FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19330

FusionGeneSummary for L3MBTL4_TRDMT1

check button Fusion gene summary
Fusion gene informationFusion gene name: L3MBTL4_TRDMT1
Fusion gene ID: 19330
HgeneTgene
Gene symbol

L3MBTL4

TRDMT1

Gene ID

91133

1787

Gene nameL3MBTL4, histone methyl-lysine binding proteintRNA aspartic acid methyltransferase 1
SynonymsHsT1031DMNT2|DNMT2|MHSAIIP|PUMET|RNMT1
Cytomap

18p11.31

10p13

Type of geneprotein-codingprotein-coding
Descriptionlethal(3)malignant brain tumor-like protein 4H-l(3)mbt-like protein 4L3mbt-like 4l(3)mbt-like 4l(3)mbt-like protein 4tRNA (cytosine(38)-C(5))-methyltransferaseDNA (cytosine-5)-methyltransferase-like protein 2DNA MTase homolog HsaIIPDNA cytosine-5 methyltransferase 2DNA methyltransferase-2tRNA (cytosine-5-)-methyltransferase
Modification date2018051920180519
UniProtAcc

Q8NA19

O14717

Ensembl transtripts involved in fusion geneENST00000400105, ENST00000317931, 
ENST00000284898, ENST00000400104, 
ENST00000535782, ENST00000578677, 
ENST00000377799, ENST00000377766, 
ENST00000412821, ENST00000358282, 
ENST00000351358, ENST00000457442, 
ENST00000452380, ENST00000488990, 
Fusion gene scores* DoF score4 X 4 X 4=641 X 1 X 1=1
# samples 41
** MAII scorelog2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: L3MBTL4 [Title/Abstract] AND TRDMT1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTRDMT1

GO:0030488

tRNA methylation

16424344


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBLCATCGA-ZF-AA4T-01AL3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000400105ENST00000377799L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000400105ENST00000377766L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000400105ENST00000412821L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000400105ENST00000358282L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000400105ENST00000351358L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-5UTRENST00000400105ENST00000457442L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-intronENST00000400105ENST00000452380L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-intronENST00000400105ENST00000488990L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000317931ENST00000377799L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000317931ENST00000377766L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000317931ENST00000412821L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000317931ENST00000358282L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000317931ENST00000351358L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-5UTRENST00000317931ENST00000457442L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-intronENST00000317931ENST00000452380L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-intronENST00000317931ENST00000488990L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000284898ENST00000377799L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000284898ENST00000377766L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000284898ENST00000412821L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000284898ENST00000358282L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000284898ENST00000351358L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-5UTRENST00000284898ENST00000457442L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-intronENST00000284898ENST00000452380L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-intronENST00000284898ENST00000488990L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000400104ENST00000377799L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000400104ENST00000377766L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000400104ENST00000412821L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000400104ENST00000358282L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000400104ENST00000351358L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-5UTRENST00000400104ENST00000457442L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-intronENST00000400104ENST00000452380L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-intronENST00000400104ENST00000488990L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
In-frameENST00000535782ENST00000377799L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000535782ENST00000377766L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
In-frameENST00000535782ENST00000412821L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
Frame-shitENST00000535782ENST00000358282L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
In-frameENST00000535782ENST00000351358L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-5UTRENST00000535782ENST00000457442L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-intronENST00000535782ENST00000452380L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
5CDS-intronENST00000535782ENST00000488990L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
intron-3CDSENST00000578677ENST00000377799L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
intron-3CDSENST00000578677ENST00000377766L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
intron-3CDSENST00000578677ENST00000412821L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
intron-3CDSENST00000578677ENST00000358282L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
intron-3CDSENST00000578677ENST00000351358L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
intron-5UTRENST00000578677ENST00000457442L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
intron-intronENST00000578677ENST00000452380L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-
intron-intronENST00000578677ENST00000488990L3MBTL4chr18

