FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 19116

FusionGeneSummary for KMT2C_AUTS2

check button Fusion gene summary
Fusion gene informationFusion gene name: KMT2C_AUTS2
Fusion gene ID: 19116
HgeneTgene
Gene symbol

KMT2C

AUTS2

Gene ID

58508

26053

Gene namelysine methyltransferase 2CAUTS2, activator of transcription and developmental regulator
SynonymsHALR|KLEFS2|MLL3FBRSL2|MRD26
Cytomap

7q36.1

7q11.22

Type of geneprotein-codingprotein-coding
Descriptionhistone-lysine N-methyltransferase 2CALR-like proteinhistone-lysine N-methyltransferase MLL3histone-lysine N-methyltransferase, H3 lysine-4 specifichomologous to ALR proteinlysine (K)-specific methyltransferase 2Cmyeloid/lymphoid or mixed-lineage leautism susceptibility gene 2 proteinautism susceptibility candidate 2autism-related protein 1
Modification date2018052320180519
UniProtAcc

Q8NEZ4

Q8WXX7

Ensembl transtripts involved in fusion geneENST00000262189, ENST00000355193, 
ENST00000485655, ENST00000485241, 
ENST00000406775, ENST00000342771, 
ENST00000403018, ENST00000489774, 
Fusion gene scores* DoF score18 X 16 X 10=288018 X 16 X 6=1728
# samples 2220
** MAII scorelog2(22/2880*10)=-3.71049338280502
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(20/1728*10)=-3.11103131238874
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KMT2C [Title/Abstract] AND AUTS2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneAUTS2

GO:0045944

positive regulation of transcription by RNA polymerase II

25519132

TgeneAUTS2

GO:0051571

positive regulation of histone H3-K4 methylation

25519132

TgeneAUTS2

GO:2000620

positive regulation of histone H4-K16 acetylation

25519132


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A8-A07C-01AKMT2Cchr7

152132711

-AUTS2chr7

69900738

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000262189ENST00000406775KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
In-frameENST00000262189ENST00000342771KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
5CDS-intronENST00000262189ENST00000403018KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
5CDS-intronENST00000262189ENST00000489774KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
In-frameENST00000355193ENST00000406775KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
In-frameENST00000355193ENST00000342771KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
5CDS-intronENST00000355193ENST00000403018KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
5CDS-intronENST00000355193ENST00000489774KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
intron-3CDSENST00000485655ENST00000406775KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
intron-3CDSENST00000485655ENST00000342771KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
intron-intronENST00000485655ENST00000403018KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
intron-intronENST00000485655ENST00000489774KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
intron-3CDSENST00000485241ENST00000406775KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
intron-3CDSENST00000485241ENST00000342771KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
intron-intronENST00000485241ENST00000403018KMT2Cchr7

152132711

-AUTS2chr7

69900738

+
intron-intronENST00000485241ENST00000489774KMT2Cchr7

152132711

-AUTS2chr7

69900738

+

Top

FusionProtFeatures for KMT2C_AUTS2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KMT2C

