FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18472

FusionGeneSummary for KDM4C_KIAA1045

check button Fusion gene summary
Fusion gene informationFusion gene name: KDM4C_KIAA1045
Fusion gene ID: 18472
HgeneTgene
Gene symbol

KDM4C

KIAA1045

Gene ID

23081

Gene namelysine demethylase 4C
SynonymsGASC1|JHDM3C|JMJD2C|TDRD14C
Cytomap

9p24.1

Type of geneprotein-coding
Descriptionlysine-specific demethylase 4CJmjC domain-containing histone demethylation protein 3Cgene amplified in squamous cell carcinoma 1 proteinjumonji domain-containing protein 2Clysine (K)-specific demethylase 4Ctudor domain containing 14C
Modification date20180523
UniProtAcc

Q9H3R0

Ensembl transtripts involved in fusion geneENST00000535193, ENST00000543771, 
ENST00000381306, ENST00000381309, 
ENST00000442236, ENST00000489243, 
ENST00000536108, ENST00000428870, 
ENST00000401787, 
ENST00000544237, 
ENST00000476115, ENST00000242315, 
Fusion gene scores* DoF score11 X 8 X 10=8803 X 2 X 3=18
# samples 123
** MAII scorelog2(12/880*10)=-2.87446911791614
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: KDM4C [Title/Abstract] AND KIAA1045 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneKDM4C

GO:0006357

regulation of transcription by RNA polymerase II

17277772

HgeneKDM4C

GO:0033169

histone H3-K9 demethylation

18066052|21914792

HgeneKDM4C

GO:0070544

histone H3-K36 demethylation

21914792


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-S9-A7R1-01AKDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000535193ENST00000544237KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
5CDS-3UTRENST00000535193ENST00000476115KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
5CDS-3UTRENST00000535193ENST00000242315KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
In-frameENST00000543771ENST00000544237KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
5CDS-3UTRENST00000543771ENST00000476115KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
5CDS-3UTRENST00000543771ENST00000242315KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
In-frameENST00000381306ENST00000544237KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
5CDS-3UTRENST00000381306ENST00000476115KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
5CDS-3UTRENST00000381306ENST00000242315KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
In-frameENST00000381309ENST00000544237KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
5CDS-3UTRENST00000381309ENST00000476115KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
5CDS-3UTRENST00000381309ENST00000242315KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
In-frameENST00000442236ENST00000544237KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
5CDS-3UTRENST00000442236ENST00000476115KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
5CDS-3UTRENST00000442236ENST00000242315KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
3UTR-3CDSENST00000489243ENST00000544237KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
3UTR-3UTRENST00000489243ENST00000476115KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
3UTR-3UTRENST00000489243ENST00000242315KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
In-frameENST00000536108ENST00000544237KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
5CDS-3UTRENST00000536108ENST00000476115KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
5CDS-3UTRENST00000536108ENST00000242315KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
intron-3CDSENST00000428870ENST00000544237KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
intron-3UTRENST00000428870ENST00000476115KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
intron-3UTRENST00000428870ENST00000242315KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
intron-3CDSENST00000401787ENST00000544237KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
intron-3UTRENST00000401787ENST00000476115KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+
intron-3UTRENST00000401787ENST00000242315KDM4Cchr9

6893232

+KIAA1045chr9

34976149

+

Top

FusionProtFeatures for KDM4C_KIAA1045


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KDM4C

Q9H3R0

KIAA1045

Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000381306+821144_3103071048DomainJmjC
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000381306+82116_583071048DomainJmjN
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000381309+822144_3103071057DomainJmjC
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000381309+82216_583071057DomainJmjN
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000535193+818144_310329836DomainJmjC
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000535193+81816_58329836DomainJmjN
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000543771+818144_310307814DomainJmjC
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000543771+81816_58307814DomainJmjN

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000381306+821877_9343071048DomainNote=Tudor 1
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000381306+821935_9913071048DomainNote=Tudor 2
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000381309+822877_9343071057DomainNote=Tudor 1
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000381309+822935_9913071057DomainNote=Tudor 2
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000535193+818877_934329836DomainNote=Tudor 1
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000535193+818935_991329836DomainNote=Tudor 2
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000543771+818877_934307814DomainNote=Tudor 1
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000543771+818935_991307814DomainNote=Tudor 2
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000381306+821689_7473071048Zinc fingerNote=PHD-type 1
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000381306+821752_7853071048Zinc fingerC2HC pre-PHD-type
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000381306+821808_8653071048Zinc fingerPHD-type 2
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000381309+822689_7473071057Zinc fingerNote=PHD-type 1
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000381309+822752_7853071057Zinc fingerC2HC pre-PHD-type
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000381309+822808_8653071057Zinc fingerPHD-type 2
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000535193+818689_747329836Zinc fingerNote=PHD-type 1
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000535193+818752_785329836Zinc fingerC2HC pre-PHD-type
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000535193+818808_865329836Zinc fingerPHD-type 2
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000543771+818689_747307814Zinc fingerNote=PHD-type 1
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000543771+818752_785307814Zinc fingerC2HC pre-PHD-type
HgeneKDM4Cchr9:6893232chr9:34976149ENST00000543771+818808_865307814Zinc fingerPHD-type 2
TgeneKIAA1045chr9:6893232chr9:34976149ENST00000242315+28129_190188401Zinc fingerNote=PHD-type
TgeneKIAA1045chr9:6893232chr9:34976149ENST00000544237+28129_190188401Zinc fingerNote=PHD-type


Top

FusionGeneSequence for KDM4C_KIAA1045


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KDM4C_ENST00000535193_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_542aa
MKHTGLPWKRTEEAAADTALTIMEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQCTDDIDNLL
IPAPIQQMVTGQSGLFTQYNIQKKAMTVKEFRQLANSGKTCTPRYLDYEDLERKYWKNLTFVAPITGADINGSITDEGVDEWNIARLNTV
LDVVEEECGISIEGVNTPTLTFGMWKTTFAWHTEDMDLTSINTLHFGEPKSWTAIPPEHGKRLERLAQGFFPSSSQGCDAFLRHKMTLIS
PSVLKKTGIPFDKITQEAGEFMITFPTGYHAGFNHGFNCAESTNFATVRWIDTGKVAKLDNINLLLTEEEMTSLTETFQRCKVIPDCSLT
LEDFLRYRHQAAKRGDRDRALSEEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLRPQNSLLRLLTVKERERARAAFLARGSGS
TVSEAECRRAQHSWFCKRFPEAPSCSVSISHVGPIADSSPASSSSKSQDKTLLPTEQESRFVDWPTFLQENVLYILAARPNSAAIHLKPP

>In-frame_KDM4C_ENST00000543771_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_520aa
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQCTDDIDNLLIPAPIQQMVTGQSGLFTQYNIQ
KKAMTVKEFRQLANSGKTCTPRYLDYEDLERKYWKNLTFVAPITGADINGSITDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPTLTF
GMWKTTFAWHTEDMDLTSINTLHFGEPKSWTAIPPEHGKRLERLAQGFFPSSSQGCDAFLRHKMTLISPSVLKKTGIPFDKITQEAGEFM
ITFPTGYHAGFNHGFNCAESTNFATVRWIDTGKVAKLDNINLLLTEEEMTSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRALS
EEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLRPQNSLLRLLTVKERERARAAFLARGSGSTVSEAECRRAQHSWFCKRFPEA