6237963

-TRDMT1chr10

17216659

-

Top

FusionProtFeatures for L3MBTL4_TRDMT1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
L3MBTL4

Q8NA19

TRDMT1

O14717

Putative Polycomb group (PcG) protein. PcG proteinsmaintain the transcriptionally repressive state of genes, probablyvia a modification of chromatin, rendering it heritably changed inits expressibility (By similarity). {ECO:0000250}. Specifically methylates cytosine 38 in the anticodonloop of tRNA(Asp). {ECO:0000269|PubMed:16424344}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for L3MBTL4_TRDMT1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_L3MBTL4_ENST00000535782_chr18_6237963_-_TRDMT1_ENST00000377799_chr10_17216659_-_445aa
MSKEFQVGMKLEAVDRKNPSLVCVATIADIVEDRLLVHFDNWDDSYDYWCDVNSPTVQPVGWCQENGRTLIAPQESCIPAQVVAAIDVNT
VANEVYKTNFPHTQLLAKTIEGITLEEFDRLSFDMILMSPPCQPFTRIGRQGDMTDSRTNSFLHILDILPRLQKLPKTILLENVKGFEVS
STRDLLIQTIENCGFQYQEFLLSPTSLGIPNSRLRTFLIAKLQSEPLPFQAPGQVLMEFPKIESVHPQKTAMDVENKIQEKNVEPNISFD
GSIQCSGKDAILFKLETAEEIHRKNQQDSDLSVKMLKDFLEDDTDVNQTLLPPKSLLRTALLLDIVQPTCRRSVCFTKGTGSYIEGTGSV

>In-frame_L3MBTL4_ENST00000535782_chr18_6237963_-_TRDMT1_ENST00000412821_chr10_17216659_-_421aa
MSKEFQVGMKLEAVDRKNPSLVCVATIADIVEDRLLVHFDNWDDSYDYWCDVNSPTVQPVGWCQENGRTLIAPQESCIPAQVVAAIDVNT
VANEVYKTNFPHTQLLAKTIEGITLEEFDRLSFDMILMSPPCQPFTRLQKLPKTILLENVKGFEVSSTRDLLIQTIENCGFQYQEFLLSP
TSLGIPNSRLRTFLIAKLQSEPLPFQAPGQVLMEFPKIESVHPQKTAMDVENKIQEKNVEPNISFDGSIQCSGKDAILFKLETAEEIHRK
NQQDSDLSVKMLKDFLEDDTDVNQTLLPPKSLLRTALLLDIVQPTCRRSVCFTKGTGSYIEGTGSVLQTAEDVQVENIYKSLTNLSQEEQ

