegionNote=Nicotinamide ribonucleotide binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneLAMB3chr1:209795881chr7:105894950ENST00000356082-1823948_11339001173Coiled coilOntology_term=ECO:0000255
HgeneLAMB3chr1:209795881chr7:105894950ENST00000367030-1823948_11339001173Coiled coilOntology_term=ECO:0000255
HgeneLAMB3chr1:209795881chr7:105894950ENST00000391911-1722948_11339001173Coiled coilOntology_term=ECO:0000255
HgeneLAMB3chr1:209795881chr7:105894950ENST00000356082-1823817_11709001173RegionNote=Domain I
HgeneLAMB3chr1:209795881chr7:105894950ENST00000367030-1823817_11709001173RegionNote=Domain I
HgeneLAMB3chr1:209795881chr7:105894950ENST00000391911-1722817_11709001173RegionNote=Domain I
TgeneNAMPTchr1:209795881chr7:105894950ENST00000222553-711311_313363492RegionNote=Nicotinamide ribonucleotide binding
TgeneNAMPTchr1:209795881chr7:105894950ENST00000222553-711353_354363492RegionNote=Nicotinamide ribonucleotide binding


Top

FusionGeneSequence for LAMB3_NAMPT


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_LAMB3_ENST00000356082_chr1_209795881_-_NAMPT_ENST00000222553_chr7_105894950_-_1029aa
MRPFFLLCFALPGLLHAQQACSRGACTPPVGDLLVGRTRFLRASSTCGLTKPETYCTQTGEWQMKCCKCDSRQPHNYYSHRVENVASSSG
PMRWWQSQNDVNPVSLQLDLDRRFQLQEVMMEFQGPMPAGMLIERSSDFGKTWRVYQYLAADCTSTFPRVRQGRPQSWQDVRCQSLPQRP
NARLNGGKVQLNLMDLVSGIPATQSQKIQEVGEITNLRVNFTRLAPVPQRGYHPPSAYTAVSQLRLQGSCFCHGHADRCAPKPGASAGPS
TAVQVHDVCVCQHNTAGPNCERCAPFYNNRPWRPAEGQDAHECQRCDCNGHSETCHFDPAVFAASQGATGGVCDNCRDHTEGKNCERCQL
HTFRNRRPGASIQETCISCECDPDGAVPGAPCDPVTGQCVCKEHVQGERCDLCKPGFTGLTYANPQGCHRCDCNILGSRRDMPCDEESGR
CLCLPNVVGPKCDQCAPYHWKLASGQGCEPCACDPHNSLSPQCNQFTGQCPCREGFGGLMCSAAAIRQCPDRTTGDVATGCRACDCDFRG
TEGPGCDKASGRCLCRPGLTGPRCDQCQRGYCNRYPVCVACHPCFQTTDADLREQALRFGRLRNATASLWSGPGLEDRGLASRILDAKSK
IEQIRAVLSSPAVTEQEVAQVASAILSLRRTLQGLQLDLPLEEETLSLPRDLESLDRSFNGLLTMTQRKREQFEKISSADPSGAFRMLST
AYEQSAQAAQQVSDSSRLLDQLRDSRREAERLVRQAGGGGGTGSPKLVALRLEMSSLPDLTPTFNKLCGNSRQMACTPISCPGELCPQDN
GTACGSRCRGVLPRAGGAFLMAGQVAEQLRGFNAQLQRTRQMIRAAEESASQIQSSAQRLETQVSASRSQMEEDVRRTRLLIQQVRDFLT
DCRRHETKNVET_KTCLRFWWRFATEVDKRSLELFLQV_LCCN_WPWD_RLQGPSC_SQQKVQKGPIIFT_DASREFCYTGGRKRRP_GI

>In-frame_LAMB3_ENST00000367030_chr1_209795881_-_NAMPT_ENST00000222553_chr7_105894950_-_1029aa
MRPFFLLCFALPGLLHAQQACSRGACTPPVGDLLVGRTRFLRASSTCGLTKPETYCTQTGEWQMKCCKCDSRQPHNYYSHRVENVASSSG
PMRWWQSQNDVNPVSLQLDLDRRFQLQEVMMEFQGPMPAGMLIERSSDFGKTWRVYQYLAADCTSTFPRVRQGRPQSWQDVRCQSLPQRP
NARLNGGKVQLNLMDLVSGIPATQSQKIQEVGEITNLRVNFTRLAPVPQRGYHPPSAYTAVSQLRLQGSCFCHGHADRCAPKPGASAGPS
TAVQVHDVCVCQHNTAGPNCERCAPFYNNRPWRPAEGQDAHECQRCDCNGHSETCHFDPAVFAASQGATGGVCDNCRDHTEGKNCERCQL
HTFRNRRPGASIQETCISCECDPDGAVPGAPCDPVTGQCVCKEHVQGERCDLCKPGFTGLTYANPQGCHRCDCNILGSRRDMPCDEESGR
CLCLPNVVGPKCDQCAPYHWKLASGQGCEPCACDPHNSLSPQCNQFTGQCPCREGFGGLMCSAAAIRQCPDRTTGDVATGCRACDCDFRG
TEGPGCDKASGRCLCRPGLTGPRCDQCQRGYCNRYPVCVACHPCFQTTDADLREQALRFGRLRNATASLWSGPGLEDRGLASRILDAKSK