>In-frame_KDM4C_ENST00000381306_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_520aa
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQCTDDIDNLLIPAPIQQMVTGQSGLFTQYNIQ
KKAMTVKEFRQLANSGKTCTPRYLDYEDLERKYWKNLTFVAPITGADINGSITDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPTLTF
GMWKTTFAWHTEDMDLTSINTLHFGEPKSWTAIPPEHGKRLERLAQGFFPSSSQGCDAFLRHKMTLISPSVLKKTGIPFDKITQEAGEFM
ITFPTGYHAGFNHGFNCAESTNFATVRWIDTGKVAKLDNINLLLTEEEMTSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRALS
EEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLRPQNSLLRLLTVKERERARAAFLARGSGSTVSEAECRRAQHSWFCKRFPEA

>In-frame_KDM4C_ENST00000381309_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_520aa
MEVAEVESPLNPSCKIMTFRPSMEEFREFNKYLAYMESKGAHRAGLAKVIPPKEWKPRQCTDDIDNLLIPAPIQQMVTGQSGLFTQYNIQ
KKAMTVKEFRQLANSGKTCTPRYLDYEDLERKYWKNLTFVAPITGADINGSITDEGVDEWNIARLNTVLDVVEEECGISIEGVNTPTLTF
GMWKTTFAWHTEDMDLTSINTLHFGEPKSWTAIPPEHGKRLERLAQGFFPSSSQGCDAFLRHKMTLISPSVLKKTGIPFDKITQEAGEFM
ITFPTGYHAGFNHGFNCAESTNFATVRWIDTGKVAKLDNINLLLTEEEMTSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRALS
EEQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLRPQNSLLRLLTVKERERARAAFLARGSGSTVSEAECRRAQHSWFCKRFPEA

>In-frame_KDM4C_ENST00000442236_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_339aa
MWKTTFAWHTEDMDLTSINTLHFGEPKSWTAIPPEHGKRLERLAQGFFPSSSQGCDAFLRHKMTLISPSVLKKTGIPFDKITQEAGEFMI
TFPTGYHAGFNHGFNCAESTNFATVRWIDTGKVAKLDNINLLLTEEEMTSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRALSE
EQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLRPQNSLLRLLTVKERERARAAFLARGSGSTVSEAECRRAQHSWFCKRFPEAP

>In-frame_KDM4C_ENST00000536108_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_339aa
MWKTTFAWHTEDMDLTSINTLHFGEPKSWTAIPPEHGKRLERLAQGFFPSSSQGCDAFLRHKMTLISPSVLKKTGIPFDKITQEAGEFMI
TFPTGYHAGFNHGFNCAESTNFATVRWIDTGKVAKLDNINLLLTEEEMTSLTETFQRCKVIPDCSLTLEDFLRYRHQAAKRGDRDRALSE
EQEEQAARQFAALDPEHRGHIEWPDFLSHESLLLLQQLRPQNSLLRLLTVKERERARAAFLARGSGSTVSEAECRRAQHSWFCKRFPEAP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KDM4C_ENST00000535193_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_1626nt
ATGAAGCACTATGGGCTGCCCTGGAAGAGGACTGAAGAAGCAGCTGCAGACACTGCCCTAACCATCATGGAGGTGGCCGAGGTGGAAAGT
CCTCTGAACCCCAGCTGTAAGATAATGACCTTCAGACCCTCCATGGAGGAGTTCCGGGAGTTCAACAAATACCTTGCATACATGGAGTCT
AAAGGAGCCCATCGTGCGGGTCTTGCAAAGGTGATTCCTCCTAAGGAGTGGAAGCCAAGACAGTGCTATGATGACATTGATAATTTGCTC
ATTCCAGCACCAATTCAGCAGATGGTCACAGGGCAGTCAGGACTGTTCACTCAGTACAACATCCAGAAAAAAGCGATGACTGTGAAGGAG
TTCAGGCAGCTGGCCAACAGTGGCAAATATTGTACTCCAAGATACTTGGATTACGAAGATTTGGAGCGCAAGTACTGGAAGAACTTAACT
TTTGTGGCACCTATCTATGGTGCAGATATTAATGGGAGCATATATGATGAGGGTGTGGATGAATGGAACATAGCTCGCCTCAATACAGTC
TTGGATGTGGTTGAAGAAGAGTGTGGCATTTCTATTGAGGGTGTAAATACCCCATATCTCTATTTTGGCATGTGGAAGACCACGTTTGCA
TGGCACACCGAAGACATGGACCTCTATAGCATTAATTATCTCCACTTTGGAGAGCCCAAGTCTTGGTATGCTATACCTCCGGAGCATGGA
AAACGACTTGAAAGACTAGCTCAAGGTTTTTTCCCAAGCAGCTCCCAAGGGTGTGATGCATTTCTTCGCCACAAGATGACATTGATTTCT
CCATCAGTATTGAAGAAATATGGTATTCCCTTTGACAAGATAACCCAGGAGGCTGGAGAATTCATGATCACTTTCCCATATGGCTACCAT
GCTGGTTTTAATCATGGTTTCAACTGTGCAGAATCTACAAATTTTGCTACTGTCAGATGGATTGACTATGGAAAAGTTGCCAAATTGGAC
AACATCAACTTGCTGCTTACTGAGGAGGAAATGTATAGCCTCACGGAGACCTTTCAGCGGTGTAAAGTCATCCCTGATTGCTCCCTGACA
CTGGAGGACTTTCTGCGTTACCGCCACCAAGCAGCCAAGCGGGGGGACCGTGACAGGGCCCTGAGTGAGGAGCAAGAAGAGCAGGCGGCC
CGCCAGTTTGCTGCCCTGGACCCTGAACATCGAGGCCACATAGAGTGGCCTGACTTCTTGTCCCATGAGTCCCTCCTGCTTCTGCAGCAG
TTGCGTCCCCAGAACTCTCTGTTGAGGCTTCTGACAGTGAAGGAGCGGGAGCGAGCCCGAGCCGCCTTCCTGGCTCGGGGCAGTGGGAGC
ACCGTCAGTGAGGCAGAGTGCCGCCGGGCCCAGCACTCTTGGTTTTGCAAACGGTTCCCAGAGGCTCCTTCCTGCAGTGTCAGCATCAGC
CATGTGGGTCCCATCGCAGATAGCAGCCCAGCCAGCAGCAGCAGCAAGAGTCAGGACAAGACCCTGCTGCCCACAGAGCAGGAGTCCAGA
TTTGTGGACTGGCCTACCTTCCTGCAAGAGAATGTCCTCTACATCCTGGCTGCTCGCCCCAACAGCGCAGCCATTCACCTGAAGCCCCCA