Q8NEZ4

AUTS2

Q8WXX7

Histone methyltransferase. Methylates 'Lys-4' of histoneH3. H3 'Lys-4' methylation represents a specific tag forepigenetic transcriptional activation. Central component of theMLL2/3 complex, a coactivator complex of nuclear receptors,involved in transcriptional coactivation. KMT2C/MLL3 may be acatalytic subunit of this complex. May be involved inleukemogenesis and developmental disorder.{ECO:0000269|PubMed:17500065}. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain thetranscriptionally repressive state of many genes, including Hoxgenes, throughout development. PcG PRC1 complex acts via chromatinremodeling and modification of histones; it mediatesmonoubiquitination of histone H2A 'Lys-119', rendering chromatinheritably changed in its expressibility (PubMed:25519132). ThePRC1-like complex that contains PCGF5, RNF2, CSNK2B, RYBP andAUTS2 has decreased histone H2A ubiquitination activity, due tothe phosphorylation of RNF2 by CSNK2B (PubMed:25519132). As aconsequence, the complex mediates transcriptional activation(PubMed:25519132). In the cytoplasm, plays a role in axon anddendrite elongation and in neuronal migration during embryonicbrain development. Promotes reorganization of the actincytoskeleton, lamellipodia formation and neurite elongation viaits interaction with RAC guanine nucleotide exchange factors,which then leads to the activation of RAC1 (By similarity).{ECO:0000250|UniProtKB:A0A087WPF7, ECO:0000269|PubMed:25519132}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-15934_46534912DNA bindingNote=A.T hook
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-16034_46534969DNA bindingNote=A.T hook
TgeneAUTS2chr7:152132711chr7:69900738ENST00000342771+3191122_11812201260Compositional biasHis-rich
TgeneAUTS2chr7:152132711chr7:69900738ENST00000342771+319288_4712201260Compositional biasPro-rich
TgeneAUTS2chr7:152132711chr7:69900738ENST00000342771+319525_5482201260Compositional biasHis-rich
TgeneAUTS2chr7:152132711chr7:69900738ENST00000342771+319545_6462201260Compositional biasPro-rich
TgeneAUTS2chr7:152132711chr7:69900738ENST00000403018+051122_1181-15267Compositional biasHis-rich
TgeneAUTS2chr7:152132711chr7:69900738ENST00000403018+05288_471-15267Compositional biasPro-rich
TgeneAUTS2chr7:152132711chr7:69900738ENST00000403018+05525_548-15267Compositional biasHis-rich
TgeneAUTS2chr7:152132711chr7:69900738ENST00000403018+05545_646-15267Compositional biasPro-rich
TgeneAUTS2chr7:152132711chr7:69900738ENST00000406775+3181122_11812201236Compositional biasHis-rich
TgeneAUTS2chr7:152132711chr7:69900738ENST00000406775+318288_4712201236Compositional biasPro-rich
TgeneAUTS2chr7:152132711chr7:69900738ENST00000406775+318525_5482201236Compositional biasHis-rich
TgeneAUTS2chr7:152132711chr7:69900738ENST00000406775+318545_6462201236Compositional biasPro-rich
TgeneAUTS2chr7:152132711chr7:69900738ENST00000342771+319289_4722201260RegionImportant for regulation of lamellipodia formation
TgeneAUTS2chr7:152132711chr7:69900738ENST00000403018+05289_472-15267RegionImportant for regulation of lamellipodia formation
TgeneAUTS2chr7:152132711chr7:69900738ENST00000406775+318289_4722201236RegionImportant for regulation of lamellipodia formation

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1591338_1366534912Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1591754_1787534912Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1593054_3081534912Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1593173_3272534912Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1593391_3433534912Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-159644_672534912Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-15992_112534912Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1601338_1366534969Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1601754_1787534969Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1603054_3081534969Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1603173_3272534969Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1603391_3433534969Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-160644_672534969Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-16092_112534969Coiled coilOntology_term=ECO:0000255
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1591719_1796534912Compositional biasNote=Gln-rich
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1591834_2281534912Compositional biasNote=Pro-rich
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1592412_2630534912Compositional biasNote=Pro-rich
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1592690_2786534912Compositional biasNote=Asp-rich
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1593012_3509534912Compositional biasNote=Gln-rich
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1593277_3381534912Compositional biasNote=Pro-rich
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1601719_1796534969Compositional biasNote=Gln-rich
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1601834_2281534969Compositional biasNote=Pro-rich
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1602412_2630534969Compositional biasNote=Pro-rich
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1602690_2786534969Compositional biasNote=Asp-rich
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1603012_3509534969Compositional biasNote=Gln-rich
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1603277_3381534969Compositional biasNote=Pro-rich
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-159436_489534912DomainDHHC
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1594545_4605534912DomainFYR N-terminal
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1594606_4691534912DomainFYR C-terminal
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1594771_4887534912DomainSET
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1594895_4911534912DomainPost-SET
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-160436_489534969DomainDHHC
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1604545_4605534969DomainFYR N-terminal
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1604606_4691534969DomainFYR C-terminal
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1604771_4887534969DomainSET
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1604895_4911534969DomainPost-SET
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1594848_4849534912RegionS-adenosyl-L-methionine binding
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1604848_4849534969RegionS-adenosyl-L-methionine binding
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1591007_1057534912Zinc fingerPHD-type 6
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1591084_1139534912Zinc fingerPHD-type 7
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-159227_262534912Zinc fingerC2HC pre-PHD-type 1%3B degenerate
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-159283_331534912Zinc fingerPHD-type 1
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-159341_391534912Zinc fingerPHD-type 2
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-159344_389534912Zinc fingerRING-type
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-159388_438534912Zinc fingerPHD-type 3
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1594399_4439534912Zinc fingerC2HC pre-PHD-type 2
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-1594460_4507534912Zinc fingerPHD-type 8
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-159464_520534912Zinc fingerPHD-type 4
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000262189-159957_1010534912Zinc fingerPHD-type 5
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1601007_1057534969Zinc fingerPHD-type 6
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1601084_1139534969Zinc fingerPHD-type 7
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-160227_262534969Zinc fingerC2HC pre-PHD-type 1%3B degenerate
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-160283_331534969Zinc fingerPHD-type 1
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-160341_391534969Zinc fingerPHD-type 2
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-160344_389534969Zinc fingerRING-type
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-160388_438534969Zinc fingerPHD-type 3
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1604399_4439534969Zinc fingerC2HC pre-PHD-type 2
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-1604460_4507534969Zinc fingerPHD-type 8
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-160464_520534969Zinc fingerPHD-type 4
HgeneKMT2Cchr7:152132711chr7:69900738ENST00000355193-160957_1010534969Zinc fingerPHD-type 5