IEQIRAVLSSPAVTEQEVAQVASAILSLRRTLQGLQLDLPLEEETLSLPRDLESLDRSFNGLLTMTQRKREQFEKISSADPSGAFRMLST
AYEQSAQAAQQVSDSSRLLDQLRDSRREAERLVRQAGGGGGTGSPKLVALRLEMSSLPDLTPTFNKLCGNSRQMACTPISCPGELCPQDN
GTACGSRCRGVLPRAGGAFLMAGQVAEQLRGFNAQLQRTRQMIRAAEESASQIQSSAQRLETQVSASRSQMEEDVRRTRLLIQQVRDFLT
DCRRHETKNVET_KTCLRFWWRFATEVDKRSLELFLQV_LCCN_WPWD_RLQGPSC_SQQKVQKGPIIFT_DASREFCYTGGRKRRP_GI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_LAMB3_ENST00000356082_chr1_209795881_-_NAMPT_ENST00000222553_chr7_105894950_-_3088nt
ATGAGACCATTCTTCCTCTTGTGTTTTGCCCTGCCTGGCCTCCTGCATGCCCAACAAGCCTGCTCCCGTGGGGCCTGCTATCCACCTGTT
GGGGACCTGCTTGTTGGGAGGACCCGGTTTCTCCGAGCTTCATCTACCTGTGGACTGACCAAGCCTGAGACCTACTGCACCCAGTATGGC
GAGTGGCAGATGAAATGCTGCAAGTGTGACTCCAGGCAGCCTCACAACTACTACAGTCACCGAGTAGAGAATGTGGCTTCATCCTCCGGC
CCCATGCGCTGGTGGCAGTCACAGAATGATGTGAACCCTGTCTCTCTGCAGCTGGACCTGGACAGGAGATTCCAGCTTCAAGAAGTCATG
ATGGAGTTCCAGGGGCCCATGCCCGCCGGCATGCTGATTGAGCGCTCCTCAGACTTCGGTAAGACCTGGCGAGTGTACCAGTACCTGGCT
GCCGACTGCACCTCCACCTTCCCTCGGGTCCGCCAGGGTCGGCCTCAGAGCTGGCAGGATGTTCGGTGCCAGTCCCTGCCTCAGAGGCCT
AATGCACGCCTAAATGGGGGGAAGGTCCAACTTAACCTTATGGATTTAGTGTCTGGGATTCCAGCAACTCAAAGTCAAAAAATTCAAGAG
GTGGGGGAGATCACAAACTTGAGAGTCAATTTCACCAGGCTGGCCCCTGTGCCCCAAAGGGGCTACCACCCTCCCAGCGCCTACTATGCT
GTGTCCCAGCTCCGTCTGCAGGGGAGCTGCTTCTGTCACGGCCATGCTGATCGCTGCGCACCCAAGCCTGGGGCCTCTGCAGGCCCCTCC
ACCGCTGTGCAGGTCCACGATGTCTGTGTCTGCCAGCACAACACTGCCGGCCCAAATTGTGAGCGCTGTGCACCCTTCTACAACAACCGG
CCCTGGAGACCGGCGGAGGGCCAGGACGCCCATGAATGCCAAAGGTGCGACTGCAATGGGCACTCAGAGACATGTCACTTTGACCCCGCT
GTGTTTGCCGCCAGCCAGGGGGCATATGGAGGTGTGTGTGACAATTGCCGGGACCACACCGAAGGCAAGAACTGTGAGCGGTGTCAGCTG
CACTATTTCCGGAACCGGCGCCCGGGAGCTTCCATTCAGGAGACCTGCATCTCCTGCGAGTGTGATCCGGATGGGGCAGTGCCAGGGGCT
CCCTGTGACCCAGTGACCGGGCAGTGTGTGTGCAAGGAGCATGTGCAGGGAGAGCGCTGTGACCTATGCAAGCCGGGCTTCACTGGACTC
ACCTACGCCAACCCGCAGGGCTGCCACCGCTGTGACTGCAACATCCTGGGGTCCCGGAGGGACATGCCGTGTGACGAGGAGAGTGGGCGC
TGCCTTTGTCTGCCCAACGTGGTGGGTCCCAAATGTGACCAGTGTGCTCCCTACCACTGGAAGCTGGCCAGTGGCCAGGGCTGTGAACCG
TGTGCCTGCGACCCGCACAACTCCCTCAGCCCACAGTGCAACCAGTTCACAGGGCAGTGCCCCTGTCGGGAAGGCTTTGGTGGCCTGATG
TGCAGCGCTGCAGCCATCCGCCAGTGTCCAGACCGGACCTATGGAGACGTGGCCACAGGATGCCGAGCCTGTGACTGTGATTTCCGGGGA
ACAGAGGGCCCGGGCTGCGACAAGGCATCAGGCCGCTGCCTCTGCCGCCCTGGCTTGACCGGGCCCCGCTGTGACCAGTGCCAGCGAGGC
TACTGTAATCGCTACCCGGTGTGCGTGGCCTGCCACCCTTGCTTCCAGACCTATGATGCGGACCTCCGGGAGCAGGCCCTGCGCTTTGGT
AGACTCCGCAATGCCACCGCCAGCCTGTGGTCAGGGCCTGGGCTGGAGGACCGTGGCCTGGCCTCCCGGATCCTAGATGCAAAGAGTAAG
ATTGAGCAGATCCGAGCAGTTCTCAGCAGCCCCGCAGTCACAGAGCAGGAGGTGGCTCAGGTGGCCAGTGCCATCCTCTCCCTCAGGCGA
ACTCTCCAGGGCCTGCAGCTGGATCTGCCCCTGGAGGAGGAGACGTTGTCCCTTCCGAGAGACCTGGAGAGTCTTGACAGAAGCTTCAAT
GGTCTCCTTACTATGTATCAGAGGAAGAGGGAGCAGTTTGAAAAAATAAGCAGTGCTGATCCTTCAGGAGCCTTCCGGATGCTGAGCACA
GCCTACGAGCAGTCAGCCCAGGCTGCTCAGCAGGTCTCCGACAGCTCGCGCCTTTTGGACCAGCTCAGGGACAGCCGGAGAGAGGCAGAG
AGGCTGGTGCGGCAGGCGGGAGGAGGAGGAGGCACCGGCAGCCCCAAGCTTGTGGCCCTGAGGCTGGAGATGTCTTCGTTGCCTGACCTG