>In-frame_KDM4C_ENST00000543771_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_1560nt
ATGGAGGTGGCCGAGGTGGAAAGTCCTCTGAACCCCAGCTGTAAGATAATGACCTTCAGACCCTCCATGGAGGAGTTCCGGGAGTTCAAC
AAATACCTTGCATACATGGAGTCTAAAGGAGCCCATCGTGCGGGTCTTGCAAAGGTGATTCCTCCTAAGGAGTGGAAGCCAAGACAGTGC
TATGATGACATTGATAATTTGCTCATTCCAGCACCAATTCAGCAGATGGTCACAGGGCAGTCAGGACTGTTCACTCAGTACAACATCCAG
AAAAAAGCGATGACTGTGAAGGAGTTCAGGCAGCTGGCCAACAGTGGCAAATATTGTACTCCAAGATACTTGGATTACGAAGATTTGGAG
CGCAAGTACTGGAAGAACTTAACTTTTGTGGCACCTATCTATGGTGCAGATATTAATGGGAGCATATATGATGAGGGTGTGGATGAATGG
AACATAGCTCGCCTCAATACAGTCTTGGATGTGGTTGAAGAAGAGTGTGGCATTTCTATTGAGGGTGTAAATACCCCATATCTCTATTTT
GGCATGTGGAAGACCACGTTTGCATGGCACACCGAAGACATGGACCTCTATAGCATTAATTATCTCCACTTTGGAGAGCCCAAGTCTTGG
TATGCTATACCTCCGGAGCATGGAAAACGACTTGAAAGACTAGCTCAAGGTTTTTTCCCAAGCAGCTCCCAAGGGTGTGATGCATTTCTT
CGCCACAAGATGACATTGATTTCTCCATCAGTATTGAAGAAATATGGTATTCCCTTTGACAAGATAACCCAGGAGGCTGGAGAATTCATG
ATCACTTTCCCATATGGCTACCATGCTGGTTTTAATCATGGTTTCAACTGTGCAGAATCTACAAATTTTGCTACTGTCAGATGGATTGAC
TATGGAAAAGTTGCCAAATTGGACAACATCAACTTGCTGCTTACTGAGGAGGAAATGTATAGCCTCACGGAGACCTTTCAGCGGTGTAAA
GTCATCCCTGATTGCTCCCTGACACTGGAGGACTTTCTGCGTTACCGCCACCAAGCAGCCAAGCGGGGGGACCGTGACAGGGCCCTGAGT
GAGGAGCAAGAAGAGCAGGCGGCCCGCCAGTTTGCTGCCCTGGACCCTGAACATCGAGGCCACATAGAGTGGCCTGACTTCTTGTCCCAT
GAGTCCCTCCTGCTTCTGCAGCAGTTGCGTCCCCAGAACTCTCTGTTGAGGCTTCTGACAGTGAAGGAGCGGGAGCGAGCCCGAGCCGCC
TTCCTGGCTCGGGGCAGTGGGAGCACCGTCAGTGAGGCAGAGTGCCGCCGGGCCCAGCACTCTTGGTTTTGCAAACGGTTCCCAGAGGCT
CCTTCCTGCAGTGTCAGCATCAGCCATGTGGGTCCCATCGCAGATAGCAGCCCAGCCAGCAGCAGCAGCAAGAGTCAGGACAAGACCCTG
CTGCCCACAGAGCAGGAGTCCAGATTTGTGGACTGGCCTACCTTCCTGCAAGAGAATGTCCTCTACATCCTGGCTGCTCGCCCCAACAGC

>In-frame_KDM4C_ENST00000381306_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_1560nt
ATGGAGGTGGCCGAGGTGGAAAGTCCTCTGAACCCCAGCTGTAAGATAATGACCTTCAGACCCTCCATGGAGGAGTTCCGGGAGTTCAAC
AAATACCTTGCATACATGGAGTCTAAAGGAGCCCATCGTGCGGGTCTTGCAAAGGTGATTCCTCCTAAGGAGTGGAAGCCAAGACAGTGC
TATGATGACATTGATAATTTGCTCATTCCAGCACCAATTCAGCAGATGGTCACAGGGCAGTCAGGACTGTTCACTCAGTACAACATCCAG
AAAAAAGCGATGACTGTGAAGGAGTTCAGGCAGCTGGCCAACAGTGGCAAATATTGTACTCCAAGATACTTGGATTACGAAGATTTGGAG
CGCAAGTACTGGAAGAACTTAACTTTTGTGGCACCTATCTATGGTGCAGATATTAATGGGAGCATATATGATGAGGGTGTGGATGAATGG
AACATAGCTCGCCTCAATACAGTCTTGGATGTGGTTGAAGAAGAGTGTGGCATTTCTATTGAGGGTGTAAATACCCCATATCTCTATTTT
GGCATGTGGAAGACCACGTTTGCATGGCACACCGAAGACATGGACCTCTATAGCATTAATTATCTCCACTTTGGAGAGCCCAAGTCTTGG
TATGCTATACCTCCGGAGCATGGAAAACGACTTGAAAGACTAGCTCAAGGTTTTTTCCCAAGCAGCTCCCAAGGGTGTGATGCATTTCTT
CGCCACAAGATGACATTGATTTCTCCATCAGTATTGAAGAAATATGGTATTCCCTTTGACAAGATAACCCAGGAGGCTGGAGAATTCATG
ATCACTTTCCCATATGGCTACCATGCTGGTTTTAATCATGGTTTCAACTGTGCAGAATCTACAAATTTTGCTACTGTCAGATGGATTGAC
TATGGAAAAGTTGCCAAATTGGACAACATCAACTTGCTGCTTACTGAGGAGGAAATGTATAGCCTCACGGAGACCTTTCAGCGGTGTAAA
GTCATCCCTGATTGCTCCCTGACACTGGAGGACTTTCTGCGTTACCGCCACCAAGCAGCCAAGCGGGGGGACCGTGACAGGGCCCTGAGT
GAGGAGCAAGAAGAGCAGGCGGCCCGCCAGTTTGCTGCCCTGGACCCTGAACATCGAGGCCACATAGAGTGGCCTGACTTCTTGTCCCAT
GAGTCCCTCCTGCTTCTGCAGCAGTTGCGTCCCCAGAACTCTCTGTTGAGGCTTCTGACAGTGAAGGAGCGGGAGCGAGCCCGAGCCGCC
TTCCTGGCTCGGGGCAGTGGGAGCACCGTCAGTGAGGCAGAGTGCCGCCGGGCCCAGCACTCTTGGTTTTGCAAACGGTTCCCAGAGGCT
CCTTCCTGCAGTGTCAGCATCAGCCATGTGGGTCCCATCGCAGATAGCAGCCCAGCCAGCAGCAGCAGCAAGAGTCAGGACAAGACCCTG
CTGCCCACAGAGCAGGAGTCCAGATTTGTGGACTGGCCTACCTTCCTGCAAGAGAATGTCCTCTACATCCTGGCTGCTCGCCCCAACAGC