Top

FusionGeneSequence for KMT2C_AUTS2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KMT2C_ENST00000262189_chr7_152132711_-_AUTS2_ENST00000406775_chr7_69900738_+_1069aa
MSSEEDKSVEQPQPPPPPPEEPGAPAPSPAAADKRPRGRPRKDGASPFQRARKNVTVTVTRKRRHQMPALKNSSTLLL_TKIRS_VLARY
QNMTARMQGRLSPRTRV_REARRRARTVAKSQSLSLWCLKTPALRSHSQYPSRRRSPNSELLLRTLTWCSAQRPHLNPHL_VHSHHRALL
RPSSSLPRSLRCRGHPGHSPPPSCSIRTSHLCRPTPLLRASPSHCQPTTAVA_ASTV_AAAEAALQRRLSPPHLTSPTTPLPPRSPSPCP
TTAPCTASHPPSSPPHTHITPICLPLPLLCLLHHH_HQEVCRWPDTRPGALTQSKTSCDRN_TLVFWPLRVLTAGLPWALRPTCGPSSIS
TSTSTSTPTSTRTSTPSRRSPTPSHPPPSCRRQHLPCLTNTLQKLTHSTGTVSSIPILLQCRASPL_SHPLALLVHYKEHFSRS_QILSD
LC_GNQGSGVLCMFTSPGRFTTTNRKSRNRCSQTHISWTLD_NLSS_AALQAPVFLEPSTTPMTWHGLQLCSLPLVLHTQLGPLLGHLLI
TATSSTLLPT_SLLIGRLHSQA_QQLVAMPSGDLEILPLHPTQCSATRMAPVCRTLATLTNPGTGCTERLRRSRPLRPG_SQGSWSAARP
LQLMTEIEM_INETHLLVKMTKKGKASRRDTPATLHQHLSSR_MPWDIPAAPLNRSGLI_TLRLGRRTNPKRGRETTRNPARTWPPTSTR
RKRATCPRRTGTATRGAPRAKRPSSWPGCRLPTCGPRWWRVPGPTAPRAGRPSRARVSRPTRTPRRAPRSR_RRSGRKTMTCLQRPRRPT
GPRSRRLPTPRPACTRGPWPRCP_RWG_RAFTP_TASAAWTGLA__PPSWASAPSRAESASRTLLSTGTPSGTP_GILTENLTFTGETRW
AGTSC_GTTRSTGSRLPGCTKPTAPSGTGSLTTTATTTTTTTTRCLWTLGGSTSGEATWTSGSACTCSEKTTSTRGSTPCTPPPSTDTSP

