FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18340

FusionGeneSummary for KCNQ5_AMPH

check button Fusion gene summary
Fusion gene informationFusion gene name: KCNQ5_AMPH
Fusion gene ID: 18340
HgeneTgene
Gene symbol

KCNQ5

AMPH

Gene ID

56479

273

Gene namepotassium voltage-gated channel subfamily Q member 5amphiphysin
SynonymsKv7.5|MRD46AMPH1
Cytomap

6q13

7p14.1

Type of geneprotein-codingprotein-coding
Descriptionpotassium voltage-gated channel subfamily KQT member 5KQT-like 5potassium channel proteinpotassium channel subunit alpha KvLQT5potassium channel, voltage gated KQT-like subfamily Q, member 5voltage-gated potassium channel subunit Kv7.5amphiphysinamphiphysin (Stiff-Mann syndrome with breast cancer 128kD autoantigen)amphiphysin I
Modification date2018052320180522
UniProtAcc

Q9NR82

P49418

Ensembl transtripts involved in fusion geneENST00000342056, ENST00000355194, 
ENST00000370398, ENST00000370392, 
ENST00000355635, ENST00000414165, 
ENST00000402622, ENST00000403813, 
ENST00000325590, ENST00000356264, 
ENST00000428293, ENST00000471913, 
Fusion gene scores* DoF score6 X 5 X 4=1203 X 2 X 3=18
# samples 63
** MAII scorelog2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: KCNQ5 [Title/Abstract] AND AMPH [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneKCNQ5

GO:0071805

potassium ion transmembrane transport

10787416|11159685


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-85-8354-01AKCNQ5chr6

73815090

+AMPHchr7

38433814

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000342056ENST00000325590KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000342056ENST00000356264KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000342056ENST00000428293KCNQ5chr6

73815090

+AMPHchr7

38433814

-
5CDS-5UTRENST00000342056ENST00000471913KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000355194ENST00000325590KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000355194ENST00000356264KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000355194ENST00000428293KCNQ5chr6

73815090

+AMPHchr7

38433814

-
5CDS-5UTRENST00000355194ENST00000471913KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000370398ENST00000325590KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000370398ENST00000356264KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000370398ENST00000428293KCNQ5chr6

73815090

+AMPHchr7

38433814

-
5CDS-5UTRENST00000370398ENST00000471913KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000370392ENST00000325590KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000370392ENST00000356264KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000370392ENST00000428293KCNQ5chr6

73815090

+AMPHchr7

38433814

-
5CDS-5UTRENST00000370392ENST00000471913KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000355635ENST00000325590KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000355635ENST00000356264KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000355635ENST00000428293KCNQ5chr6

73815090

+AMPHchr7

38433814

-
5CDS-5UTRENST00000355635ENST00000471913KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000414165ENST00000325590KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000414165ENST00000356264KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000414165ENST00000428293KCNQ5chr6

73815090

+AMPHchr7

38433814

-
5CDS-5UTRENST00000414165ENST00000471913KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000402622ENST00000325590KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000402622ENST00000356264KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000402622ENST00000428293KCNQ5chr6

73815090

+AMPHchr7

38433814

-
5CDS-5UTRENST00000402622ENST00000471913KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000403813ENST00000325590KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000403813ENST00000356264KCNQ5chr6