ACACCCACCTTCAACAAGCTCTGTGGCAACTCCAGGCAGATGGCTTGCACCCCAATATCATGCCCTGGTGAGCTATGTCCCCAAGACAAT
GGCACAGCCTGTGGCTCCCGCTGCAGGGGTGTCCTTCCCAGGGCCGGTGGGGCCTTCTTGATGGCGGGGCAGGTGGCTGAGCAGCTGCGG
GGCTTCAATGCCCAGCTCCAGCGGACCAGGCAGATGATTAGGGCAGCCGAGGAATCTGCCTCACAGATTCAATCCAGTGCCCAGCGCTTG
GAGACCCAGGTGAGCGCCAGCCGCTCCCAGATGGAGGAAGATGTCAGACGCACACGGCTCCTAATCCAGCAGGTCCGGGACTTCCTAACA
GATTGTAGAAGGCATGAAACAAAAAATGTGGAGTATTGAAAATATTGCCTTCGGTTCTGGTGGAGGTTTGCTACAGAAGTTGACAAGAGA
TCTCTTGAATTGTTCCTTCAAGTGTAGCTATGTTGTAACTAATGGCCTTGGGATTAACGTCTTCAAGGACCCAGTTGCTGATCCCAACAA
AAGGTCCAAAAAGGGCCGATTATCTTTACATAGGACGCCAGCAGGGAATTTTGTTACACTGGAGGAAGGAAAAGGAGACCTTGAGGAATA
TGGTCAGGATCTTCTCCATACTGTCTTCAAGAATGGCAAGGTGACAAAAAGCTATTCATTTGATGAAATAAGAAAAAATGCACAGCTGAA

>In-frame_LAMB3_ENST00000367030_chr1_209795881_-_NAMPT_ENST00000222553_chr7_105894950_-_3088nt
ATGAGACCATTCTTCCTCTTGTGTTTTGCCCTGCCTGGCCTCCTGCATGCCCAACAAGCCTGCTCCCGTGGGGCCTGCTATCCACCTGTT
GGGGACCTGCTTGTTGGGAGGACCCGGTTTCTCCGAGCTTCATCTACCTGTGGACTGACCAAGCCTGAGACCTACTGCACCCAGTATGGC
GAGTGGCAGATGAAATGCTGCAAGTGTGACTCCAGGCAGCCTCACAACTACTACAGTCACCGAGTAGAGAATGTGGCTTCATCCTCCGGC
CCCATGCGCTGGTGGCAGTCACAGAATGATGTGAACCCTGTCTCTCTGCAGCTGGACCTGGACAGGAGATTCCAGCTTCAAGAAGTCATG
ATGGAGTTCCAGGGGCCCATGCCCGCCGGCATGCTGATTGAGCGCTCCTCAGACTTCGGTAAGACCTGGCGAGTGTACCAGTACCTGGCT
GCCGACTGCACCTCCACCTTCCCTCGGGTCCGCCAGGGTCGGCCTCAGAGCTGGCAGGATGTTCGGTGCCAGTCCCTGCCTCAGAGGCCT
AATGCACGCCTAAATGGGGGGAAGGTCCAACTTAACCTTATGGATTTAGTGTCTGGGATTCCAGCAACTCAAAGTCAAAAAATTCAAGAG
GTGGGGGAGATCACAAACTTGAGAGTCAATTTCACCAGGCTGGCCCCTGTGCCCCAAAGGGGCTACCACCCTCCCAGCGCCTACTATGCT
GTGTCCCAGCTCCGTCTGCAGGGGAGCTGCTTCTGTCACGGCCATGCTGATCGCTGCGCACCCAAGCCTGGGGCCTCTGCAGGCCCCTCC
ACCGCTGTGCAGGTCCACGATGTCTGTGTCTGCCAGCACAACACTGCCGGCCCAAATTGTGAGCGCTGTGCACCCTTCTACAACAACCGG
CCCTGGAGACCGGCGGAGGGCCAGGACGCCCATGAATGCCAAAGGTGCGACTGCAATGGGCACTCAGAGACATGTCACTTTGACCCCGCT
GTGTTTGCCGCCAGCCAGGGGGCATATGGAGGTGTGTGTGACAATTGCCGGGACCACACCGAAGGCAAGAACTGTGAGCGGTGTCAGCTG
CACTATTTCCGGAACCGGCGCCCGGGAGCTTCCATTCAGGAGACCTGCATCTCCTGCGAGTGTGATCCGGATGGGGCAGTGCCAGGGGCT
CCCTGTGACCCAGTGACCGGGCAGTGTGTGTGCAAGGAGCATGTGCAGGGAGAGCGCTGTGACCTATGCAAGCCGGGCTTCACTGGACTC
ACCTACGCCAACCCGCAGGGCTGCCACCGCTGTGACTGCAACATCCTGGGGTCCCGGAGGGACATGCCGTGTGACGAGGAGAGTGGGCGC
TGCCTTTGTCTGCCCAACGTGGTGGGTCCCAAATGTGACCAGTGTGCTCCCTACCACTGGAAGCTGGCCAGTGGCCAGGGCTGTGAACCG
TGTGCCTGCGACCCGCACAACTCCCTCAGCCCACAGTGCAACCAGTTCACAGGGCAGTGCCCCTGTCGGGAAGGCTTTGGTGGCCTGATG
TGCAGCGCTGCAGCCATCCGCCAGTGTCCAGACCGGACCTATGGAGACGTGGCCACAGGATGCCGAGCCTGTGACTGTGATTTCCGGGGA
ACAGAGGGCCCGGGCTGCGACAAGGCATCAGGCCGCTGCCTCTGCCGCCCTGGCTTGACCGGGCCCCGCTGTGACCAGTGCCAGCGAGGC
TACTGTAATCGCTACCCGGTGTGCGTGGCCTGCCACCCTTGCTTCCAGACCTATGATGCGGACCTCCGGGAGCAGGCCCTGCGCTTTGGT
AGACTCCGCAATGCCACCGCCAGCCTGTGGTCAGGGCCTGGGCTGGAGGACCGTGGCCTGGCCTCCCGGATCCTAGATGCAAAGAGTAAG
ATTGAGCAGATCCGAGCAGTTCTCAGCAGCCCCGCAGTCACAGAGCAGGAGGTGGCTCAGGTGGCCAGTGCCATCCTCTCCCTCAGGCGA