>In-frame_KDM4C_ENST00000381309_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_1560nt
ATGGAGGTGGCCGAGGTGGAAAGTCCTCTGAACCCCAGCTGTAAGATAATGACCTTCAGACCCTCCATGGAGGAGTTCCGGGAGTTCAAC
AAATACCTTGCATACATGGAGTCTAAAGGAGCCCATCGTGCGGGTCTTGCAAAGGTGATTCCTCCTAAGGAGTGGAAGCCAAGACAGTGC
TATGATGACATTGATAATTTGCTCATTCCAGCACCAATTCAGCAGATGGTCACAGGGCAGTCAGGACTGTTCACTCAGTACAACATCCAG
AAAAAAGCGATGACTGTGAAGGAGTTCAGGCAGCTGGCCAACAGTGGCAAATATTGTACTCCAAGATACTTGGATTACGAAGATTTGGAG
CGCAAGTACTGGAAGAACTTAACTTTTGTGGCACCTATCTATGGTGCAGATATTAATGGGAGCATATATGATGAGGGTGTGGATGAATGG
AACATAGCTCGCCTCAATACAGTCTTGGATGTGGTTGAAGAAGAGTGTGGCATTTCTATTGAGGGTGTAAATACCCCATATCTCTATTTT
GGCATGTGGAAGACCACGTTTGCATGGCACACCGAAGACATGGACCTCTATAGCATTAATTATCTCCACTTTGGAGAGCCCAAGTCTTGG
TATGCTATACCTCCGGAGCATGGAAAACGACTTGAAAGACTAGCTCAAGGTTTTTTCCCAAGCAGCTCCCAAGGGTGTGATGCATTTCTT
CGCCACAAGATGACATTGATTTCTCCATCAGTATTGAAGAAATATGGTATTCCCTTTGACAAGATAACCCAGGAGGCTGGAGAATTCATG
ATCACTTTCCCATATGGCTACCATGCTGGTTTTAATCATGGTTTCAACTGTGCAGAATCTACAAATTTTGCTACTGTCAGATGGATTGAC
TATGGAAAAGTTGCCAAATTGGACAACATCAACTTGCTGCTTACTGAGGAGGAAATGTATAGCCTCACGGAGACCTTTCAGCGGTGTAAA
GTCATCCCTGATTGCTCCCTGACACTGGAGGACTTTCTGCGTTACCGCCACCAAGCAGCCAAGCGGGGGGACCGTGACAGGGCCCTGAGT
GAGGAGCAAGAAGAGCAGGCGGCCCGCCAGTTTGCTGCCCTGGACCCTGAACATCGAGGCCACATAGAGTGGCCTGACTTCTTGTCCCAT
GAGTCCCTCCTGCTTCTGCAGCAGTTGCGTCCCCAGAACTCTCTGTTGAGGCTTCTGACAGTGAAGGAGCGGGAGCGAGCCCGAGCCGCC
TTCCTGGCTCGGGGCAGTGGGAGCACCGTCAGTGAGGCAGAGTGCCGCCGGGCCCAGCACTCTTGGTTTTGCAAACGGTTCCCAGAGGCT
CCTTCCTGCAGTGTCAGCATCAGCCATGTGGGTCCCATCGCAGATAGCAGCCCAGCCAGCAGCAGCAGCAAGAGTCAGGACAAGACCCTG
CTGCCCACAGAGCAGGAGTCCAGATTTGTGGACTGGCCTACCTTCCTGCAAGAGAATGTCCTCTACATCCTGGCTGCTCGCCCCAACAGC

>In-frame_KDM4C_ENST00000442236_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_1017nt
ATGTGGAAGACCACGTTTGCATGGCACACCGAAGACATGGACCTCTATAGCATTAATTATCTCCACTTTGGAGAGCCCAAGTCTTGGTAT
GCTATACCTCCGGAGCATGGAAAACGACTTGAAAGACTAGCTCAAGGTTTTTTCCCAAGCAGCTCCCAAGGGTGTGATGCATTTCTTCGC
CACAAGATGACATTGATTTCTCCATCAGTATTGAAGAAATATGGTATTCCCTTTGACAAGATAACCCAGGAGGCTGGAGAATTCATGATC
ACTTTCCCATATGGCTACCATGCTGGTTTTAATCATGGTTTCAACTGTGCAGAATCTACAAATTTTGCTACTGTCAGATGGATTGACTAT
GGAAAAGTTGCCAAATTGGACAACATCAACTTGCTGCTTACTGAGGAGGAAATGTATAGCCTCACGGAGACCTTTCAGCGGTGTAAAGTC
ATCCCTGATTGCTCCCTGACACTGGAGGACTTTCTGCGTTACCGCCACCAAGCAGCCAAGCGGGGGGACCGTGACAGGGCCCTGAGTGAG
GAGCAAGAAGAGCAGGCGGCCCGCCAGTTTGCTGCCCTGGACCCTGAACATCGAGGCCACATAGAGTGGCCTGACTTCTTGTCCCATGAG
TCCCTCCTGCTTCTGCAGCAGTTGCGTCCCCAGAACTCTCTGTTGAGGCTTCTGACAGTGAAGGAGCGGGAGCGAGCCCGAGCCGCCTTC
CTGGCTCGGGGCAGTGGGAGCACCGTCAGTGAGGCAGAGTGCCGCCGGGCCCAGCACTCTTGGTTTTGCAAACGGTTCCCAGAGGCTCCT
TCCTGCAGTGTCAGCATCAGCCATGTGGGTCCCATCGCAGATAGCAGCCCAGCCAGCAGCAGCAGCAAGAGTCAGGACAAGACCCTGCTG
CCCACAGAGCAGGAGTCCAGATTTGTGGACTGGCCTACCTTCCTGCAAGAGAATGTCCTCTACATCCTGGCTGCTCGCCCCAACAGCGCA