>In-frame_L3MBTL4_ENST00000535782_chr18_6237963_-_TRDMT1_ENST00000351358_chr10_17216659_-_399aa
MSKEFQVGMKLEAVDRKNPSLVCVATIADIVEDRLLVHFDNWDDSYDYWCDVNSPTVQPVGWCQENGRTLIAPQESCIPAQVVAAIDVNT
VANEVYKTNFPHTQLLAKTIEGITLEEFDRLSFDMILMSPPCQPFTRDLLIQTIENCGFQYQEFLLSPTSLGIPNSRLRTFLIAKLQSEP
LPFQAPGQVLMEFPKIESVHPQKTAMDVENKIQEKNVEPNISFDGSIQCSGKDAILFKLETAEEIHRKNQQDSDLSVKMLKDFLEDDTDV
NQTLLPPKSLLRTALLLDIVQPTCRRSVCFTKGTGSYIEGTGSVLQTAEDVQVENIYKSLTNLSQEEQITKLLILKLRTFTPKEIANLLG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_L3MBTL4_ENST00000535782_chr18_6237963_-_TRDMT1_ENST00000377799_chr10_17216659_-_1335nt
ATGTCTAAAGAATTTCAGGTTGGAATGAAGCTGGAGGCCGTGGACAGGAAGAACCCTTCCTTGGTGTGTGTGGCGACCATAGCAGATATT
GTTGAAGATCGCTTACTAGTGCATTTTGACAACTGGGATGATAGTTACGATTACTGGTGCGATGTTAATAGCCCTTATGTCCAGCCAGTT
GGTTGGTGTCAGGAGAATGGAAGAACTCTGATAGCACCCCAAGAAAGCTGTATACCTGCACAAGTGGTGGCTGCCATTGATGTCAACACT
GTCGCTAATGAAGTATACAAGTATAATTTTCCTCACACACAGTTACTTGCCAAGACGATTGAAGGCATTACACTCGAAGAGTTTGACAGA
TTATCTTTTGATATGATTTTAATGAGCCCTCCCTGCCAGCCATTCACAAGGATTGGCCGGCAGGGTGATATGACTGATTCAAGGACGAAT
AGCTTCTTACATATTCTAGATATTCTCCCAAGATTACAAAAATTACCAAAGTATATTCTTTTGGAAAATGTTAAAGGTTTTGAAGTATCT
TCTACAAGAGACCTCTTGATACAAACAATAGAAAATTGTGGCTTTCAGTACCAAGAGTTTCTATTATCTCCAACCTCTCTTGGCATTCCA
AATTCAAGGCTACGATATTTTCTTATTGCAAAGCTTCAGTCAGAGCCATTACCCTTTCAAGCCCCTGGTCAGGTACTGATGGAGTTCCCC
AAAATTGAATCTGTACATCCACAAAAATATGCAATGGATGTAGAAAATAAAATTCAAGAAAAGAACGTTGAACCAAATATTAGCTTTGAT
GGCAGCATACAGTGTTCTGGAAAAGATGCCATTCTTTTTAAGCTTGAAACTGCAGAAGAAATTCACAGGAAAAATCAACAAGATAGTGAT
CTCTCTGTGAAAATGCTAAAAGATTTTCTTGAAGATGACACTGACGTGAACCAGTATCTTTTACCACCAAAGTCATTGCTGCGATATGCT
CTTCTGTTAGACATTGTTCAGCCCACTTGTAGAAGGTCCGTGTGCTTTACCAAAGGATATGGAAGCTACATAGAAGGGACAGGGTCTGTG
TTACAGACTGCAGAGGATGTGCAGGTTGAGAATATCTACAAATCCCTTACCAATTTGTCACAAGAAGAACAGATAACAAAGCTGTTAATA
CTTAAACTGCGATATTTCACTCCTAAAGAAATAGCAAATCTCCTTGGATTTCCTCCAGAGTTCGGATTTCCTGAGAAGATAACAGTGAAA