ACTCTCCAGGGCCTGCAGCTGGATCTGCCCCTGGAGGAGGAGACGTTGTCCCTTCCGAGAGACCTGGAGAGTCTTGACAGAAGCTTCAAT
GGTCTCCTTACTATGTATCAGAGGAAGAGGGAGCAGTTTGAAAAAATAAGCAGTGCTGATCCTTCAGGAGCCTTCCGGATGCTGAGCACA
GCCTACGAGCAGTCAGCCCAGGCTGCTCAGCAGGTCTCCGACAGCTCGCGCCTTTTGGACCAGCTCAGGGACAGCCGGAGAGAGGCAGAG
AGGCTGGTGCGGCAGGCGGGAGGAGGAGGAGGCACCGGCAGCCCCAAGCTTGTGGCCCTGAGGCTGGAGATGTCTTCGTTGCCTGACCTG
ACACCCACCTTCAACAAGCTCTGTGGCAACTCCAGGCAGATGGCTTGCACCCCAATATCATGCCCTGGTGAGCTATGTCCCCAAGACAAT
GGCACAGCCTGTGGCTCCCGCTGCAGGGGTGTCCTTCCCAGGGCCGGTGGGGCCTTCTTGATGGCGGGGCAGGTGGCTGAGCAGCTGCGG
GGCTTCAATGCCCAGCTCCAGCGGACCAGGCAGATGATTAGGGCAGCCGAGGAATCTGCCTCACAGATTCAATCCAGTGCCCAGCGCTTG
GAGACCCAGGTGAGCGCCAGCCGCTCCCAGATGGAGGAAGATGTCAGACGCACACGGCTCCTAATCCAGCAGGTCCGGGACTTCCTAACA
GATTGTAGAAGGCATGAAACAAAAAATGTGGAGTATTGAAAATATTGCCTTCGGTTCTGGTGGAGGTTTGCTACAGAAGTTGACAAGAGA
TCTCTTGAATTGTTCCTTCAAGTGTAGCTATGTTGTAACTAATGGCCTTGGGATTAACGTCTTCAAGGACCCAGTTGCTGATCCCAACAA
AAGGTCCAAAAAGGGCCGATTATCTTTACATAGGACGCCAGCAGGGAATTTTGTTACACTGGAGGAAGGAAAAGGAGACCTTGAGGAATA
TGGTCAGGATCTTCTCCATACTGTCTTCAAGAATGGCAAGGTGACAAAAAGCTATTCATTTGATGAAATAAGAAAAAATGCACAGCTGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_LAMB3_ENST00000356082_chr1_209795881_-_NAMPT_ENST00000222553_chr7_105894950_-_6021nt
GGCTGTTGTTTAAAAACCTGGAGCCGGGAGGGGAGACCCCCACATTCAAGAGGAGCTTTCAGGCGATCTGGAGAAAGAACGGCAGAACAC
ACAGCAAGGAAAGGTCCTTTCTGGGGATCACCCCATTGGCTGAAGATGAGACCATTCTTCCTCTTGTGTTTTGCCCTGCCTGGCCTCCTG
CATGCCCAACAAGCCTGCTCCCGTGGGGCCTGCTATCCACCTGTTGGGGACCTGCTTGTTGGGAGGACCCGGTTTCTCCGAGCTTCATCT
ACCTGTGGACTGACCAAGCCTGAGACCTACTGCACCCAGTATGGCGAGTGGCAGATGAAATGCTGCAAGTGTGACTCCAGGCAGCCTCAC
AACTACTACAGTCACCGAGTAGAGAATGTGGCTTCATCCTCCGGCCCCATGCGCTGGTGGCAGTCACAGAATGATGTGAACCCTGTCTCT
CTGCAGCTGGACCTGGACAGGAGATTCCAGCTTCAAGAAGTCATGATGGAGTTCCAGGGGCCCATGCCCGCCGGCATGCTGATTGAGCGC
TCCTCAGACTTCGGTAAGACCTGGCGAGTGTACCAGTACCTGGCTGCCGACTGCACCTCCACCTTCCCTCGGGTCCGCCAGGGTCGGCCT
CAGAGCTGGCAGGATGTTCGGTGCCAGTCCCTGCCTCAGAGGCCTAATGCACGCCTAAATGGGGGGAAGGTCCAACTTAACCTTATGGAT
TTAGTGTCTGGGATTCCAGCAACTCAAAGTCAAAAAATTCAAGAGGTGGGGGAGATCACAAACTTGAGAGTCAATTTCACCAGGCTGGCC
CCTGTGCCCCAAAGGGGCTACCACCCTCCCAGCGCCTACTATGCTGTGTCCCAGCTCCGTCTGCAGGGGAGCTGCTTCTGTCACGGCCAT
GCTGATCGCTGCGCACCCAAGCCTGGGGCCTCTGCAGGCCCCTCCACCGCTGTGCAGGTCCACGATGTCTGTGTCTGCCAGCACAACACT
GCCGGCCCAAATTGTGAGCGCTGTGCACCCTTCTACAACAACCGGCCCTGGAGACCGGCGGAGGGCCAGGACGCCCATGAATGCCAAAGG
TGCGACTGCAATGGGCACTCAGAGACATGTCACTTTGACCCCGCTGTGTTTGCCGCCAGCCAGGGGGCATATGGAGGTGTGTGTGACAAT
TGCCGGGACCACACCGAAGGCAAGAACTGTGAGCGGTGTCAGCTGCACTATTTCCGGAACCGGCGCCCGGGAGCTTCCATTCAGGAGACC
TGCATCTCCTGCGAGTGTGATCCGGATGGGGCAGTGCCAGGGGCTCCCTGTGACCCAGTGACCGGGCAGTGTGTGTGCAAGGAGCATGTG
CAGGGAGAGCGCTGTGACCTATGCAAGCCGGGCTTCACTGGACTCACCTACGCCAACCCGCAGGGCTGCCACCGCTGTGACTGCAACATC
CTGGGGTCCCGGAGGGACATGCCGTGTGACGAGGAGAGTGGGCGCTGCCTTTGTCTGCCCAACGTGGTGGGTCCCAAATGTGACCAGTGT
GCTCCCTACCACTGGAAGCTGGCCAGTGGCCAGGGCTGTGAACCGTGTGCCTGCGACCCGCACAACTCCCTCAGCCCACAGTGCAACCAG