>In-frame_KDM4C_ENST00000536108_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_1017nt
ATGTGGAAGACCACGTTTGCATGGCACACCGAAGACATGGACCTCTATAGCATTAATTATCTCCACTTTGGAGAGCCCAAGTCTTGGTAT
GCTATACCTCCGGAGCATGGAAAACGACTTGAAAGACTAGCTCAAGGTTTTTTCCCAAGCAGCTCCCAAGGGTGTGATGCATTTCTTCGC
CACAAGATGACATTGATTTCTCCATCAGTATTGAAGAAATATGGTATTCCCTTTGACAAGATAACCCAGGAGGCTGGAGAATTCATGATC
ACTTTCCCATATGGCTACCATGCTGGTTTTAATCATGGTTTCAACTGTGCAGAATCTACAAATTTTGCTACTGTCAGATGGATTGACTAT
GGAAAAGTTGCCAAATTGGACAACATCAACTTGCTGCTTACTGAGGAGGAAATGTATAGCCTCACGGAGACCTTTCAGCGGTGTAAAGTC
ATCCCTGATTGCTCCCTGACACTGGAGGACTTTCTGCGTTACCGCCACCAAGCAGCCAAGCGGGGGGACCGTGACAGGGCCCTGAGTGAG
GAGCAAGAAGAGCAGGCGGCCCGCCAGTTTGCTGCCCTGGACCCTGAACATCGAGGCCACATAGAGTGGCCTGACTTCTTGTCCCATGAG
TCCCTCCTGCTTCTGCAGCAGTTGCGTCCCCAGAACTCTCTGTTGAGGCTTCTGACAGTGAAGGAGCGGGAGCGAGCCCGAGCCGCCTTC
CTGGCTCGGGGCAGTGGGAGCACCGTCAGTGAGGCAGAGTGCCGCCGGGCCCAGCACTCTTGGTTTTGCAAACGGTTCCCAGAGGCTCCT
TCCTGCAGTGTCAGCATCAGCCATGTGGGTCCCATCGCAGATAGCAGCCCAGCCAGCAGCAGCAGCAAGAGTCAGGACAAGACCCTGCTG
CCCACAGAGCAGGAGTCCAGATTTGTGGACTGGCCTACCTTCCTGCAAGAGAATGTCCTCTACATCCTGGCTGCTCGCCCCAACAGCGCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_KDM4C_ENST00000535193_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_1798nt
ATGGCTGACATGATGGTCTGTGACCTGAAAGTTGTTGAATAGTTGGAGTGTTCTGCATTCATGTGGAAGAGGCTAAAGGATGTTTGATGA
AGCACTATGGGCTGCCCTGGAAGAGGACTGAAGAAGCAGCTGCAGACACTGCCCTAACCATCATGGAGGTGGCCGAGGTGGAAAGTCCTC
TGAACCCCAGCTGTAAGATAATGACCTTCAGACCCTCCATGGAGGAGTTCCGGGAGTTCAACAAATACCTTGCATACATGGAGTCTAAAG
GAGCCCATCGTGCGGGTCTTGCAAAGGTGATTCCTCCTAAGGAGTGGAAGCCAAGACAGTGCTATGATGACATTGATAATTTGCTCATTC
CAGCACCAATTCAGCAGATGGTCACAGGGCAGTCAGGACTGTTCACTCAGTACAACATCCAGAAAAAAGCGATGACTGTGAAGGAGTTCA
GGCAGCTGGCCAACAGTGGCAAATATTGTACTCCAAGATACTTGGATTACGAAGATTTGGAGCGCAAGTACTGGAAGAACTTAACTTTTG
TGGCACCTATCTATGGTGCAGATATTAATGGGAGCATATATGATGAGGGTGTGGATGAATGGAACATAGCTCGCCTCAATACAGTCTTGG
ATGTGGTTGAAGAAGAGTGTGGCATTTCTATTGAGGGTGTAAATACCCCATATCTCTATTTTGGCATGTGGAAGACCACGTTTGCATGGC
ACACCGAAGACATGGACCTCTATAGCATTAATTATCTCCACTTTGGAGAGCCCAAGTCTTGGTATGCTATACCTCCGGAGCATGGAAAAC
GACTTGAAAGACTAGCTCAAGGTTTTTTCCCAAGCAGCTCCCAAGGGTGTGATGCATTTCTTCGCCACAAGATGACATTGATTTCTCCAT
CAGTATTGAAGAAATATGGTATTCCCTTTGACAAGATAACCCAGGAGGCTGGAGAATTCATGATCACTTTCCCATATGGCTACCATGCTG
GTTTTAATCATGGTTTCAACTGTGCAGAATCTACAAATTTTGCTACTGTCAGATGGATTGACTATGGAAAAGTTGCCAAATTGGACAACA
TCAACTTGCTGCTTACTGAGGAGGAAATGTATAGCCTCACGGAGACCTTTCAGCGGTGTAAAGTCATCCCTGATTGCTCCCTGACACTGG
AGGACTTTCTGCGTTACCGCCACCAAGCAGCCAAGCGGGGGGACCGTGACAGGGCCCTGAGTGAGGAGCAAGAAGAGCAGGCGGCCCGCC
AGTTTGCTGCCCTGGACCCTGAACATCGAGGCCACATAGAGTGGCCTGACTTCTTGTCCCATGAGTCCCTCCTGCTTCTGCAGCAGTTGC
GTCCCCAGAACTCTCTGTTGAGGCTTCTGACAGTGAAGGAGCGGGAGCGAGCCCGAGCCGCCTTCCTGGCTCGGGGCAGTGGGAGCACCG
TCAGTGAGGCAGAGTGCCGCCGGGCCCAGCACTCTTGGTTTTGCAAACGGTTCCCAGAGGCTCCTTCCTGCAGTGTCAGCATCAGCCATG
TGGGTCCCATCGCAGATAGCAGCCCAGCCAGCAGCAGCAGCAAGAGTCAGGACAAGACCCTGCTGCCCACAGAGCAGGAGTCCAGATTTG
TGGACTGGCCTACCTTCCTGCAAGAGAATGTCCTCTACATCCTGGCTGCTCGCCCCAACAGCGCAGCCATTCACCTGAAGCCCCCAGGAT