>In-frame_L3MBTL4_ENST00000535782_chr18_6237963_-_TRDMT1_ENST00000412821_chr10_17216659_-_1263nt
ATGTCTAAAGAATTTCAGGTTGGAATGAAGCTGGAGGCCGTGGACAGGAAGAACCCTTCCTTGGTGTGTGTGGCGACCATAGCAGATATT
GTTGAAGATCGCTTACTAGTGCATTTTGACAACTGGGATGATAGTTACGATTACTGGTGCGATGTTAATAGCCCTTATGTCCAGCCAGTT
GGTTGGTGTCAGGAGAATGGAAGAACTCTGATAGCACCCCAAGAAAGCTGTATACCTGCACAAGTGGTGGCTGCCATTGATGTCAACACT
GTCGCTAATGAAGTATACAAGTATAATTTTCCTCACACACAGTTACTTGCCAAGACGATTGAAGGCATTACACTCGAAGAGTTTGACAGA
TTATCTTTTGATATGATTTTAATGAGCCCTCCCTGCCAGCCATTCACAAGATTACAAAAATTACCAAAGTATATTCTTTTGGAAAATGTT
AAAGGTTTTGAAGTATCTTCTACAAGAGACCTCTTGATACAAACAATAGAAAATTGTGGCTTTCAGTACCAAGAGTTTCTATTATCTCCA
ACCTCTCTTGGCATTCCAAATTCAAGGCTACGATATTTTCTTATTGCAAAGCTTCAGTCAGAGCCATTACCCTTTCAAGCCCCTGGTCAG
GTACTGATGGAGTTCCCCAAAATTGAATCTGTACATCCACAAAAATATGCAATGGATGTAGAAAATAAAATTCAAGAAAAGAACGTTGAA
CCAAATATTAGCTTTGATGGCAGCATACAGTGTTCTGGAAAAGATGCCATTCTTTTTAAGCTTGAAACTGCAGAAGAAATTCACAGGAAA
AATCAACAAGATAGTGATCTCTCTGTGAAAATGCTAAAAGATTTTCTTGAAGATGACACTGACGTGAACCAGTATCTTTTACCACCAAAG
TCATTGCTGCGATATGCTCTTCTGTTAGACATTGTTCAGCCCACTTGTAGAAGGTCCGTGTGCTTTACCAAAGGATATGGAAGCTACATA
GAAGGGACAGGGTCTGTGTTACAGACTGCAGAGGATGTGCAGGTTGAGAATATCTACAAATCCCTTACCAATTTGTCACAAGAAGAACAG
ATAACAAAGCTGTTAATACTTAAACTGCGATATTTCACTCCTAAAGAAATAGCAAATCTCCTTGGATTTCCTCCAGAGTTCGGATTTCCT
GAGAAGATAACAGTGAAACAGCGTTATCGCCTACTTGGAAATAGTCTCAACGTGCATGTAGTAGCTAAACTAATCAAAATCTTATATGAA