TTCACAGGGCAGTGCCCCTGTCGGGAAGGCTTTGGTGGCCTGATGTGCAGCGCTGCAGCCATCCGCCAGTGTCCAGACCGGACCTATGGA
GACGTGGCCACAGGATGCCGAGCCTGTGACTGTGATTTCCGGGGAACAGAGGGCCCGGGCTGCGACAAGGCATCAGGCCGCTGCCTCTGC
CGCCCTGGCTTGACCGGGCCCCGCTGTGACCAGTGCCAGCGAGGCTACTGTAATCGCTACCCGGTGTGCGTGGCCTGCCACCCTTGCTTC
CAGACCTATGATGCGGACCTCCGGGAGCAGGCCCTGCGCTTTGGTAGACTCCGCAATGCCACCGCCAGCCTGTGGTCAGGGCCTGGGCTG
GAGGACCGTGGCCTGGCCTCCCGGATCCTAGATGCAAAGAGTAAGATTGAGCAGATCCGAGCAGTTCTCAGCAGCCCCGCAGTCACAGAG
CAGGAGGTGGCTCAGGTGGCCAGTGCCATCCTCTCCCTCAGGCGAACTCTCCAGGGCCTGCAGCTGGATCTGCCCCTGGAGGAGGAGACG
TTGTCCCTTCCGAGAGACCTGGAGAGTCTTGACAGAAGCTTCAATGGTCTCCTTACTATGTATCAGAGGAAGAGGGAGCAGTTTGAAAAA
ATAAGCAGTGCTGATCCTTCAGGAGCCTTCCGGATGCTGAGCACAGCCTACGAGCAGTCAGCCCAGGCTGCTCAGCAGGTCTCCGACAGC
TCGCGCCTTTTGGACCAGCTCAGGGACAGCCGGAGAGAGGCAGAGAGGCTGGTGCGGCAGGCGGGAGGAGGAGGAGGCACCGGCAGCCCC
AAGCTTGTGGCCCTGAGGCTGGAGATGTCTTCGTTGCCTGACCTGACACCCACCTTCAACAAGCTCTGTGGCAACTCCAGGCAGATGGCT
TGCACCCCAATATCATGCCCTGGTGAGCTATGTCCCCAAGACAATGGCACAGCCTGTGGCTCCCGCTGCAGGGGTGTCCTTCCCAGGGCC
GGTGGGGCCTTCTTGATGGCGGGGCAGGTGGCTGAGCAGCTGCGGGGCTTCAATGCCCAGCTCCAGCGGACCAGGCAGATGATTAGGGCA
GCCGAGGAATCTGCCTCACAGATTCAATCCAGTGCCCAGCGCTTGGAGACCCAGGTGAGCGCCAGCCGCTCCCAGATGGAGGAAGATGTC
AGACGCACACGGCTCCTAATCCAGCAGGTCCGGGACTTCCTAACAGATTGTAGAAGGCATGAAACAAAAAATGTGGAGTATTGAAAATAT
TGCCTTCGGTTCTGGTGGAGGTTTGCTACAGAAGTTGACAAGAGATCTCTTGAATTGTTCCTTCAAGTGTAGCTATGTTGTAACTAATGG
CCTTGGGATTAACGTCTTCAAGGACCCAGTTGCTGATCCCAACAAAAGGTCCAAAAAGGGCCGATTATCTTTACATAGGACGCCAGCAGG
GAATTTTGTTACACTGGAGGAAGGAAAAGGAGACCTTGAGGAATATGGTCAGGATCTTCTCCATACTGTCTTCAAGAATGGCAAGGTGAC
AAAAAGCTATTCATTTGATGAAATAAGAAAAAATGCACAGCTGAATATTGAACTGGAAGCAGCACATCATTAGGCTTTATGACTGGGTGT
GTGTTGTGTGTATGTAATACATAATGTTTATTGTACAGATGTGTGGGGTTTGTGTTTTATGATACATTACAGCCAAATTATTTGTTGGTT
TATGGACATACTGCCCTTTCATTTTTTTTCTTTTCCAGTGTTTAGGTGATCTCAAATTAGGAAATGCATTTAACCATGTAAAAGATGAGT
GCTAAAGTAAGCTTTTTAGGGCCCTTTGCCAATAGGTAGTCATTCAATCTGGTATTGATCTTTTCACAAATAACAGAACTGAGAAACTTT
TATATATAACTGATGATCACATAAAACAGATTTGCATAAAATTACCATGATTGCTTTATGTTTATATTTAACTTGTATTTTTGTACAAAC
AAGATTGTGTAAGATATATTTGAAGTTTCAGTGATTTAACAGTCTTTCCAACTTTTCATGATTTTTATGAGCACAGACTTTCAAGAAAAT
ACTTGAAAATAAATTACATTGCCTTTTGTCCATTAATCAGCAAATAAAACATGGCCTTAACAAAGTTGTTTGTGTTATTGTACAATTTGA
AAATTATGTCGGGACATACCCTATAGAATTACTAACCTTACTGCCCCTTGTAGAATATGTATTAATCATTCTACATTAAAGAAAATAATG
GTTCTTACTGGAATGTCTAGGCACTGTACAGTTATTATATATCTTGGTTGTTGTATTGTACCAGTGAAATGCCAAATTTGAAAGGCCTGT
ACTGCAATTTTATATGTCAGAGATTGCCTGTGGCTCTAATATGCACCTCAAGATTTTAAGGAGATAATGTTTTTAGAGAGAATTTCTGCT
TCCACTATAGAATATATACATAAATGTAAAATACTTACAAAAGTGGAAGTAGTGTATTTTAAAGTAATTACACTTCTGAATTTATTTTTC
ATATTCTATAGTTGGTATGACTTAAATGAATTACTGGAGTGGGTAGTGAGTGTACTTAAATGTTTCAATTCTGTTATATTTTTTATTAAG
TTTTTAAAAAATTAAATTGGATATTAAATTGTATGGACATCATTTATTAATTTTAAACTGAATGCCCTCAATAAGTAATACTGAAGCACA
TTCTTAAATGAAGATAAATTATCTCCAATGAAAAGCATGACATGTGTTTCAATAGAAGAATCTTAAGTTGGCTAAATTCAAAGTGCTTGA
CATCAAAATGTTCTAGAGTGATTAGCTACTAGATTCTGAATCATACATCACATCTGACTAGAGACCAGTTTCTTTCGAATGATTCTTTTA