73815090

+AMPHchr7

38433814

-
In-frameENST00000403813ENST00000428293KCNQ5chr6

73815090

+AMPHchr7

38433814

-
5CDS-5UTRENST00000403813ENST00000471913KCNQ5chr6

73815090

+AMPHchr7

38433814

-

Top

FusionProtFeatures for KCNQ5_AMPH


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KCNQ5

Q9NR82

AMPH

P49418

May participate in mechanisms of regulated exocytosis insynapses and certain endocrine cell types. May control theproperties of the membrane associated cytoskeleton.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69299_319343428IntramembranePore-forming%3B Name%3DSegment H5
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614299_319343933IntramembranePore-forming%3B Name%3DSegment H5
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614299_319343943IntramembranePore-forming%3B Name%3DSegment H5
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613299_319343924IntramembranePore-forming%3B Name%3DSegment H5
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612299_319343823IntramembranePore-forming%3B Name%3DSegment H5
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69311_316343428MotifSelectivity filter
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614311_316343933MotifSelectivity filter
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614311_316343943MotifSelectivity filter
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613311_316343924MotifSelectivity filter
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612311_316343823MotifSelectivity filter
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69147_156343428Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69178_200343428Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+691_125343428Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69222_229343428Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69253_266343428Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69288_298343428Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69320_325343428Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614147_156343933Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614178_200343933Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+6141_125343933Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614222_229343933Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614253_266343933Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614288_298343933Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614320_325343933Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614147_156343943Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614178_200343943Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+6141_125343943Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614222_229343943Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614253_266343943Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614288_298343943Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614320_325343943Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613147_156343924Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613178_200343924Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+6131_125343924Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613222_229343924Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613253_266343924Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613288_298343924Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613320_325343924Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612147_156343823Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612178_200343823Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+6121_125343823Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612222_229343823Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612253_266343823Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612288_298343823Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612320_325343823Topological domainExtracellular
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69126_146343428TransmembraneHelical%3B Name%3DSegment S1
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69157_177343428TransmembraneHelical%3B Name%3DSegment S2
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69201_221343428TransmembraneHelical%3B Name%3DSegment S3
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69230_252343428TransmembraneHelical%3B Voltage-sensor%3B Name%3DSegment S4
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69267_287343428TransmembraneHelical%3B Name%3DSegment S5
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69326_346343428TransmembraneHelical%3B Name%3DSegment S6
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614126_146343933TransmembraneHelical%3B Name%3DSegment S1
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614157_177343933TransmembraneHelical%3B Name%3DSegment S2
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614201_221343933TransmembraneHelical%3B Name%3DSegment S3
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614230_252343933TransmembraneHelical%3B Voltage-sensor%3B Name%3DSegment S4
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614267_287343933TransmembraneHelical%3B Name%3DSegment S5
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614326_346343933TransmembraneHelical%3B Name%3DSegment S6
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614126_146343943TransmembraneHelical%3B Name%3DSegment S1
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614157_177343943TransmembraneHelical%3B Name%3DSegment S2
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614201_221343943TransmembraneHelical%3B Name%3DSegment S3
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614230_252343943TransmembraneHelical%3B Voltage-sensor%3B Name%3DSegment S4
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614267_287343943TransmembraneHelical%3B Name%3DSegment S5
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614326_346343943TransmembraneHelical%3B Name%3DSegment S6
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613126_146343924TransmembraneHelical%3B Name%3DSegment S1
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613157_177343924TransmembraneHelical%3B Name%3DSegment S2
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613201_221343924TransmembraneHelical%3B Name%3DSegment S3
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613230_252343924TransmembraneHelical%3B Voltage-sensor%3B Name%3DSegment S4
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613267_287343924TransmembraneHelical%3B Name%3DSegment S5
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613326_346343924TransmembraneHelical%3B Name%3DSegment S6
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612126_146343823TransmembraneHelical%3B Name%3DSegment S1
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612157_177343823TransmembraneHelical%3B Name%3DSegment S2
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612201_221343823TransmembraneHelical%3B Name%3DSegment S3
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612230_252343823TransmembraneHelical%3B Voltage-sensor%3B Name%3DSegment S4
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612267_287343823TransmembraneHelical%3B Name%3DSegment S5
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612326_346343823TransmembraneHelical%3B Name%3DSegment S6
TgeneAMPHchr6:73815090chr7:38433814ENST00000325590-1520622_695424654DomainSH3
TgeneAMPHchr6:73815090chr7:38433814ENST00000356264-1621622_695466696DomainSH3

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370392+69347_932343428Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000370398+614347_932343933Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000402622+614347_932343943Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000403813+613347_932343924Topological domainCytoplasmic
HgeneKCNQ5chr6:73815090chr7:38433814ENST00000414165+612347_932343823Topological domainCytoplasmic
TgeneAMPHchr6:73815090chr7:38433814ENST00000325590-152010_83424654Coiled coilOntology_term=ECO:0000255
TgeneAMPHchr6:73815090chr7:38433814ENST00000325590-1520144_191424654Coiled coilOntology_term=ECO:0000255
TgeneAMPHchr6:73815090chr7:38433814ENST00000356264-162110_83466696Coiled coilOntology_term=ECO:0000255
TgeneAMPHchr6:73815090chr7:38433814ENST00000356264-1621144_191466696Coiled coilOntology_term=ECO:0000255
TgeneAMPHchr6:73815090chr7:38433814ENST00000325590-152024_240424654DomainBAR
TgeneAMPHchr6:73815090chr7:38433814ENST00000356264-162124_240466696DomainBAR


Top

FusionGeneSequence for KCNQ5_AMPH


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KCNQ5_ENST00000342056_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000342056_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000342056_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000355194_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLPVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000355194_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLPVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000355194_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLPVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000370398_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000370398_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000370398_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000370392_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000370392_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000370392_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000355635_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000355635_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000355635_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000414165_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000414165_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000414165_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000402622_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000402622_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000402622_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000403813_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000403813_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG

>In-frame_KCNQ5_ENST00000403813_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_573aa
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGGGGGGLRESRRGKQGARMSLL
GKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRTRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVTAHSKELITAW
YIGFLVLIFSSFLVTLVEKDANKEFSTTADALWWGTITLTTIGTGDKTPLTWLGRLLSAGFALLGISFFALPAIIPGADADAAVGTLVSA
AEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVIPSVVIEPASNHEEEGENEITIGAEPKETTEDAA
PPGPTSETPELATEQKPIQDPQPTPSAPAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KCNQ5_ENST00000342056_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000342056_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000342056_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000355194_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCCTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000355194_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCCTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000355194_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCCTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000370398_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000370398_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000370398_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000370392_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000370392_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000370392_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000355635_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000355635_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000355635_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000414165_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000414165_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000414165_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000402622_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000402622_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000402622_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000403813_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000403813_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC

>In-frame_KCNQ5_ENST00000403813_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_1719nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_KCNQ5_ENST00000342056_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_3231nt
GGCTGGGTGTGCGCGCGTGGGAGCGCGCCTCGGAGCGCCCCGCACTCCCCCACTCTATCCCCGGGGGCAGTTTGGGAAGGAGGGAGTGGT
AGTCGCGGGAATGAGGGAGCAAGAGAAACCCTCTCAAAGTGACGCCCCAAACAGGTCCGGATTTAGAATTCGAAGCTAAAGGCTGTTAGA
AATTGGGACTCCTCGGCCTCCTCTGCAGCCCCTCCTTTCCCGCCCCGAAGCCCGGGCGGTTTGCTGGCTGCCTGCTTCCCCGCCCCCGGC
TCAGAGGTCTCTGGCTGGCGGGCGCCCCGTCGGCCGCCGGCTTCCTCCTTGAAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCA
GGCGCTGGCGGCCCCCTCGCGGTGCCCGTGGTGATGCCATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGG
TGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGGCGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGC
TGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTGCTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGA
GCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTGGGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGT
ACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAGAGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCT
TTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCTGAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGA
TTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGGTCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTG
CTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTTATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCA
CGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTCCGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAG
TGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGGTACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGG
AAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGATGCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAA
CTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGCTTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAG
CTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCAGCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTG
CCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGAACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCG
AAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTGGTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTA
TAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCTCCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTA
TCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATGGGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTC
CTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTTGAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGG
TGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGCTGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCA
CCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGCTTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTA
AACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATTATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTAT
CAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAAAAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGT
TTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTACTTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAAT
TTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCTGCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGC
CCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTTACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACA
CATCTATATATATATGGACACACAGTCACGCAAGCTAGTTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTT
GCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAATTGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTT
TTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAGAGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGA
TAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGGGCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGG
ATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAGATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAA
AACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGCAACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATC

>In-frame_KCNQ5_ENST00000342056_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_3231nt
GGCTGGGTGTGCGCGCGTGGGAGCGCGCCTCGGAGCGCCCCGCACTCCCCCACTCTATCCCCGGGGGCAGTTTGGGAAGGAGGGAGTGGT
AGTCGCGGGAATGAGGGAGCAAGAGAAACCCTCTCAAAGTGACGCCCCAAACAGGTCCGGATTTAGAATTCGAAGCTAAAGGCTGTTAGA
AATTGGGACTCCTCGGCCTCCTCTGCAGCCCCTCCTTTCCCGCCCCGAAGCCCGGGCGGTTTGCTGGCTGCCTGCTTCCCCGCCCCCGGC
TCAGAGGTCTCTGGCTGGCGGGCGCCCCGTCGGCCGCCGGCTTCCTCCTTGAAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCA
GGCGCTGGCGGCCCCCTCGCGGTGCCCGTGGTGATGCCATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGG
TGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGGCGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGC
TGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTGCTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGA
GCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTGGGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGT
ACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAGAGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCT
TTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCTGAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGA
TTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGGTCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTG
CTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTTATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCA
CGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTCCGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAG
TGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGGTACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGG
AAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGATGCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAA
CTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGCTTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAG
CTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCAGCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTG
CCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGAACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCG
AAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTGGTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTA
TAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCTCCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTA
TCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATGGGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTC
CTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTTGAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGG
TGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGCTGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCA
CCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGCTTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTA
AACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATTATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTAT
CAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAAAAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGT
TTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTACTTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAAT
TTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCTGCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGC
CCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTTACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACA
CATCTATATATATATGGACACACAGTCACGCAAGCTAGTTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTT
GCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAATTGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTT
TTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAGAGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGA
TAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGGGCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGG
ATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAGATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAA
AACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGCAACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATC

>In-frame_KCNQ5_ENST00000342056_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_3229nt
GGCTGGGTGTGCGCGCGTGGGAGCGCGCCTCGGAGCGCCCCGCACTCCCCCACTCTATCCCCGGGGGCAGTTTGGGAAGGAGGGAGTGGT
AGTCGCGGGAATGAGGGAGCAAGAGAAACCCTCTCAAAGTGACGCCCCAAACAGGTCCGGATTTAGAATTCGAAGCTAAAGGCTGTTAGA
AATTGGGACTCCTCGGCCTCCTCTGCAGCCCCTCCTTTCCCGCCCCGAAGCCCGGGCGGTTTGCTGGCTGCCTGCTTCCCCGCCCCCGGC
TCAGAGGTCTCTGGCTGGCGGGCGCCCCGTCGGCCGCCGGCTTCCTCCTTGAAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCA
GGCGCTGGCGGCCCCCTCGCGGTGCCCGTGGTGATGCCATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGG
TGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGGCGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGC
TGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTGCTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGA
GCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTGGGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGT
ACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAGAGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCT
TTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCTGAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGA
TTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGGTCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTG
CTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTTATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCA
CGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTCCGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAG
TGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGGTACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGG
AAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGATGCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAA
CTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGCTTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAG
CTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCAGCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTG
CCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGAACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCG
AAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTGGTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTA
TAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCTCCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTA
TCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATGGGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTC
CTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTTGAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGG
TGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGCTGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCA
CCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGCTTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTA
AACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATTATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTAT
CAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAAAAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGT
TTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTACTTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAAT
TTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCTGCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGC
CCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTTACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACA
CATCTATATATATATGGACACACAGTCACGCAAGCTAGTTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTT
GCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAATTGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTT
TTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAGAGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGA
TAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGGGCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGG
ATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAGATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAA
AACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGCAACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATC

>In-frame_KCNQ5_ENST00000355194_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_3180nt
ACTCTATCCCCGGGGGCAGTTTGGGAAGGAGGGAGTGGTAGTCGCGGGAATGAGGGAGCAAGAGAAACCCTCTCAAAGTGACGCCCCAAA
CAGGTCCGGATTTAGAATTCGAAGCTAAAGGCTGTTAGAAATTGGGACTCCTCGGCCTCCTCTGCAGCCCCTCCTTTCCCGCCCCGAAGC
CCGGGCGGTTTGCTGGCTGCCTGCTTCCCCGCCCCCGGCTCAGAGGTCTCTGGCTGGCGGGCGCCCCGTCGGCCGCCGGCTTCCTCCTTG
AAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCAGGCGCTGGCGGCCCCCTCGCGGTGCCCGTGGTGATGCCATGCCCCGCCACC
ACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGGCGCTTGGGCAGCG
GCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTGCTGGGCACCCGCG
CGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTGGGGAAGCCGCTCT
CTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAGAGACCCCGCGGCT
GGGCGTTCATCTACCACGCTTTCGTTTTTCTCCCTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCTGAGCACACAAAAT
TGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGGTCTGCGGGTTGCT
GTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTTATCGCTTCAATAG
CAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTCCGCATGGTGCGCA
TGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGGTACATAGGATTTT
TGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGATGCTCTCTGGTGGG
GCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGCTTTGCACTCCTTG
GCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCAGCTGAGGGGGCCC
CAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGAACTGAAACCACTG
AGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTGGTCATAGAGCCTG
CCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCTCCTCCGGGCCCCA
CCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATGGGGGCTGCTGACC
AGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTTGAGGCAGCAAATT
CTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGCTGGCTGGTGGGAG
TGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGCTTAGATTAGGGCA
ACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATTATGCTCTTAATGA
TTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAAAAGTAAATTAAGG
AAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTACTTGATCCCCTCCC
ACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCTGCAGAAGATGTGA
TGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTTACTATGTTTAAAA
CTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAGTTCCCATGACTCC
TGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAATTGTCATTGATACA
TGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAGAGTCAACAGTATC
TGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGGGCCTGATTTATCT
AGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAGATTGGGTAGAAAG
ATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGCAACTCATCTTCAC
AGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTGTCATTCCAAATAA

>In-frame_KCNQ5_ENST00000355194_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_3180nt
ACTCTATCCCCGGGGGCAGTTTGGGAAGGAGGGAGTGGTAGTCGCGGGAATGAGGGAGCAAGAGAAACCCTCTCAAAGTGACGCCCCAAA
CAGGTCCGGATTTAGAATTCGAAGCTAAAGGCTGTTAGAAATTGGGACTCCTCGGCCTCCTCTGCAGCCCCTCCTTTCCCGCCCCGAAGC
CCGGGCGGTTTGCTGGCTGCCTGCTTCCCCGCCCCCGGCTCAGAGGTCTCTGGCTGGCGGGCGCCCCGTCGGCCGCCGGCTTCCTCCTTG
AAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCAGGCGCTGGCGGCCCCCTCGCGGTGCCCGTGGTGATGCCATGCCCCGCCACC
ACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGGCGCTTGGGCAGCG
GCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTGCTGGGCACCCGCG
CGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTGGGGAAGCCGCTCT
CTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAGAGACCCCGCGGCT
GGGCGTTCATCTACCACGCTTTCGTTTTTCTCCCTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCTGAGCACACAAAAT
TGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGGTCTGCGGGTTGCT
GTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTTATCGCTTCAATAG
CAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTCCGCATGGTGCGCA
TGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGGTACATAGGATTTT
TGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGATGCTCTCTGGTGGG
GCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGCTTTGCACTCCTTG
GCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCAGCTGAGGGGGCCC
CAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGAACTGAAACCACTG
AGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTGGTCATAGAGCCTG
CCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCTCCTCCGGGCCCCA
CCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATGGGGGCTGCTGACC
AGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTTGAGGCAGCAAATT
CTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGCTGGCTGGTGGGAG
TGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGCTTAGATTAGGGCA
ACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATTATGCTCTTAATGA
TTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAAAAGTAAATTAAGG
AAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTACTTGATCCCCTCCC
ACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCTGCAGAAGATGTGA
TGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTTACTATGTTTAAAA
CTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAGTTCCCATGACTCC
TGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAATTGTCATTGATACA
TGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAGAGTCAACAGTATC
TGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGGGCCTGATTTATCT
AGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAGATTGGGTAGAAAG
ATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGCAACTCATCTTCAC
AGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTGTCATTCCAAATAA

>In-frame_KCNQ5_ENST00000355194_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_3178nt
ACTCTATCCCCGGGGGCAGTTTGGGAAGGAGGGAGTGGTAGTCGCGGGAATGAGGGAGCAAGAGAAACCCTCTCAAAGTGACGCCCCAAA
CAGGTCCGGATTTAGAATTCGAAGCTAAAGGCTGTTAGAAATTGGGACTCCTCGGCCTCCTCTGCAGCCCCTCCTTTCCCGCCCCGAAGC
CCGGGCGGTTTGCTGGCTGCCTGCTTCCCCGCCCCCGGCTCAGAGGTCTCTGGCTGGCGGGCGCCCCGTCGGCCGCCGGCTTCCTCCTTG
AAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCAGGCGCTGGCGGCCCCCTCGCGGTGCCCGTGGTGATGCCATGCCCCGCCACC
ACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGGCGCTTGGGCAGCG
GCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTGCTGGGCACCCGCG
CGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTGGGGAAGCCGCTCT
CTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAGAGACCCCGCGGCT
GGGCGTTCATCTACCACGCTTTCGTTTTTCTCCCTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCTGAGCACACAAAAT
TGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGGTCTGCGGGTTGCT
GTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTTATCGCTTCAATAG
CAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTCCGCATGGTGCGCA
TGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGGTACATAGGATTTT
TGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGATGCTCTCTGGTGGG
GCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGCTTTGCACTCCTTG
GCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCAGCTGAGGGGGCCC
CAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGAACTGAAACCACTG
AGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTGGTCATAGAGCCTG
CCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCTCCTCCGGGCCCCA
CCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATGGGGGCTGCTGACC
AGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTTGAGGCAGCAAATT
CTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGCTGGCTGGTGGGAG
TGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGCTTAGATTAGGGCA
ACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATTATGCTCTTAATGA
TTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAAAAGTAAATTAAGG
AAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTACTTGATCCCCTCCC
ACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCTGCAGAAGATGTGA
TGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTTACTATGTTTAAAA
CTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAGTTCCCATGACTCC
TGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAATTGTCATTGATACA
TGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAGAGTCAACAGTATC
TGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGGGCCTGATTTATCT
AGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAGATTGGGTAGAAAG
ATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGCAACTCATCTTCAC
AGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTGTCATTCCAAATAA

>In-frame_KCNQ5_ENST00000370398_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_2942nt
GGGCGCCCCGTCGGCCGCCGGCTTCCTCCTTGAAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCAGGCGCTGGCGGCCCCCTCG
CGGTGCCCGTGGTGATGCCATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGC
GGCGGCGGCGGGCGGGGGGCGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAG
GGGCGACGGCCTGCTACTGCTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGG
GGCCCGGATGAGCCTGCTGGGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTA
CCTGTACAACGTGCTGGAGAGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTC
AGTGTTTTCTACCATCCCTGAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGA
GTTCATCATTCGAATCTGGTCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGT
TATAGATACCATTGTTCTTATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCT
CCGTTTCCTACAGATCCTCCGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAA
GGAATTAATCACAGCTTGGTACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGA
GTTTTCTACATATGCAGATGCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGG
AAGATTGCTTTCTGCAGGCTTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGT
TGGAACCTTGGTGTCAGCAGCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTT
AGAGGAGGCCAAAATTGGAACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGA
GAAGGTCATTCCTTCGGTGGTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGA
GACCACCGAGGACGCGGCTCCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCAC
GCCTTCTGCACCAGCCATGGGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGT
GGAAACACTGCATGATTTTGAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGA
AGCTGATCAGGATGCAGGCTGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCC
AGAGAACTTCACCCGACGCTTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGA
AGAGTTCACTTTTGTTATTATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAA
AAAAATGTAAGAGGAAAAAAAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAA
GCTGTGGAGACTCTTGTACTTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTAT
CGTATTGAGTGGCTGCCCTGCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCT
CTCGCTCCCTTTCAGGTTTACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGAC
ACACAGTCACGCAAGCTAGTTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTG
TAGCTCTTTGCCTCTCAATTGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCA
GCCATCCCATTGGCAAAAGAGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGG
CACCCTCAGAGAAGGCAGGGCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCT
TCTCTTCTGCCTTTATGAGATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTC
CACCTCTTTCTATTTATGCAACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAA

>In-frame_KCNQ5_ENST00000370398_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_2942nt
GGGCGCCCCGTCGGCCGCCGGCTTCCTCCTTGAAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCAGGCGCTGGCGGCCCCCTCG
CGGTGCCCGTGGTGATGCCATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGC
GGCGGCGGCGGGCGGGGGGCGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAG
GGGCGACGGCCTGCTACTGCTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGG
GGCCCGGATGAGCCTGCTGGGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTA
CCTGTACAACGTGCTGGAGAGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTC
AGTGTTTTCTACCATCCCTGAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGA
GTTCATCATTCGAATCTGGTCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGT
TATAGATACCATTGTTCTTATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCT
CCGTTTCCTACAGATCCTCCGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAA
GGAATTAATCACAGCTTGGTACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGA
GTTTTCTACATATGCAGATGCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGG
AAGATTGCTTTCTGCAGGCTTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGT
TGGAACCTTGGTGTCAGCAGCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTT
AGAGGAGGCCAAAATTGGAACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGA
GAAGGTCATTCCTTCGGTGGTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGA
GACCACCGAGGACGCGGCTCCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCAC
GCCTTCTGCACCAGCCATGGGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGT
GGAAACACTGCATGATTTTGAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGA
AGCTGATCAGGATGCAGGCTGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCC
AGAGAACTTCACCCGACGCTTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGA
AGAGTTCACTTTTGTTATTATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAA
AAAAATGTAAGAGGAAAAAAAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAA
GCTGTGGAGACTCTTGTACTTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTAT
CGTATTGAGTGGCTGCCCTGCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCT
CTCGCTCCCTTTCAGGTTTACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGAC
ACACAGTCACGCAAGCTAGTTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTG
TAGCTCTTTGCCTCTCAATTGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCA
GCCATCCCATTGGCAAAAGAGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGG
CACCCTCAGAGAAGGCAGGGCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCT
TCTCTTCTGCCTTTATGAGATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTC
CACCTCTTTCTATTTATGCAACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAA

>In-frame_KCNQ5_ENST00000370398_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_2940nt
GGGCGCCCCGTCGGCCGCCGGCTTCCTCCTTGAAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCAGGCGCTGGCGGCCCCCTCG
CGGTGCCCGTGGTGATGCCATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGC
GGCGGCGGCGGGCGGGGGGCGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAG
GGGCGACGGCCTGCTACTGCTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGG
GGCCCGGATGAGCCTGCTGGGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTA
CCTGTACAACGTGCTGGAGAGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTC
AGTGTTTTCTACCATCCCTGAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGA
GTTCATCATTCGAATCTGGTCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGT
TATAGATACCATTGTTCTTATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCT
CCGTTTCCTACAGATCCTCCGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAA
GGAATTAATCACAGCTTGGTACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGA
GTTTTCTACATATGCAGATGCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGG
AAGATTGCTTTCTGCAGGCTTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGT
TGGAACCTTGGTGTCAGCAGCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTT
AGAGGAGGCCAAAATTGGAACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGA
GAAGGTCATTCCTTCGGTGGTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGA
GACCACCGAGGACGCGGCTCCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCAC
GCCTTCTGCACCAGCCATGGGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGT
GGAAACACTGCATGATTTTGAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGA
AGCTGATCAGGATGCAGGCTGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCC
AGAGAACTTCACCCGACGCTTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGA
AGAGTTCACTTTTGTTATTATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAA
AAAAATGTAAGAGGAAAAAAAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAA
GCTGTGGAGACTCTTGTACTTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTAT
CGTATTGAGTGGCTGCCCTGCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCT
CTCGCTCCCTTTCAGGTTTACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGAC
ACACAGTCACGCAAGCTAGTTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTG
TAGCTCTTTGCCTCTCAATTGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCA
GCCATCCCATTGGCAAAAGAGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGG
CACCCTCAGAGAAGGCAGGGCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCT
TCTCTTCTGCCTTTATGAGATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTC
CACCTCTTTCTATTTATGCAACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAA

>In-frame_KCNQ5_ENST00000370392_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_2917nt
CTCCTTGAAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCAGGCGCTGGCGGCCCCCTCGCGGTGCCCGTGGTGATGCCATGCCC
CGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGGCGCTTG
GGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTGCTGGGC
ACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTGGGGAAG
CCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAGAGACCC
CGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCTGAGCAC
ACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGGTCTGCG
GGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTTATCGCT
TCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTCCGCATG
GTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGGTACATA
GGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGATGCTCTC
TGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGCTTTGCA
CTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCAGCTGAG
GGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGAACTGAA
ACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTGGTCATA
GAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCTCCTCCG
GGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATGGGGGCT
GCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTTGAGGCA
GCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGCTGGCTG
GTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGCTTAGAT
TAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATTATGCTC
TTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAAAAGTAA
ATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTACTTGATC
CCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCTGCAGAA
GATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTTACTATG
TTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAGTTCCCA
TGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAATTGTCAT
TGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAGAGTCAA
CAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGGGCCTGA
TTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAGATTGGG
TAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGCAACTCA
TCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTGTCATTC

>In-frame_KCNQ5_ENST00000370392_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_2917nt
CTCCTTGAAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCAGGCGCTGGCGGCCCCCTCGCGGTGCCCGTGGTGATGCCATGCCC
CGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGGCGCTTG
GGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTGCTGGGC
ACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTGGGGAAG
CCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAGAGACCC
CGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCTGAGCAC
ACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGGTCTGCG
GGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTTATCGCT
TCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTCCGCATG
GTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGGTACATA
GGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGATGCTCTC
TGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGCTTTGCA
CTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCAGCTGAG
GGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGAACTGAA
ACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTGGTCATA
GAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCTCCTCCG
GGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATGGGGGCT
GCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTTGAGGCA
GCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGCTGGCTG
GTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGCTTAGAT
TAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATTATGCTC
TTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAAAAGTAA
ATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTACTTGATC
CCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCTGCAGAA
GATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTTACTATG
TTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAGTTCCCA
TGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAATTGTCAT
TGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAGAGTCAA
CAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGGGCCTGA
TTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAGATTGGG
TAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGCAACTCA
TCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTGTCATTC

>In-frame_KCNQ5_ENST00000370392_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_2915nt
CTCCTTGAAACCCGCCGGCGCACATGAGGCCGCTGCCCCCGCCGCAGGCGCTGGCGGCCCCCTCGCGGTGCCCGTGGTGATGCCATGCCC
CGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGGCGCTTG
GGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTGCTGGGC
ACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTGGGGAAG
CCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAGAGACCC
CGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCTGAGCAC
ACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGGTCTGCG
GGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTTATCGCT
TCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTCCGCATG
GTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGGTACATA
GGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGATGCTCTC
TGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGCTTTGCA
CTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCAGCTGAG
GGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGAACTGAA
ACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTGGTCATA
GAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCTCCTCCG
GGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATGGGGGCT
GCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTTGAGGCA
GCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGCTGGCTG
GTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGCTTAGAT
TAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATTATGCTC
TTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAAAAGTAA
ATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTACTTGATC
CCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCTGCAGAA
GATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTTACTATG
TTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAGTTCCCA
TGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAATTGTCAT
TGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAGAGTCAA
CAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGGGCCTGA
TTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAGATTGGG
TAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGCAACTCA
TCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTGTCATTC

>In-frame_KCNQ5_ENST00000355635_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_2833nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC
TTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATT
ATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAA
AAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTAC
TTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCT
GCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTT
ACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAG
TTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAAT
TGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAG
AGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGG
GCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAG
ATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGC
AACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTG

>In-frame_KCNQ5_ENST00000355635_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_2833nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC
TTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATT
ATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAA
AAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTAC
TTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCT
GCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTT
ACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAG
TTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAAT
TGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAG
AGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGG
GCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAG
ATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGC
AACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTG

>In-frame_KCNQ5_ENST00000355635_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_2831nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC
TTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATT
ATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAA
AAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTAC
TTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCT
GCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTT
ACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAG
TTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAAT
TGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAG
AGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGG
GCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAG
ATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGC
AACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTG

>In-frame_KCNQ5_ENST00000414165_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_2833nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC
TTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATT
ATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAA
AAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTAC
TTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCT
GCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTT
ACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAG
TTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAAT
TGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAG
AGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGG
GCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAG
ATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGC
AACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTG

>In-frame_KCNQ5_ENST00000414165_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_2833nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC
TTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATT
ATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAA
AAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTAC
TTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCT
GCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTT
ACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAG
TTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAAT
TGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAG
AGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGG
GCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAG
ATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGC
AACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTG

>In-frame_KCNQ5_ENST00000414165_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_2831nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC
TTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATT
ATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAA
AAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTAC
TTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCT
GCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTT
ACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAG
TTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAAT
TGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAG
AGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGG
GCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAG
ATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGC
AACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTG

>In-frame_KCNQ5_ENST00000402622_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_2833nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC
TTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATT
ATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAA
AAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTAC
TTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCT
GCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTT
ACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAG
TTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAAT
TGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAG
AGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGG
GCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAG
ATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGC
AACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTG

>In-frame_KCNQ5_ENST00000402622_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_2833nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC
TTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATT
ATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAA
AAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTAC
TTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCT
GCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTT
ACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAG
TTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAAT
TGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAG
AGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGG
GCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAG
ATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGC
AACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTG

>In-frame_KCNQ5_ENST00000402622_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_2831nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC
TTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATT
ATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAA
AAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTAC
TTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCT
GCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTT
ACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAG
TTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAAT
TGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAG
AGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGG
GCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAG
ATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGC
AACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTG

>In-frame_KCNQ5_ENST00000403813_chr6_73815090_+_AMPH_ENST00000325590_chr7_38433814_-_2833nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC
TTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATT
ATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAA
AAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTAC
TTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCT
GCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTT
ACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAG
TTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAAT
TGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAG
AGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGG
GCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAG
ATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGC
AACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTG

>In-frame_KCNQ5_ENST00000403813_chr6_73815090_+_AMPH_ENST00000356264_chr7_38433814_-_2833nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC
TTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATT
ATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAA
AAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTAC
TTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCT
GCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTT
ACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAG
TTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAAT
TGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAG
AGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGG
GCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAG
ATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGC
AACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTG

>In-frame_KCNQ5_ENST00000403813_chr6_73815090_+_AMPH_ENST00000428293_chr7_38433814_-_2831nt
ATGCCCCGCCACCACGCGGGAGGAGAGGAGGGCGGCGCCGCCGGGCTCTGGGTGAAGAGCGGCGCAGCGGCGGCGGCGGCGGGCGGGGGG
CGCTTGGGCAGCGGCATGAAGGATGTGGAGTCCGGCCGGGGCAGGGTGCTGCTGAACTCGGCAGCCGCCAGGGGCGACGGCCTGCTACTG
CTGGGCACCCGCGCGGCCACGCTCGGTGGCGGCGGCGGTGGCCTGAGGGAGAGCCGCCGGGGCAAGCAGGGGGCCCGGATGAGCCTGCTG
GGGAAGCCGCTCTCTTACACGAGTAGCCAGAGCTGCCGGCGCAACGTCAAGTACCGGCGGGTGCAGAACTACCTGTACAACGTGCTGGAG
AGACCCCGCGGCTGGGCGTTCATCTACCACGCTTTCGTTTTTCTCCTTGTCTTTGGTTGCTTGATTTTGTCAGTGTTTTCTACCATCCCT
GAGCACACAAAATTGGCCTCAAGTTGCCTCTTGATCCTGGAGTTCGTGATGATTGTCGTCTTTGGTTTGGAGTTCATCATTCGAATCTGG
TCTGCGGGTTGCTGTTGTCGATATAGAGGATGGCAAGGAAGACTGAGGTTTGCTCGAAAGCCCTTCTGTGTTATAGATACCATTGTTCTT
ATCGCTTCAATAGCAGTTGTTTCTGCAAAAACTCAGGGTAATATTTTTGCCACGTCTGCACTCAGAAGTCTCCGTTTCCTACAGATCCTC
CGCATGGTGCGCATGGACCGAAGGGGAGGCACTTGGAAATTACTGGGTTCAGTGGTTTATGCTCACAGCAAGGAATTAATCACAGCTTGG
TACATAGGATTTTTGGTTCTTATTTTTTCGTCTTTCCTTGTCTATCTGGTGGAAAAGGATGCCAATAAAGAGTTTTCTACATATGCAGAT
GCTCTCTGGTGGGGCACAATTACATTGACAACTATTGGCTATGGAGACAAAACTCCCCTAACTTGGCTGGGAAGATTGCTTTCTGCAGGC
TTTGCACTCCTTGGCATTTCTTTCTTTGCACTTCCTGCCATCATACCTGGAGCTGATGCTGATGCAGCTGTTGGAACCTTGGTGTCAGCA
GCTGAGGGGGCCCCAGGAGAGGAAGCAGAGGCGGAGAAGGCCACTGTCCCTGCCGGGGAAGGAGTAAGTTTAGAGGAGGCCAAAATTGGA
ACTGAAACCACTGAGGGTGCAGAGAGTGCCCAACCTGAAGCAGAGGAGCTCGAAGCAACAGTGCCTCAGGAGAAGGTCATTCCTTCGGTG
GTCATAGAGCCTGCCTCCAACCATGAAGAGGAAGGAGAAAACGAAATAACTATAGGTGCAGAGCCCAAGGAGACCACCGAGGACGCGGCT
CCTCCGGGCCCCACCAGCGAGACACCGGAGCTGGCTACGGAGCAGAAGCCTATCCAGGACCCTCAGCCCACGCCTTCTGCACCAGCCATG
GGGGCTGCTGACCAGCTAGCATCTGCAAGGGAGGCCTCTCAGGAATTGCCTCCTGGCTTTCTCTACAAGGTGGAAACACTGCATGATTTT
GAGGCAGCAAATTCTGATGAACTTACCTTACAAAGGGGTGATGTGGTGCTGGTGGTCCCCTCAGATTCAGAAGCTGATCAGGATGCAGGC
TGGCTGGTGGGAGTGAAGGAATCAGACTGGCTTCAGTACAGAGACCTTGCCACCTACAAAGGCCTCTTTCCAGAGAACTTCACCCGACGC
TTAGATTAGGGCAACAAGTACTGCAAGAAGGAGCTCAGTTACGGGGTTTTTAAACCTTCATGAAAACCTGAAGAGTTCACTTTTGTTATT
ATGCTCTTAATGATTTACAGACTGATGCCAGACAAACCTTGGGAAGATGTATCAATGGAGCATGTGTGCAAAAAAATGTAAGAGGAAAAA
AAGTAAATTAAGGAAAAAATCCTCACTCATTCCCATGTTGTCAATAACAGGTTTGTTTGTGCTTTGTCCAAGCTGTGGAGACTCTTGTAC
TTGATCCCCTCCCACCAATTCTAAAGTAGCTTTCTCCAGATCAGACTTTAATTTCTCTGCATCAGGTGTATCGTATTGAGTGGCTGCCCT
GCAGAAGATGTGATGAATTATCCTGTAGTACAAGATTATCTTATTCCCCTGCCCAGGTGTGAGCACGTGCTCTCGCTCCCTTTCAGGTTT
ACTATGTTTAAAACTAAACTGCTGCAAAAGTTCTCAATGTTCTTTTCCAACACATCTATATATATATGGACACACAGTCACGCAAGCTAG
TTCCCATGACTCCTGGATCTATGTGTATGCAGAAGGCTACATATACATAGTTGCTTCTTTCCTTTCCATTGTAGCTCTTTGCCTCTCAAT
TGTCATTGATACATGCATTGCTCTTATTCTGTCTGGCATTACAATTGCAGTTTTGCCTAATGGCAAAACCAGCCATCCCATTGGCAAAAG
AGTCAACAGTATCTGTGTTTGTACTGTGCAGTTTTCAGGATGAGATGACAGATAGCACGACTACACTGAGGCACCCTCAGAGAAGGCAGG
GCCTGATTTATCTAGCTGTCCAGCCGCTGTGGCTGGAGGTAGGCTAGTTGGGATGGGCAGCTAAGCAGTCTTCTCTTCTGCCTTTATGAG
ATTGGGTAGAAAGATGGGGCATATTCATCTACCCCCAAAAGAACACTATAAAAACAGCTCCTCTATATTTCCACCTCTTTCTATTTATGC
AACTCATCTTCACAGATTGTTCTAAAGTAAAATAGATGGTGTATGCTGTATCCACAAATCATCTGTAACAATTATGTTTTCAGTGCTGTG


Top

FusionGenePPI for KCNQ5_AMPH


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KCNQ5KCNQ3, DISC1, HCCS, MCOLN3, GABRE, KCNS3AMPHPLD1, PLD2, SYNJ1, DNM1, SH3GL2, VTN, CLTC, BIN1, CDK5R1, AP2A2, AP1B1, PTK2, CABIN1, SYN1, TNK2, MAPK6, ITSN2, KHDRBS1, ITSN1, REPS1, SGIP1, REPS2, SYNM, TP73, AP2B1, DNM2, TERF1, CDK5, DYRK1A, MANEA, AP2A1, UBC, PPP3CC, CCDC67, ARL16, HAX1, NUFIP1, DGUOK, DNAAF2, AP1G1, CALM1, BIN2, AP2M1, AP2S1, AAGAB, CLIP4


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KCNQ5_AMPH


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneKCNQ5Q9NR82DB04953EzogabinePotassium voltage-gated channel subfamily KQT member 5small moleculeapproved|investigational

Top

RelatedDiseases for KCNQ5_AMPH


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneKCNQ5C0027092Myopia1CTD_human