>In-frame_L3MBTL4_ENST00000535782_chr18_6237963_-_TRDMT1_ENST00000351358_chr10_17216659_-_1197nt
ATGTCTAAAGAATTTCAGGTTGGAATGAAGCTGGAGGCCGTGGACAGGAAGAACCCTTCCTTGGTGTGTGTGGCGACCATAGCAGATATT
GTTGAAGATCGCTTACTAGTGCATTTTGACAACTGGGATGATAGTTACGATTACTGGTGCGATGTTAATAGCCCTTATGTCCAGCCAGTT
GGTTGGTGTCAGGAGAATGGAAGAACTCTGATAGCACCCCAAGAAAGCTGTATACCTGCACAAGTGGTGGCTGCCATTGATGTCAACACT
GTCGCTAATGAAGTATACAAGTATAATTTTCCTCACACACAGTTACTTGCCAAGACGATTGAAGGCATTACACTCGAAGAGTTTGACAGA
TTATCTTTTGATATGATTTTAATGAGCCCTCCCTGCCAGCCATTCACAAGAGACCTCTTGATACAAACAATAGAAAATTGTGGCTTTCAG
TACCAAGAGTTTCTATTATCTCCAACCTCTCTTGGCATTCCAAATTCAAGGCTACGATATTTTCTTATTGCAAAGCTTCAGTCAGAGCCA
TTACCCTTTCAAGCCCCTGGTCAGGTACTGATGGAGTTCCCCAAAATTGAATCTGTACATCCACAAAAATATGCAATGGATGTAGAAAAT
AAAATTCAAGAAAAGAACGTTGAACCAAATATTAGCTTTGATGGCAGCATACAGTGTTCTGGAAAAGATGCCATTCTTTTTAAGCTTGAA
ACTGCAGAAGAAATTCACAGGAAAAATCAACAAGATAGTGATCTCTCTGTGAAAATGCTAAAAGATTTTCTTGAAGATGACACTGACGTG
AACCAGTATCTTTTACCACCAAAGTCATTGCTGCGATATGCTCTTCTGTTAGACATTGTTCAGCCCACTTGTAGAAGGTCCGTGTGCTTT
ACCAAAGGATATGGAAGCTACATAGAAGGGACAGGGTCTGTGTTACAGACTGCAGAGGATGTGCAGGTTGAGAATATCTACAAATCCCTT
ACCAATTTGTCACAAGAAGAACAGATAACAAAGCTGTTAATACTTAAACTGCGATATTTCACTCCTAAAGAAATAGCAAATCTCCTTGGA
TTTCCTCCAGAGTTCGGATTTCCTGAGAAGATAACAGTGAAACAGCGTTATCGCCTACTTGGAAATAGTCTCAACGTGCATGTAGTAGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_L3MBTL4_ENST00000535782_chr18_6237963_-_TRDMT1_ENST00000377799_chr10_17216659_-_3689nt
TTGCAAAATGCTCCAAAGAAATTATTCAGAAACAGAAGTCCTAATGGGCCAATGTCTAAAGAATTTCAGGTTGGAATGAAGCTGGAGGCC
GTGGACAGGAAGAACCCTTCCTTGGTGTGTGTGGCGACCATAGCAGATATTGTTGAAGATCGCTTACTAGTGCATTTTGACAACTGGGAT
GATAGTTACGATTACTGGTGCGATGTTAATAGCCCTTATGTCCAGCCAGTTGGTTGGTGTCAGGAGAATGGAAGAACTCTGATAGCACCC
CAAGAAAGCTGTATACCTGCACAAGTGGTGGCTGCCATTGATGTCAACACTGTCGCTAATGAAGTATACAAGTATAATTTTCCTCACACA
CAGTTACTTGCCAAGACGATTGAAGGCATTACACTCGAAGAGTTTGACAGATTATCTTTTGATATGATTTTAATGAGCCCTCCCTGCCAG
CCATTCACAAGGATTGGCCGGCAGGGTGATATGACTGATTCAAGGACGAATAGCTTCTTACATATTCTAGATATTCTCCCAAGATTACAA
AAATTACCAAAGTATATTCTTTTGGAAAATGTTAAAGGTTTTGAAGTATCTTCTACAAGAGACCTCTTGATACAAACAATAGAAAATTGT
GGCTTTCAGTACCAAGAGTTTCTATTATCTCCAACCTCTCTTGGCATTCCAAATTCAAGGCTACGATATTTTCTTATTGCAAAGCTTCAG
TCAGAGCCATTACCCTTTCAAGCCCCTGGTCAGGTACTGATGGAGTTCCCCAAAATTGAATCTGTACATCCACAAAAATATGCAATGGAT
GTAGAAAATAAAATTCAAGAAAAGAACGTTGAACCAAATATTAGCTTTGATGGCAGCATACAGTGTTCTGGAAAAGATGCCATTCTTTTT
AAGCTTGAAACTGCAGAAGAAATTCACAGGAAAAATCAACAAGATAGTGATCTCTCTGTGAAAATGCTAAAAGATTTTCTTGAAGATGAC
ACTGACGTGAACCAGTATCTTTTACCACCAAAGTCATTGCTGCGATATGCTCTTCTGTTAGACATTGTTCAGCCCACTTGTAGAAGGTCC