TGTATGTAGATCTGTTCTTCTGAGGCAGCGGTTGGCCAACTATAGCCCAAAGGCCAAATTTGGACTTCTTTTTATAAATGCAGATTGTCT
ATGGCTGCTTTCCCACTACTCCAGCCTAAGGTAAACAGCTGCAATAGAAGCCAAATGAGAATCGCAAAGCCCAAAATGTTTATTAACCTG
CCCTTTACACAAAATTACACAAAAAGTTTCCTGATCTCTGTTCTAAGAAAAGGAGTGTGCCTTGCATTTAAAAGGAAATGTTGGTTTCTA
GGGAAGGGAGGAGGCTAAATAATTGATACGGAATTTTCCTCTTTTGTCTTCTTTTTTCTCACTTAAGAATCCGATACTGGAAGACTGATT
TAGAAAAGTTTTTAACATGACATTAAATGTGAAATTTTAAAAATTGAAAAGCCATAAATCATCTGTTTTAAATAGTTACATGAGAAAATG
ATCACTAGAATAACCTAATTAGAAGTGTTATCTTCATTAAATGTTTTTTGTAAGTGGTATTAGAAAGAATATGTTTTTCAGATGGTTCTT
TAAACATGTAGTGAGAACAATAAGCATTATTCACTTTTAGTAAGTCTTCTGTAATCCATGATATAAAATAATTTTAAAATGATTTTTTAA
TGTATTTGAGTAAAGATGAGTAGTATTAAGAAAAACACACATTTCTTCACAAAATGTGCTAAGGGGCGTGTAAAGAATCAAAAGAAACTA
TTACCAATAATAGTTTTGATAATCACCCATAATTTTGTGTTTAAACATTGAAATTATAGTACAGACAGTATTCTCTGTGTTCTGTGAATT
TCAGCAGCTTCAGAATAGAGTTTAATTTAGAAATTTGCAGTGAAAAAAGCTATCTCTTTGTTCACAACCATAAATCAGGAGATGGAGATT
AATTCTATTGGCTCTTAGTCACTTGGAACTGATTAATTCTGACTTTCTGTCACTAAGCACTTGGTATTTGGCCATCTCCATTCTGAGCAC
CAAACGGTTAACACGAATGTCCACTAGAACTCTGCTGTGTGTCACCCTTAAATCAGTCTAAATCTTCCAGACAAAAGCAAATGGCATTTA
TGGATTTAAGTCATTAGATTTTCAACTGACATTAATTAATCCCTCTTGATTGATTATATCATCAAGTATTTATATCTTAAATAGGAGGTA
GGATTTCTGTGTTAAGACTCTTATTTGTACCCTATAATTAAAGTAAAATGTTTTTTATGAGTATCCCTTGTTTTCCCTTCTTAAATTGTT
ATCAAACAATTTTTATAATGAAATCTATCTTGGAAAATTAGAAAGAAAAATGGCAAGGTATTTATTGTTCTGTTTGCCATAATTTAGAAC
TCACACTTAAGTATTTTGTAGTTTTACATTCCTTTTTAACCCATTCAGTGGAGAATGTCAGCTTTTCTCCCAAGTTGTATGTTAAGTCTA

>In-frame_LAMB3_ENST00000367030_chr1_209795881_-_NAMPT_ENST00000222553_chr7_105894950_-_6004nt
GCGGGAGGAGGACTGTATCTCTGGATGCCTGGGGCCTGGTTTCAGGGCCTGATTTATTCCTCTTCCTGGGAGCTCACTCAGGAAAGGTCC
TTTCTGGGGATCACCCCATTGGCTGAAGATGAGACCATTCTTCCTCTTGTGTTTTGCCCTGCCTGGCCTCCTGCATGCCCAACAAGCCTG
CTCCCGTGGGGCCTGCTATCCACCTGTTGGGGACCTGCTTGTTGGGAGGACCCGGTTTCTCCGAGCTTCATCTACCTGTGGACTGACCAA
GCCTGAGACCTACTGCACCCAGTATGGCGAGTGGCAGATGAAATGCTGCAAGTGTGACTCCAGGCAGCCTCACAACTACTACAGTCACCG
AGTAGAGAATGTGGCTTCATCCTCCGGCCCCATGCGCTGGTGGCAGTCACAGAATGATGTGAACCCTGTCTCTCTGCAGCTGGACCTGGA
CAGGAGATTCCAGCTTCAAGAAGTCATGATGGAGTTCCAGGGGCCCATGCCCGCCGGCATGCTGATTGAGCGCTCCTCAGACTTCGGTAA
GACCTGGCGAGTGTACCAGTACCTGGCTGCCGACTGCACCTCCACCTTCCCTCGGGTCCGCCAGGGTCGGCCTCAGAGCTGGCAGGATGT
TCGGTGCCAGTCCCTGCCTCAGAGGCCTAATGCACGCCTAAATGGGGGGAAGGTCCAACTTAACCTTATGGATTTAGTGTCTGGGATTCC
AGCAACTCAAAGTCAAAAAATTCAAGAGGTGGGGGAGATCACAAACTTGAGAGTCAATTTCACCAGGCTGGCCCCTGTGCCCCAAAGGGG
CTACCACCCTCCCAGCGCCTACTATGCTGTGTCCCAGCTCCGTCTGCAGGGGAGCTGCTTCTGTCACGGCCATGCTGATCGCTGCGCACC
CAAGCCTGGGGCCTCTGCAGGCCCCTCCACCGCTGTGCAGGTCCACGATGTCTGTGTCTGCCAGCACAACACTGCCGGCCCAAATTGTGA
GCGCTGTGCACCCTTCTACAACAACCGGCCCTGGAGACCGGCGGAGGGCCAGGACGCCCATGAATGCCAAAGGTGCGACTGCAATGGGCA
CTCAGAGACATGTCACTTTGACCCCGCTGTGTTTGCCGCCAGCCAGGGGGCATATGGAGGTGTGTGTGACAATTGCCGGGACCACACCGA
AGGCAAGAACTGTGAGCGGTGTCAGCTGCACTATTTCCGGAACCGGCGCCCGGGAGCTTCCATTCAGGAGACCTGCATCTCCTGCGAGTG