>In-frame_KMT2C_ENST00000262189_chr7_152132711_-_AUTS2_ENST00000342771_chr7_69900738_+_1093aa
MSSEEDKSVEQPQPPPPPPEEPGAPAPSPAAADKRPRGRPRKDGASPFQRARKNVTVTVTRKRRHQMPALKNSSTLLL_TKIRS_VLARY
QNMTARMQGRLSPRTRV_REARRRARTVAKSQSLSLWCLKTPALRSHSQYPSRRRSPNSELLLRTLTWCSAQRPHLNPHL_VHSHHRALL
RPSSSLPRSLRCRGHPGHSPPPSCSIRTSHLCRPTPLLRASPSHCQPTTAVA_ASTV_AAAEAALQRRLSPPHLTSPTTPLPPRSPSPCP
TTAPCTASHPPSSPPHTHITPICLPLPLLCLLHHH_HQEVCRWPDTRPGALTQSKTSCDRN_TLVFWPLRVLTAGLPWALRPTCGPSSIS
TSTSTSTPTSTRTSTPSRRSPTPSHPPPSCRRQHLPCLTNTLQKLTHSTGTVSSIPILLQCRASPL_SHPLALLVHYKEHFSRRHPTLSM
SLLGLGQSHTLYSKRTRG_QILSDLC_GNQGSGVLCMFTSPGRFTTTNRKSRNRCSQTHISWTLD_NLSS_AALQAPVFLEPSTTPMTWH
GLQLCSLPLVLHTQLGPLLGHLLITATSSTLLPT_SLLIGRLHSQA_QQLVAMPSGDLEILPLHPTQCSATRMAPVCRTLATLTNPGTGC
TERLRRSRPLRPG_SQGSWSAARPLQLMTEIEM_INETHLLVKMTKKGKASRRDTPATLHQHLSSR_MPWDIPAAPLNRSGLI_TLRLGR
RTNPKRGRETTRNPARTWPPTSTRRKRATCPRRTGTATRGAPRAKRPSSWPGCRLPTCGPRWWRVPGPTAPRAGRPSRARVSRPTRTPRR
APRSR_RRSGRKTMTCLQRPRRPTGPRSRRLPTPRPACTRGPWPRCP_RWG_RAFTP_TASAAWTGLA__PPSWASAPSRAESASRTLLS
TGTPSGTP_GILTENLTFTGETRWAGTSC_GTTRSTGSRLPGCTKPTAPSGTGSLTTTATTTTTTTTRCLWTLGGSTSGEATWTSGSACT
CSEKTTSTRGSTPCTPPPSTDTSPTPASSPRDSPACTIPASAPPRATRTDSSTRPLRQQR_AHLPRSSPRWGAARSLPEGRLLCPQR_GR

>In-frame_KMT2C_ENST00000355193_chr7_152132711_-_AUTS2_ENST00000406775_chr7_69900738_+_1069aa
MSSEEDKSVEQPQPPPPPPEEPGAPAPSPAAADKRPRGRPRKDGASPFQRARKNVTVTVTRKRRHQMPALKNSSTLLL_TKIRS_VLARY
QNMTARMQGRLSPRTRV_REARRRARTVAKSQSLSLWCLKTPALRSHSQYPSRRRSPNSELLLRTLTWCSAQRPHLNPHL_VHSHHRALL
RPSSSLPRSLRCRGHPGHSPPPSCSIRTSHLCRPTPLLRASPSHCQPTTAVA_ASTV_AAAEAALQRRLSPPHLTSPTTPLPPRSPSPCP
TTAPCTASHPPSSPPHTHITPICLPLPLLCLLHHH_HQEVCRWPDTRPGALTQSKTSCDRN_TLVFWPLRVLTAGLPWALRPTCGPSSIS
TSTSTSTPTSTRTSTPSRRSPTPSHPPPSCRRQHLPCLTNTLQKLTHSTGTVSSIPILLQCRASPL_SHPLALLVHYKEHFSRS_QILSD
LC_GNQGSGVLCMFTSPGRFTTTNRKSRNRCSQTHISWTLD_NLSS_AALQAPVFLEPSTTPMTWHGLQLCSLPLVLHTQLGPLLGHLLI
TATSSTLLPT_SLLIGRLHSQA_QQLVAMPSGDLEILPLHPTQCSATRMAPVCRTLATLTNPGTGCTERLRRSRPLRPG_SQGSWSAARP
LQLMTEIEM_INETHLLVKMTKKGKASRRDTPATLHQHLSSR_MPWDIPAAPLNRSGLI_TLRLGRRTNPKRGRETTRNPARTWPPTSTR
RKRATCPRRTGTATRGAPRAKRPSSWPGCRLPTCGPRWWRVPGPTAPRAGRPSRARVSRPTRTPRRAPRSR_RRSGRKTMTCLQRPRRPT
GPRSRRLPTPRPACTRGPWPRCP_RWG_RAFTP_TASAAWTGLA__PPSWASAPSRAESASRTLLSTGTPSGTP_GILTENLTFTGETRW
AGTSC_GTTRSTGSRLPGCTKPTAPSGTGSLTTTATTTTTTTTRCLWTLGGSTSGEATWTSGSACTCSEKTTSTRGSTPCTPPPSTDTSP