GTGTGCTTTACCAAAGGATATGGAAGCTACATAGAAGGGACAGGGTCTGTGTTACAGACTGCAGAGGATGTGCAGGTTGAGAATATCTAC
AAATCCCTTACCAATTTGTCACAAGAAGAACAGATAACAAAGCTGTTAATACTTAAACTGCGATATTTCACTCCTAAAGAAATAGCAAAT
CTCCTTGGATTTCCTCCAGAGTTCGGATTTCCTGAGAAGATAACAGTGAAACAGCGTTATCGCCTACTTGGAAATAGTCTCAACGTGCAT
GTAGTAGCTAAACTAATCAAAATCTTATATGAATAATTTTGAAATAACTCTGAAAGATGGTCATATGATATTCCTTCATTTTCAGAGAGT
AATTCTGAAATTCTGTTTTGAACTAATTCTGGTGAAATTTAACTAAATTATTTTAATCTGTCCTTATTAAGAAATTTGGATTTTATTAAA
AAAATCCATGTGTTTCATCAAATTTATATTACTGTATTTTATAAAATACGAACTATTGTTATGCTTTATGGAGAGTATATTTTCATATGA
AACTGATAAATATATATGTGGAATATTCTTTTTAAAAACAATTTTATAAACAAATCAAGGAGCACTAGAGCTTTAGTGTCTACATGAGTA
TCTTGTGAAGTGTCATAACAGGCATAACATATTTTTATGTTAATTAAAGAAGTTTTTTATTTCTAATTTTAAAATAATGATTCTAATTCT
AGCCCATTGAATGTTTTACTTAATTTCCAATCCTGTAAATATTTCTTTATTTCATCTAAACAAATGCATATGATATGTAAACCAAATTAT
CATCATTCAGTTTATACAGCAGACTGAAGAATATGTCAGGAAAAATAATCCTAAATGTTTGATTACCTCTCCATGAAGCGGCCACAGAAA
CTGTTGGTGCACATTATCTACATTTTCCTCAGCCTCTATCTGAAGGACAAAACTCATTTTTCCTTCTTCATTTTGTATGTACTTTCCTTT
AGTTGACTATTATCAAAGCTTGTTTTTGTCTTCTCAGCTTCTGAGTTGAATTTGCCTTTGCACGCTGAGGAATGTAGCATGACGTTAAGA
TTTCAGGGAGGAAGCTGCCCTCTGATCCCATGTCATATGACAGTACTCCCCTCCCCCCAGTTGTTCTTTATTGTAGCAACATACACTCTC
AATGAACTTTTATGACTTTTAACTTTCTCTGTCTCTCTTCCTCAGCAGACCTCTTGGAATTAGGGTTTCTAATCAAACTAAGTCTTGCAT
CATAAATTCTATGGTTTGTGATAAAAGCAAGTGACAAAGAGAAGAGAGATGAAAAGAAACAAGTCCAGAAATCATATTACAAGATTTTAA
TTCAAATTTTTCTTCTTAAAAATCAGCTATTTAGAGGTGGATAAATTGGAAGTTTGTGCATTGCTTGTGGGAACGTAAAATGGTTCAGCT
GCTGTTGGAAAACGCTATGGAGGTTCGTCACAAAATTCAACATAGAATTACCCTATGATTCAGCGATTCCACCTCTGGCTATAGATCCAA
AAGAATTGAAAGCAGGGACTTGAACAGATATTTGTACACCAGCGTTTATAACACCATTATTTACAGTAGCCAAAAGGTAGAAGCAGCCCA
AGTGTCATCCCATTCACCCATGAATGGATGCAGGAATTGTGTTCCGTGCATGCAGTGGAATAGTACCAGCCTTCCGCAGGAAGGAAATTC
TGACATATGCGGTGACATGGATGAACCTTGAGTACATTATGCGAAGTGAAATAAGCCACCCTGTGGGGATGGAGAATGGGTAGTTAGTGC
ATAATGGATACAAAGTTTCTGATTGGGGTGATGAGAAAGTTCTGGAGGTGGATGGGGAGGATGGTTGCACAACAGTGTGAGTGTACTTAA
TGCCACTGCAACTGTATATTTAAAAATAGTTAAAATGATAAATTTTACATTATGTATATTTTACTGCAATTGAAAAAATCATACTCTATT
ACCAATTTTTCAGAACTCATAGATAAATATGAATGTAGGGAAGCTGTAAGCCAGCCCATATACAGAAACTATCACTATCTACATTTTTCA
TATGTGTTCAGACAGAGCCTATTACAAGTCTCATAAATTTCAGTAAACAATCACAAATTATTTTGGCACACTTTCATGTAGGTTCTGTTC
ACTGCTGAAATATTCTAAATAAAATGGTTTAGAGTTTTACTGTAACTATGAATAATTATGCTATAATTATAGTATCCCACATTCGGTTGA
GCAACATTATACAAAATAAGTGTCGAGTTACTGTGCACCAACTATAAATACTTGAAAGGTCTGTAGAGACATTTGCTTACAAACTGGTAG
ACAGAATGTAGCTTAGTGGAATTCTTAAATTATGGGAATGTATTCACAGGAAGACGGTGATTCTTGCCCTTAATTCATAATTGAAAATAT
GCAGTAACAAGCATAAAACTCACATCTTAATGAAGATGTATCTACCAGTGTCATTCAATTAGCAGATGTATATGTATGCATAATTAATTT