>In-frame_KDM4C_ENST00000543771_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_2226nt
GCCATAGGTGCGCGTCGGCGCCCAGGAGGACGTGTGGCGCGTGGACTACATCAGGTCCAGCCCTGCGGGACCCCAGCCAGCGCTTCCGGG
CAAGGTTCTGTGCACCTGTTTTCTCCTTCTACGCGAGTATCTTTCCCCTCCGGAAAGAATGGGATATGCCTGTGTCCAAAGGACAAGAAG
ATGCGCGCCAGCAAGCCTAAGTTAACCACAGCGCGGAAGTTGAGCCCAAAGCAAGAGCGTGCCGGGCACCTTTAAGCTGTTTGTAAGCCC
ACGTGACTCACCAAGTGCGGGCCCCAGCGGTCACGTGACGGCGCGCGCGCCCTCGCGCAGGGAGAGCCGGCGGTGCGCGCGCCTTCGCCG
CTGCCTCCCACCCACCCCCTCGACGGGAGGGTGAGGCGCGGCGCAGTGATCGGGCGGCCGGGGTCCTGTGCGCGTGCGCAGCGAACAGCT
GTCACCTAGTGCGGAACAAGTCTCCCAAATTTCCCAAATCTCCCTGGGCCGGAGGCCACTGTCTTCTCTTCCTCCTCCACCGAGTCGTGC
TCTCGCCCCAACCCGCGCGCCAGACACTGCCCTAACCATCATGGAGGTGGCCGAGGTGGAAAGTCCTCTGAACCCCAGCTGTAAGATAAT
GACCTTCAGACCCTCCATGGAGGAGTTCCGGGAGTTCAACAAATACCTTGCATACATGGAGTCTAAAGGAGCCCATCGTGCGGGTCTTGC
AAAGGTGATTCCTCCTAAGGAGTGGAAGCCAAGACAGTGCTATGATGACATTGATAATTTGCTCATTCCAGCACCAATTCAGCAGATGGT
CACAGGGCAGTCAGGACTGTTCACTCAGTACAACATCCAGAAAAAAGCGATGACTGTGAAGGAGTTCAGGCAGCTGGCCAACAGTGGCAA
ATATTGTACTCCAAGATACTTGGATTACGAAGATTTGGAGCGCAAGTACTGGAAGAACTTAACTTTTGTGGCACCTATCTATGGTGCAGA
TATTAATGGGAGCATATATGATGAGGGTGTGGATGAATGGAACATAGCTCGCCTCAATACAGTCTTGGATGTGGTTGAAGAAGAGTGTGG
CATTTCTATTGAGGGTGTAAATACCCCATATCTCTATTTTGGCATGTGGAAGACCACGTTTGCATGGCACACCGAAGACATGGACCTCTA
TAGCATTAATTATCTCCACTTTGGAGAGCCCAAGTCTTGGTATGCTATACCTCCGGAGCATGGAAAACGACTTGAAAGACTAGCTCAAGG
TTTTTTCCCAAGCAGCTCCCAAGGGTGTGATGCATTTCTTCGCCACAAGATGACATTGATTTCTCCATCAGTATTGAAGAAATATGGTAT
TCCCTTTGACAAGATAACCCAGGAGGCTGGAGAATTCATGATCACTTTCCCATATGGCTACCATGCTGGTTTTAATCATGGTTTCAACTG
TGCAGAATCTACAAATTTTGCTACTGTCAGATGGATTGACTATGGAAAAGTTGCCAAATTGGACAACATCAACTTGCTGCTTACTGAGGA
GGAAATGTATAGCCTCACGGAGACCTTTCAGCGGTGTAAAGTCATCCCTGATTGCTCCCTGACACTGGAGGACTTTCTGCGTTACCGCCA
CCAAGCAGCCAAGCGGGGGGACCGTGACAGGGCCCTGAGTGAGGAGCAAGAAGAGCAGGCGGCCCGCCAGTTTGCTGCCCTGGACCCTGA
ACATCGAGGCCACATAGAGTGGCCTGACTTCTTGTCCCATGAGTCCCTCCTGCTTCTGCAGCAGTTGCGTCCCCAGAACTCTCTGTTGAG
GCTTCTGACAGTGAAGGAGCGGGAGCGAGCCCGAGCCGCCTTCCTGGCTCGGGGCAGTGGGAGCACCGTCAGTGAGGCAGAGTGCCGCCG
GGCCCAGCACTCTTGGTTTTGCAAACGGTTCCCAGAGGCTCCTTCCTGCAGTGTCAGCATCAGCCATGTGGGTCCCATCGCAGATAGCAG
CCCAGCCAGCAGCAGCAGCAAGAGTCAGGACAAGACCCTGCTGCCCACAGAGCAGGAGTCCAGATTTGTGGACTGGCCTACCTTCCTGCA
AGAGAATGTCCTCTACATCCTGGCTGCTCGCCCCAACAGCGCAGCCATTCACCTGAAGCCCCCAGGATAGCATGGAGCAGAGAAGCTCGG

>In-frame_KDM4C_ENST00000381306_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_2211nt
CGGCGCCCAGGAGGACGTGTGGCGCGTGGACTACATCAGGTCCAGCCCTGCGGGACCCCAGCCAGCGCTTCCGGGCAAGGTTCTGTGCAC
CTGTTTTCTCCTTCTACGCGAGTATCTTTCCCCTCCGGAAAGAATGGGATATGCCTGTGTCCAAAGGACAAGAAGATGCGCGCCAGCAAG
CCTAAGTTAACCACAGCGCGGAAGTTGAGCCCAAAGCAAGAGCGTGCCGGGCACCTTTAAGCTGTTTGTAAGCCCACGTGACTCACCAAG
TGCGGGCCCCAGCGGTCACGTGACGGCGCGCGCGCCCTCGCGCAGGGAGAGCCGGCGGTGCGCGCGCCTTCGCCGCTGCCTCCCACCCAC
CCCCTCGACGGGAGGGTGAGGCGCGGCGCAGTGATCGGGCGGCCGGGGTCCTGTGCGCGTGCGCAGCGAACAGCTGTCACCTAGTGCGGA
ACAAGTCTCCCAAATTTCCCAAATCTCCCTGGGCCGGAGGCCACTGTCTTCTCTTCCTCCTCCACCGAGTCGTGCTCTCGCCCCAACCCG
CGCGCCAGACACTGCCCTAACCATCATGGAGGTGGCCGAGGTGGAAAGTCCTCTGAACCCCAGCTGTAAGATAATGACCTTCAGACCCTC
CATGGAGGAGTTCCGGGAGTTCAACAAATACCTTGCATACATGGAGTCTAAAGGAGCCCATCGTGCGGGTCTTGCAAAGGTGATTCCTCC
TAAGGAGTGGAAGCCAAGACAGTGCTATGATGACATTGATAATTTGCTCATTCCAGCACCAATTCAGCAGATGGTCACAGGGCAGTCAGG
ACTGTTCACTCAGTACAACATCCAGAAAAAAGCGATGACTGTGAAGGAGTTCAGGCAGCTGGCCAACAGTGGCAAATATTGTACTCCAAG
ATACTTGGATTACGAAGATTTGGAGCGCAAGTACTGGAAGAACTTAACTTTTGTGGCACCTATCTATGGTGCAGATATTAATGGGAGCAT
ATATGATGAGGGTGTGGATGAATGGAACATAGCTCGCCTCAATACAGTCTTGGATGTGGTTGAAGAAGAGTGTGGCATTTCTATTGAGGG
TGTAAATACCCCATATCTCTATTTTGGCATGTGGAAGACCACGTTTGCATGGCACACCGAAGACATGGACCTCTATAGCATTAATTATCT
CCACTTTGGAGAGCCCAAGTCTTGGTATGCTATACCTCCGGAGCATGGAAAACGACTTGAAAGACTAGCTCAAGGTTTTTTCCCAAGCAG
CTCCCAAGGGTGTGATGCATTTCTTCGCCACAAGATGACATTGATTTCTCCATCAGTATTGAAGAAATATGGTATTCCCTTTGACAAGAT
AACCCAGGAGGCTGGAGAATTCATGATCACTTTCCCATATGGCTACCATGCTGGTTTTAATCATGGTTTCAACTGTGCAGAATCTACAAA
TTTTGCTACTGTCAGATGGATTGACTATGGAAAAGTTGCCAAATTGGACAACATCAACTTGCTGCTTACTGAGGAGGAAATGTATAGCCT
CACGGAGACCTTTCAGCGGTGTAAAGTCATCCCTGATTGCTCCCTGACACTGGAGGACTTTCTGCGTTACCGCCACCAAGCAGCCAAGCG
GGGGGACCGTGACAGGGCCCTGAGTGAGGAGCAAGAAGAGCAGGCGGCCCGCCAGTTTGCTGCCCTGGACCCTGAACATCGAGGCCACAT
AGAGTGGCCTGACTTCTTGTCCCATGAGTCCCTCCTGCTTCTGCAGCAGTTGCGTCCCCAGAACTCTCTGTTGAGGCTTCTGACAGTGAA
GGAGCGGGAGCGAGCCCGAGCCGCCTTCCTGGCTCGGGGCAGTGGGAGCACCGTCAGTGAGGCAGAGTGCCGCCGGGCCCAGCACTCTTG
GTTTTGCAAACGGTTCCCAGAGGCTCCTTCCTGCAGTGTCAGCATCAGCCATGTGGGTCCCATCGCAGATAGCAGCCCAGCCAGCAGCAG
CAGCAAGAGTCAGGACAAGACCCTGCTGCCCACAGAGCAGGAGTCCAGATTTGTGGACTGGCCTACCTTCCTGCAAGAGAATGTCCTCTA
CATCCTGGCTGCTCGCCCCAACAGCGCAGCCATTCACCTGAAGCCCCCAGGATAGCATGGAGCAGAGAAGCTCGGTTTGAGGACAGTGAC