TGATCCGGATGGGGCAGTGCCAGGGGCTCCCTGTGACCCAGTGACCGGGCAGTGTGTGTGCAAGGAGCATGTGCAGGGAGAGCGCTGTGA
CCTATGCAAGCCGGGCTTCACTGGACTCACCTACGCCAACCCGCAGGGCTGCCACCGCTGTGACTGCAACATCCTGGGGTCCCGGAGGGA
CATGCCGTGTGACGAGGAGAGTGGGCGCTGCCTTTGTCTGCCCAACGTGGTGGGTCCCAAATGTGACCAGTGTGCTCCCTACCACTGGAA
GCTGGCCAGTGGCCAGGGCTGTGAACCGTGTGCCTGCGACCCGCACAACTCCCTCAGCCCACAGTGCAACCAGTTCACAGGGCAGTGCCC
CTGTCGGGAAGGCTTTGGTGGCCTGATGTGCAGCGCTGCAGCCATCCGCCAGTGTCCAGACCGGACCTATGGAGACGTGGCCACAGGATG
CCGAGCCTGTGACTGTGATTTCCGGGGAACAGAGGGCCCGGGCTGCGACAAGGCATCAGGCCGCTGCCTCTGCCGCCCTGGCTTGACCGG
GCCCCGCTGTGACCAGTGCCAGCGAGGCTACTGTAATCGCTACCCGGTGTGCGTGGCCTGCCACCCTTGCTTCCAGACCTATGATGCGGA
CCTCCGGGAGCAGGCCCTGCGCTTTGGTAGACTCCGCAATGCCACCGCCAGCCTGTGGTCAGGGCCTGGGCTGGAGGACCGTGGCCTGGC
CTCCCGGATCCTAGATGCAAAGAGTAAGATTGAGCAGATCCGAGCAGTTCTCAGCAGCCCCGCAGTCACAGAGCAGGAGGTGGCTCAGGT
GGCCAGTGCCATCCTCTCCCTCAGGCGAACTCTCCAGGGCCTGCAGCTGGATCTGCCCCTGGAGGAGGAGACGTTGTCCCTTCCGAGAGA
CCTGGAGAGTCTTGACAGAAGCTTCAATGGTCTCCTTACTATGTATCAGAGGAAGAGGGAGCAGTTTGAAAAAATAAGCAGTGCTGATCC
TTCAGGAGCCTTCCGGATGCTGAGCACAGCCTACGAGCAGTCAGCCCAGGCTGCTCAGCAGGTCTCCGACAGCTCGCGCCTTTTGGACCA
GCTCAGGGACAGCCGGAGAGAGGCAGAGAGGCTGGTGCGGCAGGCGGGAGGAGGAGGAGGCACCGGCAGCCCCAAGCTTGTGGCCCTGAG
GCTGGAGATGTCTTCGTTGCCTGACCTGACACCCACCTTCAACAAGCTCTGTGGCAACTCCAGGCAGATGGCTTGCACCCCAATATCATG
CCCTGGTGAGCTATGTCCCCAAGACAATGGCACAGCCTGTGGCTCCCGCTGCAGGGGTGTCCTTCCCAGGGCCGGTGGGGCCTTCTTGAT
GGCGGGGCAGGTGGCTGAGCAGCTGCGGGGCTTCAATGCCCAGCTCCAGCGGACCAGGCAGATGATTAGGGCAGCCGAGGAATCTGCCTC
ACAGATTCAATCCAGTGCCCAGCGCTTGGAGACCCAGGTGAGCGCCAGCCGCTCCCAGATGGAGGAAGATGTCAGACGCACACGGCTCCT
AATCCAGCAGGTCCGGGACTTCCTAACAGATTGTAGAAGGCATGAAACAAAAAATGTGGAGTATTGAAAATATTGCCTTCGGTTCTGGTG
GAGGTTTGCTACAGAAGTTGACAAGAGATCTCTTGAATTGTTCCTTCAAGTGTAGCTATGTTGTAACTAATGGCCTTGGGATTAACGTCT
TCAAGGACCCAGTTGCTGATCCCAACAAAAGGTCCAAAAAGGGCCGATTATCTTTACATAGGACGCCAGCAGGGAATTTTGTTACACTGG
AGGAAGGAAAAGGAGACCTTGAGGAATATGGTCAGGATCTTCTCCATACTGTCTTCAAGAATGGCAAGGTGACAAAAAGCTATTCATTTG
ATGAAATAAGAAAAAATGCACAGCTGAATATTGAACTGGAAGCAGCACATCATTAGGCTTTATGACTGGGTGTGTGTTGTGTGTATGTAA
TACATAATGTTTATTGTACAGATGTGTGGGGTTTGTGTTTTATGATACATTACAGCCAAATTATTTGTTGGTTTATGGACATACTGCCCT
TTCATTTTTTTTCTTTTCCAGTGTTTAGGTGATCTCAAATTAGGAAATGCATTTAACCATGTAAAAGATGAGTGCTAAAGTAAGCTTTTT
AGGGCCCTTTGCCAATAGGTAGTCATTCAATCTGGTATTGATCTTTTCACAAATAACAGAACTGAGAAACTTTTATATATAACTGATGAT
CACATAAAACAGATTTGCATAAAATTACCATGATTGCTTTATGTTTATATTTAACTTGTATTTTTGTACAAACAAGATTGTGTAAGATAT
ATTTGAAGTTTCAGTGATTTAACAGTCTTTCCAACTTTTCATGATTTTTATGAGCACAGACTTTCAAGAAAATACTTGAAAATAAATTAC
ATTGCCTTTTGTCCATTAATCAGCAAATAAAACATGGCCTTAACAAAGTTGTTTGTGTTATTGTACAATTTGAAAATTATGTCGGGACAT
ACCCTATAGAATTACTAACCTTACTGCCCCTTGTAGAATATGTATTAATCATTCTACATTAAAGAAAATAATGGTTCTTACTGGAATGTC
TAGGCACTGTACAGTTATTATATATCTTGGTTGTTGTATTGTACCAGTGAAATGCCAAATTTGAAAGGCCTGTACTGCAATTTTATATGT
CAGAGATTGCCTGTGGCTCTAATATGCACCTCAAGATTTTAAGGAGATAATGTTTTTAGAGAGAATTTCTGCTTCCACTATAGAATATAT
ACATAAATGTAAAATACTTACAAAAGTGGAAGTAGTGTATTTTAAAGTAATTACACTTCTGAATTTATTTTTCATATTCTATAGTTGGTA