>In-frame_L3MBTL4_ENST00000535782_chr18_6237963_-_TRDMT1_ENST00000412821_chr10_17216659_-_1477nt
TTGCAAAATGCTCCAAAGAAATTATTCAGAAACAGAAGTCCTAATGGGCCAATGTCTAAAGAATTTCAGGTTGGAATGAAGCTGGAGGCC
GTGGACAGGAAGAACCCTTCCTTGGTGTGTGTGGCGACCATAGCAGATATTGTTGAAGATCGCTTACTAGTGCATTTTGACAACTGGGAT
GATAGTTACGATTACTGGTGCGATGTTAATAGCCCTTATGTCCAGCCAGTTGGTTGGTGTCAGGAGAATGGAAGAACTCTGATAGCACCC
CAAGAAAGCTGTATACCTGCACAAGTGGTGGCTGCCATTGATGTCAACACTGTCGCTAATGAAGTATACAAGTATAATTTTCCTCACACA
CAGTTACTTGCCAAGACGATTGAAGGCATTACACTCGAAGAGTTTGACAGATTATCTTTTGATATGATTTTAATGAGCCCTCCCTGCCAG
CCATTCACAAGATTACAAAAATTACCAAAGTATATTCTTTTGGAAAATGTTAAAGGTTTTGAAGTATCTTCTACAAGAGACCTCTTGATA
CAAACAATAGAAAATTGTGGCTTTCAGTACCAAGAGTTTCTATTATCTCCAACCTCTCTTGGCATTCCAAATTCAAGGCTACGATATTTT
CTTATTGCAAAGCTTCAGTCAGAGCCATTACCCTTTCAAGCCCCTGGTCAGGTACTGATGGAGTTCCCCAAAATTGAATCTGTACATCCA
CAAAAATATGCAATGGATGTAGAAAATAAAATTCAAGAAAAGAACGTTGAACCAAATATTAGCTTTGATGGCAGCATACAGTGTTCTGGA
AAAGATGCCATTCTTTTTAAGCTTGAAACTGCAGAAGAAATTCACAGGAAAAATCAACAAGATAGTGATCTCTCTGTGAAAATGCTAAAA
GATTTTCTTGAAGATGACACTGACGTGAACCAGTATCTTTTACCACCAAAGTCATTGCTGCGATATGCTCTTCTGTTAGACATTGTTCAG
CCCACTTGTAGAAGGTCCGTGTGCTTTACCAAAGGATATGGAAGCTACATAGAAGGGACAGGGTCTGTGTTACAGACTGCAGAGGATGTG
CAGGTTGAGAATATCTACAAATCCCTTACCAATTTGTCACAAGAAGAACAGATAACAAAGCTGTTAATACTTAAACTGCGATATTTCACT
CCTAAAGAAATAGCAAATCTCCTTGGATTTCCTCCAGAGTTCGGATTTCCTGAGAAGATAACAGTGAAACAGCGTTATCGCCTACTTGGA
AATAGTCTCAACGTGCATGTAGTAGCTAAACTAATCAAAATCTTATATGAATAATTTTGAAATAACTCTGAAAGATGGTCATATGATATT
CCTTCATTTTCAGAGAGTAATTCTGAAATTCTGTTTTGAACTAATTCTGGTGAAATTTAACTAAATTATTTTAATCTGTCCTTATTAAGA