>In-frame_KDM4C_ENST00000381309_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_2211nt
CGGCGCCCAGGAGGACGTGTGGCGCGTGGACTACATCAGGTCCAGCCCTGCGGGACCCCAGCCAGCGCTTCCGGGCAAGGTTCTGTGCAC
CTGTTTTCTCCTTCTACGCGAGTATCTTTCCCCTCCGGAAAGAATGGGATATGCCTGTGTCCAAAGGACAAGAAGATGCGCGCCAGCAAG
CCTAAGTTAACCACAGCGCGGAAGTTGAGCCCAAAGCAAGAGCGTGCCGGGCACCTTTAAGCTGTTTGTAAGCCCACGTGACTCACCAAG
TGCGGGCCCCAGCGGTCACGTGACGGCGCGCGCGCCCTCGCGCAGGGAGAGCCGGCGGTGCGCGCGCCTTCGCCGCTGCCTCCCACCCAC
CCCCTCGACGGGAGGGTGAGGCGCGGCGCAGTGATCGGGCGGCCGGGGTCCTGTGCGCGTGCGCAGCGAACAGCTGTCACCTAGTGCGGA
ACAAGTCTCCCAAATTTCCCAAATCTCCCTGGGCCGGAGGCCACTGTCTTCTCTTCCTCCTCCACCGAGTCGTGCTCTCGCCCCAACCCG
CGCGCCAGACACTGCCCTAACCATCATGGAGGTGGCCGAGGTGGAAAGTCCTCTGAACCCCAGCTGTAAGATAATGACCTTCAGACCCTC
CATGGAGGAGTTCCGGGAGTTCAACAAATACCTTGCATACATGGAGTCTAAAGGAGCCCATCGTGCGGGTCTTGCAAAGGTGATTCCTCC
TAAGGAGTGGAAGCCAAGACAGTGCTATGATGACATTGATAATTTGCTCATTCCAGCACCAATTCAGCAGATGGTCACAGGGCAGTCAGG
ACTGTTCACTCAGTACAACATCCAGAAAAAAGCGATGACTGTGAAGGAGTTCAGGCAGCTGGCCAACAGTGGCAAATATTGTACTCCAAG
ATACTTGGATTACGAAGATTTGGAGCGCAAGTACTGGAAGAACTTAACTTTTGTGGCACCTATCTATGGTGCAGATATTAATGGGAGCAT
ATATGATGAGGGTGTGGATGAATGGAACATAGCTCGCCTCAATACAGTCTTGGATGTGGTTGAAGAAGAGTGTGGCATTTCTATTGAGGG
TGTAAATACCCCATATCTCTATTTTGGCATGTGGAAGACCACGTTTGCATGGCACACCGAAGACATGGACCTCTATAGCATTAATTATCT
CCACTTTGGAGAGCCCAAGTCTTGGTATGCTATACCTCCGGAGCATGGAAAACGACTTGAAAGACTAGCTCAAGGTTTTTTCCCAAGCAG
CTCCCAAGGGTGTGATGCATTTCTTCGCCACAAGATGACATTGATTTCTCCATCAGTATTGAAGAAATATGGTATTCCCTTTGACAAGAT
AACCCAGGAGGCTGGAGAATTCATGATCACTTTCCCATATGGCTACCATGCTGGTTTTAATCATGGTTTCAACTGTGCAGAATCTACAAA
TTTTGCTACTGTCAGATGGATTGACTATGGAAAAGTTGCCAAATTGGACAACATCAACTTGCTGCTTACTGAGGAGGAAATGTATAGCCT
CACGGAGACCTTTCAGCGGTGTAAAGTCATCCCTGATTGCTCCCTGACACTGGAGGACTTTCTGCGTTACCGCCACCAAGCAGCCAAGCG
GGGGGACCGTGACAGGGCCCTGAGTGAGGAGCAAGAAGAGCAGGCGGCCCGCCAGTTTGCTGCCCTGGACCCTGAACATCGAGGCCACAT
AGAGTGGCCTGACTTCTTGTCCCATGAGTCCCTCCTGCTTCTGCAGCAGTTGCGTCCCCAGAACTCTCTGTTGAGGCTTCTGACAGTGAA
GGAGCGGGAGCGAGCCCGAGCCGCCTTCCTGGCTCGGGGCAGTGGGAGCACCGTCAGTGAGGCAGAGTGCCGCCGGGCCCAGCACTCTTG
GTTTTGCAAACGGTTCCCAGAGGCTCCTTCCTGCAGTGTCAGCATCAGCCATGTGGGTCCCATCGCAGATAGCAGCCCAGCCAGCAGCAG
CAGCAAGAGTCAGGACAAGACCCTGCTGCCCACAGAGCAGGAGTCCAGATTTGTGGACTGGCCTACCTTCCTGCAAGAGAATGTCCTCTA
CATCCTGGCTGCTCGCCCCAACAGCGCAGCCATTCACCTGAAGCCCCCAGGATAGCATGGAGCAGAGAAGCTCGGTTTGAGGACAGTGAC