>In-frame_KMT2C_ENST00000355193_chr7_152132711_-_AUTS2_ENST00000342771_chr7_69900738_+_1093aa
MSSEEDKSVEQPQPPPPPPEEPGAPAPSPAAADKRPRGRPRKDGASPFQRARKNVTVTVTRKRRHQMPALKNSSTLLL_TKIRS_VLARY
QNMTARMQGRLSPRTRV_REARRRARTVAKSQSLSLWCLKTPALRSHSQYPSRRRSPNSELLLRTLTWCSAQRPHLNPHL_VHSHHRALL
RPSSSLPRSLRCRGHPGHSPPPSCSIRTSHLCRPTPLLRASPSHCQPTTAVA_ASTV_AAAEAALQRRLSPPHLTSPTTPLPPRSPSPCP
TTAPCTASHPPSSPPHTHITPICLPLPLLCLLHHH_HQEVCRWPDTRPGALTQSKTSCDRN_TLVFWPLRVLTAGLPWALRPTCGPSSIS
TSTSTSTPTSTRTSTPSRRSPTPSHPPPSCRRQHLPCLTNTLQKLTHSTGTVSSIPILLQCRASPL_SHPLALLVHYKEHFSRRHPTLSM
SLLGLGQSHTLYSKRTRG_QILSDLC_GNQGSGVLCMFTSPGRFTTTNRKSRNRCSQTHISWTLD_NLSS_AALQAPVFLEPSTTPMTWH
GLQLCSLPLVLHTQLGPLLGHLLITATSSTLLPT_SLLIGRLHSQA_QQLVAMPSGDLEILPLHPTQCSATRMAPVCRTLATLTNPGTGC
TERLRRSRPLRPG_SQGSWSAARPLQLMTEIEM_INETHLLVKMTKKGKASRRDTPATLHQHLSSR_MPWDIPAAPLNRSGLI_TLRLGR
RTNPKRGRETTRNPARTWPPTSTRRKRATCPRRTGTATRGAPRAKRPSSWPGCRLPTCGPRWWRVPGPTAPRAGRPSRARVSRPTRTPRR
APRSR_RRSGRKTMTCLQRPRRPTGPRSRRLPTPRPACTRGPWPRCP_RWG_RAFTP_TASAAWTGLA__PPSWASAPSRAESASRTLLS
TGTPSGTP_GILTENLTFTGETRWAGTSC_GTTRSTGSRLPGCTKPTAPSGTGSLTTTATTTTTTTTRCLWTLGGSTSGEATWTSGSACT
CSEKTTSTRGSTPCTPPPSTDTSPTPASSPRDSPACTIPASAPPRATRTDSSTRPLRQQR_AHLPRSSPRWGAARSLPEGRLLCPQR_GR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KMT2C_ENST00000262189_chr7_152132711_-_AUTS2_ENST00000406775_chr7_69900738_+_3209nt
ATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCACCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCA
GCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCTTTCCAGAGAGCCAGAAAGAATGTGACAGTGACAGTGACC
AGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTAC
CAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAG
AGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAG
CTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTG
AGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCAC
CTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCA
GCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCA
ACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGC
CTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGG
AACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGC
ACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGC
CGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAG
TGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGAC
CTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGA
TGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACC
ACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATC
ACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCT
TCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACG
AACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCG
CTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGAC
ACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGA
ACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGG
CGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGT
CTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCT
ACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACC
GGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCA
TTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCT
TCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGG
GCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGC
CTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACG
AGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCC
ACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGA
CCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGT

>In-frame_KMT2C_ENST00000262189_chr7_152132711_-_AUTS2_ENST00000342771_chr7_69900738_+_3281nt
ATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCACCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCA
GCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCTTTCCAGAGAGCCAGAAAGAATGTGACAGTGACAGTGACC
AGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTAC
CAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAG
AGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAG
CTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTG
AGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCAC
CTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCA
GCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCA
ACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGC
CTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGG
AACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGC
ACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGC
CGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAG
TGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATG
TCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAG
GGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATA
AGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCAC
GGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACC
CTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATC
CTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGC
ACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAG
ATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCAC
CAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGA
AGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGC
CCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCC
CGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGA
GCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGC
CTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCA
TCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCC
ACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAA
GGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACC
ACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACA
TGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCC
CGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGC
TGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGA

>In-frame_KMT2C_ENST00000355193_chr7_152132711_-_AUTS2_ENST00000406775_chr7_69900738_+_3209nt
ATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCACCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCA
GCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCTTTCCAGAGAGCCAGAAAGAATGTGACAGTGACAGTGACC
AGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTAC
CAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAG
AGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAG
CTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTG
AGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCAC
CTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCA
GCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCA
ACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGC
CTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGG
AACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGC
ACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGC
CGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAG
TGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGAC
CTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGA
TGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACC
ACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATC
ACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCT
TCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACG
AACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCG
CTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGAC
ACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGA
ACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGG
CGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGT
CTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCT
ACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACC
GGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCA
TTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCT
TCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGG
GCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGC
CTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACG
AGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCC
ACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGA
CCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGT

>In-frame_KMT2C_ENST00000355193_chr7_152132711_-_AUTS2_ENST00000342771_chr7_69900738_+_3281nt
ATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCACCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCA
GCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCTTTCCAGAGAGCCAGAAAGAATGTGACAGTGACAGTGACC
AGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTAC
CAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAG
AGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAG
CTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTG
AGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCAC
CTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCA
GCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCA
ACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGC
CTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGG
AACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGC
ACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGC
CGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAG
TGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATG
TCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAAAAGGACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAG
GGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATA
AGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCAC
GGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACC
CTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATC
CTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGC
ACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAG
ATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCAC
CAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGA
AGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGC
CCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCC
CGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGA
GCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGC
CTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCA
TCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCC
ACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAA
GGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACC
ACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACA
TGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCC
CGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGC
TGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_KMT2C_ENST00000262189_chr7_152132711_-_AUTS2_ENST00000406775_chr7_69900738_+_4935nt
GAGGTGCGCGCGCCCGCGCCGATGTGTGTGAGTGCGTGTCCTGCTCGCTCCATGTTGCCGCCTCTCCCGGTACCTGCTGCTGCTCCCGGG
GCTGCGGGAAATGCGAGAGGCTGAGCCGGGGAGGAGGAACCCGAGCAGCAGCGGCGGCGGCGGCGGCCGCGGCGGCGGGAGCCCCCCAGG
AGGAGGACCGGGATCCATGTGTCTTTCCTGGTGACTAGGATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCA
CCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCAGCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCT
TTCCAGAGAGCCAGAAAGAATGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTA
TTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTC
TAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCAC
AGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAAC
CCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGC
CACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCT
ACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCC
ACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACT
CACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGG
CCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCC
TGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCA
CGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCAT
TCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTAC
AAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCT
GGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGA
GCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTG
CACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGT
CTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACA
AGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGC
CCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTA
GTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGAC
ATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACT
CGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCG
CCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCT
CGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGG
AAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGC
CCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCC
CCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATC
CTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCC
GGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGG
ACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCC
ACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCA
GCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGG
GGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGG
CCCGATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGG
CTCACACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTAT
ATGTTGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACC
AAAACAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAA
ATTCTTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTA
AGATGAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTT
AATATCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCT
TTTCACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACG
TGATATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCT
GAAGTTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTT
GCCAGATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCA
TGCCTTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAA
AGCTTCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTG
TATTCCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAA
AAAAGTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCT
ACATATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTA

>In-frame_KMT2C_ENST00000262189_chr7_152132711_-_AUTS2_ENST00000342771_chr7_69900738_+_5572nt
GAGGTGCGCGCGCCCGCGCCGATGTGTGTGAGTGCGTGTCCTGCTCGCTCCATGTTGCCGCCTCTCCCGGTACCTGCTGCTGCTCCCGGG
GCTGCGGGAAATGCGAGAGGCTGAGCCGGGGAGGAGGAACCCGAGCAGCAGCGGCGGCGGCGGCGGCCGCGGCGGCGGGAGCCCCCCAGG
AGGAGGACCGGGATCCATGTGTCTTTCCTGGTGACTAGGATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCA
CCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCAGCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCT
TTCCAGAGAGCCAGAAAGAATGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTA
TTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTC
TAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCAC
AGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAAC
CCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGC
CACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCT
ACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCC
ACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACT
CACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGG
CCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCC
TGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCA
CGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCAT
TCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTAC
AAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAAAAGGACCCGA
GGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACC
AACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCA
GTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCC
CTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAG
CAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGC
AGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGG
AGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAA
GGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTG
AACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACC
TGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCA
AGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGC
CGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTC
CAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCA
TGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCC
CCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACA
TTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACC
GCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACG
AGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCT
CCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACC
AGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTC
CCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACA
GGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGGGGGG
GAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTTCAGA
TCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGATGACA
ACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTG
GGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTT
GTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACACAGT
CGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCT
AACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTC
CTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGG
CTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAG
GGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTC
CTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAG
ATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCA
AGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAG
TGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAGAATA
TGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTA
GTATATTAAAGTGCTATCTGACGTTGTTATCCTGTTTTTGCAAAAAAAAAAAAAAAAAAAAGTTAACTACAGACCATTGTTTCTAATAAG
CAGAGAGATCTATTTTAGTAGTAAACTGAAGGTTTAGTTGTGAGCTTCAGATTTTGTGAACTCCAGATGTTGTGCGGTGTTTTTTTTTTT
TTTTAAGACAACAACTAAAAAAAATGCAAGGAATATGTACACTGGAACTGTAGTGGTAGCTTTCAGTATTGTAAAGAGATTGTTCTATAC
GGACCTTTTTGCTGTTTATCCTGTATGTAATAAAGTCCTTTCTAGATCCTATGTGAAAAGAAAAGTGAAGCAACTGAATCTTCAGCATGT
TCTCATCGGCGGAGCCTTCTTGTGTAATGTAAACTGTGCCATGTTATTAAAAAATGTGAACTAAGCTTCCAGCTGCTTGTTTGTGTGAGG
TGACCATCATTACCTTAGGGAAGAAGCCATACCTGTACAAGACCGGGCTCTTGAAAAGAAACACCTCGAACCCAGCCCGTGTAAGAACAG

>In-frame_KMT2C_ENST00000355193_chr7_152132711_-_AUTS2_ENST00000406775_chr7_69900738_+_4935nt
GAGGTGCGCGCGCCCGCGCCGATGTGTGTGAGTGCGTGTCCTGCTCGCTCCATGTTGCCGCCTCTCCCGGTACCTGCTGCTGCTCCCGGG
GCTGCGGGAAATGCGAGAGGCTGAGCCGGGGAGGAGGAACCCGAGCAGCAGCGGCGGCGGCGGCGGCCGCGGCGGCGGGAGCCCCCCAGG
AGGAGGACCGGGATCCATGTGTCTTTCCTGGTGACTAGGATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCA
CCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCAGCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCT
TTCCAGAGAGCCAGAAAGAATGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTA
TTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTC
TAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCAC
AGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAAC
CCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGC
CACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCT
ACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCC
ACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACT
CACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGG
CCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCC
TGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCA
CGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCAT
TCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTAC
AAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCT
GGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGA
GCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTG
CACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGT
CTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACA
AGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGC
CCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTA
GTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGAC
ATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACT
CGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCG
CCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCT
CGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGG
AAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGC
CCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCC
CCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATC
CTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCC
GGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGG
ACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCC
ACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCA
GCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGG
GGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGG
CCCGATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGG
CTCACACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTAT
ATGTTGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACC
AAAACAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAA
ATTCTTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTA
AGATGAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTT
AATATCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCT
TTTCACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACG
TGATATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCT
GAAGTTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTT
GCCAGATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCA
TGCCTTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAA
AGCTTCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTG
TATTCCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAA
AAAAGTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCT
ACATATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTA

>In-frame_KMT2C_ENST00000355193_chr7_152132711_-_AUTS2_ENST00000342771_chr7_69900738_+_5572nt
GAGGTGCGCGCGCCCGCGCCGATGTGTGTGAGTGCGTGTCCTGCTCGCTCCATGTTGCCGCCTCTCCCGGTACCTGCTGCTGCTCCCGGG
GCTGCGGGAAATGCGAGAGGCTGAGCCGGGGAGGAGGAACCCGAGCAGCAGCGGCGGCGGCGGCGGCCGCGGCGGCGGGAGCCCCCCAGG
AGGAGGACCGGGATCCATGTGTCTTTCCTGGTGACTAGGATGTCGTCGGAGGAGGACAAGAGCGTGGAGCAGCCGCAGCCGCCGCCACCA
CCCCCCGAGGAGCCTGGAGCCCCGGCCCCGAGCCCCGCAGCCGCAGACAAAAGACCTCGGGGCCGGCCTCGCAAAGATGGCGCTTCCCCT
TTCCAGAGAGCCAGAAAGAATGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTA
TTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTC
TAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCAC
AGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAAC
CCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGC
CACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCT
ACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCC
ACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACT
CACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGG
CCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCC
TGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCA
CGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCAT
TCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTAC
AAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAAAAGGACCCGA
GGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACC
AACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCA
GTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCC
CTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAG
CAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGC
AGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGG
AGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAA
GGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTG
AACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACC
TGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCA
AGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGC
CGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTC
CAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCA
TGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCC
CCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACA
TTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACC
GCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACG
AGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCT
CCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACC
AGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTC
CCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCGAGAACA
GGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACTGGGGGG
GAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTTTTCAGA
TCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAGATGACA
ACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGATGAGGTG
GGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTTTACTTT
GTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAACACAGT
CGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGCCCGCCT
AACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCTGTTTTC
CTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCTTGTGGG
CTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAAAATCAG
GGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAGTGTGTC
CTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTTTCTCAG
ATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGGTGATCA
AGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTGTGTGAG
TGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAGAGAATA
TGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGTCTTCTA
GTATATTAAAGTGCTATCTGACGTTGTTATCCTGTTTTTGCAAAAAAAAAAAAAAAAAAAAGTTAACTACAGACCATTGTTTCTAATAAG
CAGAGAGATCTATTTTAGTAGTAAACTGAAGGTTTAGTTGTGAGCTTCAGATTTTGTGAACTCCAGATGTTGTGCGGTGTTTTTTTTTTT
TTTTAAGACAACAACTAAAAAAAATGCAAGGAATATGTACACTGGAACTGTAGTGGTAGCTTTCAGTATTGTAAAGAGATTGTTCTATAC
GGACCTTTTTGCTGTTTATCCTGTATGTAATAAAGTCCTTTCTAGATCCTATGTGAAAAGAAAAGTGAAGCAACTGAATCTTCAGCATGT
TCTCATCGGCGGAGCCTTCTTGTGTAATGTAAACTGTGCCATGTTATTAAAAAATGTGAACTAAGCTTCCAGCTGCTTGTTTGTGTGAGG
TGACCATCATTACCTTAGGGAAGAAGCCATACCTGTACAAGACCGGGCTCTTGAAAAGAAACACCTCGAACCCAGCCCGTGTAAGAACAG


Top

FusionGenePPI for KMT2C_AUTS2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KMT2CAK1, NCOA6, ASH2L, RBBP5, HIST2H3C, ASCL2, KDM6A, SMARCB1, MAPK14, JUN, PAXIP1, H3F3A, PAGR1, WDR82, CDC73, TSC22D1, KDM4B, ELAVL1, WDR5, HIST1H3A, APPL2, ERP44, HIST3H3, DPY30, MTNR1B, FOXA1, TRIM25AUTS2PCGF3, PCGF5, RNF2, CSNK2A2, RYBP, RING1, YAF2, CSNK2A1, CSNK2B, DCAF7, FBRS, EP300, RERE, RBM14, ZNF608, ZNF609, TLE3, WDR5, PCGF6, ATN1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KMT2C_AUTS2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KMT2C_AUTS2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKMT2CC0001418Adenocarcinoma1CTD_human
HgeneKMT2CC0005695Bladder Neoplasm1CTD_human
HgeneKMT2CC0007138Carcinoma, Transitional Cell1CTD_human
HgeneKMT2CC0010606Adenoid Cystic Carcinoma1CTD_human
HgeneKMT2CC0023467Leukemia, Myelocytic, Acute1CTD_human
HgeneKMT2CC0023897Liver Diseases, Parasitic1CTD_human
HgeneKMT2CC0036920Sezary Syndrome1CTD_human
HgeneKMT2CC0038356Stomach Neoplasms1CTD_human
HgeneKMT2CC0206698Cholangiocarcinoma1CTD_human
HgeneKMT2CC0279626Squamous cell carcinoma of esophagus1CTD_human
HgeneKMT2CC2239176Liver carcinoma1CTD_human
TgeneAUTS2C0036341Schizophrenia2PSYGENET
TgeneAUTS2C0014544Epilepsy1CTD_human