TGACTTAAATGAATTACTGGAGTGGGTAGTGAGTGTACTTAAATGTTTCAATTCTGTTATATTTTTTATTAAGTTTTTAAAAAATTAAAT
TGGATATTAAATTGTATGGACATCATTTATTAATTTTAAACTGAATGCCCTCAATAAGTAATACTGAAGCACATTCTTAAATGAAGATAA
ATTATCTCCAATGAAAAGCATGACATGTGTTTCAATAGAAGAATCTTAAGTTGGCTAAATTCAAAGTGCTTGACATCAAAATGTTCTAGA
GTGATTAGCTACTAGATTCTGAATCATACATCACATCTGACTAGAGACCAGTTTCTTTCGAATGATTCTTTTATGTATGTAGATCTGTTC
TTCTGAGGCAGCGGTTGGCCAACTATAGCCCAAAGGCCAAATTTGGACTTCTTTTTATAAATGCAGATTGTCTATGGCTGCTTTCCCACT
ACTCCAGCCTAAGGTAAACAGCTGCAATAGAAGCCAAATGAGAATCGCAAAGCCCAAAATGTTTATTAACCTGCCCTTTACACAAAATTA
CACAAAAAGTTTCCTGATCTCTGTTCTAAGAAAAGGAGTGTGCCTTGCATTTAAAAGGAAATGTTGGTTTCTAGGGAAGGGAGGAGGCTA
AATAATTGATACGGAATTTTCCTCTTTTGTCTTCTTTTTTCTCACTTAAGAATCCGATACTGGAAGACTGATTTAGAAAAGTTTTTAACA
TGACATTAAATGTGAAATTTTAAAAATTGAAAAGCCATAAATCATCTGTTTTAAATAGTTACATGAGAAAATGATCACTAGAATAACCTA
ATTAGAAGTGTTATCTTCATTAAATGTTTTTTGTAAGTGGTATTAGAAAGAATATGTTTTTCAGATGGTTCTTTAAACATGTAGTGAGAA
CAATAAGCATTATTCACTTTTAGTAAGTCTTCTGTAATCCATGATATAAAATAATTTTAAAATGATTTTTTAATGTATTTGAGTAAAGAT
GAGTAGTATTAAGAAAAACACACATTTCTTCACAAAATGTGCTAAGGGGCGTGTAAAGAATCAAAAGAAACTATTACCAATAATAGTTTT
GATAATCACCCATAATTTTGTGTTTAAACATTGAAATTATAGTACAGACAGTATTCTCTGTGTTCTGTGAATTTCAGCAGCTTCAGAATA
GAGTTTAATTTAGAAATTTGCAGTGAAAAAAGCTATCTCTTTGTTCACAACCATAAATCAGGAGATGGAGATTAATTCTATTGGCTCTTA
GTCACTTGGAACTGATTAATTCTGACTTTCTGTCACTAAGCACTTGGTATTTGGCCATCTCCATTCTGAGCACCAAACGGTTAACACGAA
TGTCCACTAGAACTCTGCTGTGTGTCACCCTTAAATCAGTCTAAATCTTCCAGACAAAAGCAAATGGCATTTATGGATTTAAGTCATTAG
ATTTTCAACTGACATTAATTAATCCCTCTTGATTGATTATATCATCAAGTATTTATATCTTAAATAGGAGGTAGGATTTCTGTGTTAAGA
CTCTTATTTGTACCCTATAATTAAAGTAAAATGTTTTTTATGAGTATCCCTTGTTTTCCCTTCTTAAATTGTTATCAAACAATTTTTATA
ATGAAATCTATCTTGGAAAATTAGAAAGAAAAATGGCAAGGTATTTATTGTTCTGTTTGCCATAATTTAGAACTCACACTTAAGTATTTT
GTAGTTTTACATTCCTTTTTAACCCATTCAGTGGAGAATGTCAGCTTTTCTCCCAAGTTGTATGTTAAGTCTATTCTAATATGTACTCAA


Top

FusionGenePPI for LAMB3_NAMPT


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
LAMB3COL7A1, PDIA3, ABCA2, HSPD1, ICT1, MYEF2, LGALS3BP, STX3, TOP1, MED14, BAG2, SNRNP27, U2AF2, ATXN10, TIMMDC1, SFXN3, SLC25A25, TMTC3, LAMA1, CKMT1ANAMPTFANCA, DDA1, GBAS, CUL5, ND1, FTL, IFITM3, ADORA2A, GGT1, CD81, AKT2, ASS1, MVD, ANXA6, GSR, CTSA, NDRG1, PEPD, NXF1, TMEM25, HNRNPA1, FBXW11, HSPB1, HNRNPH1, NAPRT, NTRK1, U2AF2, LGALS7, IL13RA2, MAPK15, C16orf71, AAR2, HSD17B10, SDHA, UBE2A, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for LAMB3_NAMPT


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for LAMB3_NAMPT


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneLAMB3C0268374Adult junctional epidermolysis bullosa (disorder)2CTD_human;ORPHANET;UNIPROT
HgeneLAMB3C0079683Herlitz Disease1ORPHANET;UNIPROT
TgeneNAMPTC0009319Colitis1CTD_human
TgeneNAMPTC0009404Colorectal Neoplasms1CTD_human
TgeneNAMPTC0028754Obesity1CTD_human
TgeneNAMPTC0162820Dermatitis, Allergic Contact1CTD_human