>In-frame_KDM4C_ENST00000442236_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_1623nt
GTGCGCGTGCGCAGCGAACAGCTGTCACCTAGTGCGGAACAAGTCTCCCAAATTTCCCAAATCTCCCTGGGCCGGAGGCCACTGTCTTCT
CTTCCTCCTCCACCGAGTCGTGCTCTCGCCCCAACCCGCGCGCCAGACACTGCCCTAACCATCATGGAGGTGGCCGAGGTGGAAAGTCCT
CTGAACCCCAGCTGTAAGATAATGACCTTCAGACCCTCCATGGAGGAGTTCCGGGAGTTCAACAAATACCTTGCATACATGGAGTCTAAA
GGAGCCCATCGTGCGGGTCTTGCAAAGATATTGTACTCCAAGATACTTGGATTACGAAGATTTGGAGCGCAAGTACTGGAAGAACTTAAC
TTTTGTGGCACCTATCTATGGTGCAGATATTAATGGGAGCATATATGATGAGGGTGTGGATGAATGGAACATAGCTCGCCTCAATACAGT
CTTGGATGTGGTTGAAGAAGAGTGTGGCATTTCTATTGAGGGTGTAAATACCCCATATCTCTATTTTGGCATGTGGAAGACCACGTTTGC
ATGGCACACCGAAGACATGGACCTCTATAGCATTAATTATCTCCACTTTGGAGAGCCCAAGTCTTGGTATGCTATACCTCCGGAGCATGG
AAAACGACTTGAAAGACTAGCTCAAGGTTTTTTCCCAAGCAGCTCCCAAGGGTGTGATGCATTTCTTCGCCACAAGATGACATTGATTTC
TCCATCAGTATTGAAGAAATATGGTATTCCCTTTGACAAGATAACCCAGGAGGCTGGAGAATTCATGATCACTTTCCCATATGGCTACCA
TGCTGGTTTTAATCATGGTTTCAACTGTGCAGAATCTACAAATTTTGCTACTGTCAGATGGATTGACTATGGAAAAGTTGCCAAATTGGA
CAACATCAACTTGCTGCTTACTGAGGAGGAAATGTATAGCCTCACGGAGACCTTTCAGCGGTGTAAAGTCATCCCTGATTGCTCCCTGAC
ACTGGAGGACTTTCTGCGTTACCGCCACCAAGCAGCCAAGCGGGGGGACCGTGACAGGGCCCTGAGTGAGGAGCAAGAAGAGCAGGCGGC
CCGCCAGTTTGCTGCCCTGGACCCTGAACATCGAGGCCACATAGAGTGGCCTGACTTCTTGTCCCATGAGTCCCTCCTGCTTCTGCAGCA
GTTGCGTCCCCAGAACTCTCTGTTGAGGCTTCTGACAGTGAAGGAGCGGGAGCGAGCCCGAGCCGCCTTCCTGGCTCGGGGCAGTGGGAG
CACCGTCAGTGAGGCAGAGTGCCGCCGGGCCCAGCACTCTTGGTTTTGCAAACGGTTCCCAGAGGCTCCTTCCTGCAGTGTCAGCATCAG
CCATGTGGGTCCCATCGCAGATAGCAGCCCAGCCAGCAGCAGCAGCAAGAGTCAGGACAAGACCCTGCTGCCCACAGAGCAGGAGTCCAG
ATTTGTGGACTGGCCTACCTTCCTGCAAGAGAATGTCCTCTACATCCTGGCTGCTCGCCCCAACAGCGCAGCCATTCACCTGAAGCCCCC
AGGATAGCATGGAGCAGAGAAGCTCGGTTTGAGGACAGTGACATCCTCTCCCTCCTTTCCTTTCTCCCTTCCCCCACCAACCTCTGGCAC

>In-frame_KDM4C_ENST00000536108_chr9_6893232_+_KIAA1045_ENST00000544237_chr9_34976149_+_1634nt
AATTTCCCAAATCTCCCTGGGCCGGAGGCCACTGTCTTCTCTTCCTCCTCCACCGAGTCGTGCTCTCGCCCCAACCCGCGCGCCAGACAC
TGCCCTAACCATCATGGAGGTGGCCGAGGTGGAAAGTCCTCTGAACCCCAGCTGTAAGATAATGACCTTCAGACCCTCCATGGAGGAGTT
CCGGGAGTTCAACAAATACCTTGCATACATGGAGTCTAAAGGAGCCCATCGTGCGGGTCTTGCAAAGGTGATTCCTCCTAAGGAGTGGAA
GCCAAGACAGTGCTATGATGACATTGATAATTTGCTCATTCCAGCACCAATTCAGCAGATGGTCACAGGGCAGTCAGGACTGTTCACTCA
GTACAACATCCAGAAAAAAGCGATGACTGTGAAGGAGTTCAGGCAGCTGGCCAACAGTGGCAAGGTGTGGATGAATGGAACATAGCTCGC
CTCAATACAGTCTTGGATGTGGTTGAAGAAGAGTGTGGCATTTCTATTGAGGGTGTAAATACCCCATATCTCTATTTTGGCATGTGGAAG
ACCACGTTTGCATGGCACACCGAAGACATGGACCTCTATAGCATTAATTATCTCCACTTTGGAGAGCCCAAGTCTTGGTATGCTATACCT
CCGGAGCATGGAAAACGACTTGAAAGACTAGCTCAAGGTTTTTTCCCAAGCAGCTCCCAAGGGTGTGATGCATTTCTTCGCCACAAGATG
ACATTGATTTCTCCATCAGTATTGAAGAAATATGGTATTCCCTTTGACAAGATAACCCAGGAGGCTGGAGAATTCATGATCACTTTCCCA
TATGGCTACCATGCTGGTTTTAATCATGGTTTCAACTGTGCAGAATCTACAAATTTTGCTACTGTCAGATGGATTGACTATGGAAAAGTT
GCCAAATTGGACAACATCAACTTGCTGCTTACTGAGGAGGAAATGTATAGCCTCACGGAGACCTTTCAGCGGTGTAAAGTCATCCCTGAT
TGCTCCCTGACACTGGAGGACTTTCTGCGTTACCGCCACCAAGCAGCCAAGCGGGGGGACCGTGACAGGGCCCTGAGTGAGGAGCAAGAA
GAGCAGGCGGCCCGCCAGTTTGCTGCCCTGGACCCTGAACATCGAGGCCACATAGAGTGGCCTGACTTCTTGTCCCATGAGTCCCTCCTG
CTTCTGCAGCAGTTGCGTCCCCAGAACTCTCTGTTGAGGCTTCTGACAGTGAAGGAGCGGGAGCGAGCCCGAGCCGCCTTCCTGGCTCGG
GGCAGTGGGAGCACCGTCAGTGAGGCAGAGTGCCGCCGGGCCCAGCACTCTTGGTTTTGCAAACGGTTCCCAGAGGCTCCTTCCTGCAGT
GTCAGCATCAGCCATGTGGGTCCCATCGCAGATAGCAGCCCAGCCAGCAGCAGCAGCAAGAGTCAGGACAAGACCCTGCTGCCCACAGAG
CAGGAGTCCAGATTTGTGGACTGGCCTACCTTCCTGCAAGAGAATGTCCTCTACATCCTGGCTGCTCGCCCCAACAGCGCAGCCATTCAC
CTGAAGCCCCCAGGATAGCATGGAGCAGAGAAGCTCGGTTTGAGGACAGTGACATCCTCTCCCTCCTTTCCTTTCTCCCTTCCCCCACCA


Top

FusionGenePPI for KDM4C_KIAA1045


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KDM4CKDM4A, KDM4C, HIST1H3A, H3F3A, PPARG, HDAC1, HDAC3, HIST2H3C, SHMT2, MOV10, NXF1, TRIM25KIAA1045


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KDM4C_KIAA1045


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for KDM4C_KIAA1045


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKDM4CC0025149Medulloblastoma1CTD_human
HgeneKDM4CC0236663Alcohol withdrawal syndrome1PSYGENET