>In-frame_L3MBTL4_ENST00000535782_chr18_6237963_-_TRDMT1_ENST00000351358_chr10_17216659_-_1411nt
TTGCAAAATGCTCCAAAGAAATTATTCAGAAACAGAAGTCCTAATGGGCCAATGTCTAAAGAATTTCAGGTTGGAATGAAGCTGGAGGCC
GTGGACAGGAAGAACCCTTCCTTGGTGTGTGTGGCGACCATAGCAGATATTGTTGAAGATCGCTTACTAGTGCATTTTGACAACTGGGAT
GATAGTTACGATTACTGGTGCGATGTTAATAGCCCTTATGTCCAGCCAGTTGGTTGGTGTCAGGAGAATGGAAGAACTCTGATAGCACCC
CAAGAAAGCTGTATACCTGCACAAGTGGTGGCTGCCATTGATGTCAACACTGTCGCTAATGAAGTATACAAGTATAATTTTCCTCACACA
CAGTTACTTGCCAAGACGATTGAAGGCATTACACTCGAAGAGTTTGACAGATTATCTTTTGATATGATTTTAATGAGCCCTCCCTGCCAG
CCATTCACAAGAGACCTCTTGATACAAACAATAGAAAATTGTGGCTTTCAGTACCAAGAGTTTCTATTATCTCCAACCTCTCTTGGCATT
CCAAATTCAAGGCTACGATATTTTCTTATTGCAAAGCTTCAGTCAGAGCCATTACCCTTTCAAGCCCCTGGTCAGGTACTGATGGAGTTC
CCCAAAATTGAATCTGTACATCCACAAAAATATGCAATGGATGTAGAAAATAAAATTCAAGAAAAGAACGTTGAACCAAATATTAGCTTT
GATGGCAGCATACAGTGTTCTGGAAAAGATGCCATTCTTTTTAAGCTTGAAACTGCAGAAGAAATTCACAGGAAAAATCAACAAGATAGT
GATCTCTCTGTGAAAATGCTAAAAGATTTTCTTGAAGATGACACTGACGTGAACCAGTATCTTTTACCACCAAAGTCATTGCTGCGATAT
GCTCTTCTGTTAGACATTGTTCAGCCCACTTGTAGAAGGTCCGTGTGCTTTACCAAAGGATATGGAAGCTACATAGAAGGGACAGGGTCT
GTGTTACAGACTGCAGAGGATGTGCAGGTTGAGAATATCTACAAATCCCTTACCAATTTGTCACAAGAAGAACAGATAACAAAGCTGTTA
ATACTTAAACTGCGATATTTCACTCCTAAAGAAATAGCAAATCTCCTTGGATTTCCTCCAGAGTTCGGATTTCCTGAGAAGATAACAGTG
AAACAGCGTTATCGCCTACTTGGAAATAGTCTCAACGTGCATGTAGTAGCTAAACTAATCAAAATCTTATATGAATAATTTTGAAATAAC
TCTGAAAGATGGTCATATGATATTCCTTCATTTTCAGAGAGTAATTCTGAAATTCTGTTTTGAACTAATTCTGGTGAAATTTAACTAAAT


Top

FusionGenePPI for L3MBTL4_TRDMT1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
L3MBTL4APP, NINLTRDMT1DDX24, COPS6, RBM48, UTP14A, STX1A, EEF1A1, LRIF1, SETDB1, UNC119, APP, GBE1, NFRKB, SNRPD3, TBC1D2B


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for L3MBTL4_TRDMT1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneTRDMT1O14717DB00738PentamidinetRNA (cytosine(38)-C(5))-methyltransferasesmall moleculeapproved|investigational
TgeneTRDMT1O14717DB09462GlycerintRNA (cytosine(38)-C(5))-methyltransferasesmall moleculeapproved|investigational

Top

RelatedDiseases for L3MBTL4_TRDMT1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource