FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 18133

FusionGeneSummary for KANSL1L_ERBB4

check button Fusion gene summary
Fusion gene informationFusion gene name: KANSL1L_ERBB4
Fusion gene ID: 18133
HgeneTgene
Gene symbol

KANSL1L

ERBB4

Gene ID

151050

2066

Gene nameKAT8 regulatory NSL complex subunit 1 likeerb-b2 receptor tyrosine kinase 4
SynonymsC2orf67|MSL1v2ALS19|HER4|p180erbB4
Cytomap

2q34

2q34

Type of geneprotein-codingprotein-coding
DescriptionKAT8 regulatory NSL complex subunit 1-like proteinmale-specific lethal 1 homologreceptor tyrosine-protein kinase erbB-4ERBB4 transcript variant I12DELERBB4 transcript variant I20DELavian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4human epidermal growth factor receptor 4proto-oncogene-like protein c-ErbB-4tyrosin
Modification date2018052320180523
UniProtAcc

A0AUZ9

Q15303

Ensembl transtripts involved in fusion geneENST00000281772, ENST00000418791, 
ENST00000452086, ENST00000429908, 
ENST00000457374, 
ENST00000436443, 
ENST00000342788, ENST00000402597, 
ENST00000484474, 
Fusion gene scores* DoF score3 X 3 X 2=187 X 6 X 6=252
# samples 37
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(7/252*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: KANSL1L [Title/Abstract] AND ERBB4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneERBB4

GO:0007165

signal transduction

10572067

TgeneERBB4

GO:0007169

transmembrane receptor protein tyrosine kinase signaling pathway

10353604|18334220

TgeneERBB4

GO:0016477

cell migration

9135143

TgeneERBB4

GO:0018108

peptidyl-tyrosine phosphorylation

18334220

TgeneERBB4

GO:0046777

protein autophosphorylation

18334220


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-D8-A27M-01AKANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000281772ENST00000436443KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
In-frameENST00000281772ENST00000342788KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
In-frameENST00000281772ENST00000402597KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
5CDS-intronENST00000281772ENST00000484474KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
In-frameENST00000418791ENST00000436443KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
In-frameENST00000418791ENST00000342788KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
In-frameENST00000418791ENST00000402597KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
5CDS-intronENST00000418791ENST00000484474KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
In-frameENST00000452086ENST00000436443KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
In-frameENST00000452086ENST00000342788KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
In-frameENST00000452086ENST00000402597KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
5CDS-intronENST00000452086ENST00000484474KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
intron-3CDSENST00000429908ENST00000436443KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
intron-3CDSENST00000429908ENST00000342788KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
intron-3CDSENST00000429908ENST00000402597KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
intron-intronENST00000429908ENST00000484474KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
Frame-shiftENST00000457374ENST00000436443KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
Frame-shiftENST00000457374ENST00000342788KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
Frame-shiftENST00000457374ENST00000402597KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-
5CDS-intronENST00000457374ENST00000484474KANSL1Lchr2

210993755

-ERBB4chr2

212495319

-

Top

FusionProtFeatures for KANSL1L_ERBB4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
KANSL1L

A0AUZ9

ERBB4

Q15303

Tyrosine-protein kinase that plays an essential role ascell surface receptor for neuregulins and EGF family members andregulates development of the heart, the central nervous system andthe mammary gland, gene transcription, cell proliferation,differentiation, migration and apoptosis. Required for normalcardiac muscle differentiation during embryonic development, andfor postnatal cardiomyocyte proliferation. Required for normaldevelopment of the embryonic central nervous system, especiallyfor normal neural crest cell migration and normal axon guidance.Required for mammary gland differentiation, induction of milkproteins and lactation. Acts as cell-surface receptor for theneuregulins NRG1, NRG2, NRG3 and NRG4 and the EGF family membersBTC, EREG and HBEGF. Ligand binding triggers receptor dimerizationand autophosphorylation at specific tyrosine residues that thenserve as binding sites for scaffold proteins and effectors. Ligandspecificity and signaling is modulated by alternative splicing,proteolytic processing, and by the formation of heterodimers withother ERBB family members, thereby creating multiple combinationsof intracellular phosphotyrosines that trigger ligand- andcontext-specific cellular responses. Mediates phosphorylation ofSHC1 and activation of the MAP kinases MAPK1/ERK2 and MAPK3/ERK1.Isoform JM-A CYT-1 and isoform JM-B CYT-1 phosphorylate PIK3R1,leading to the activation of phosphatidylinositol 3-kinase andAKT1 and protect cells against apoptosis. Isoform JM-A CYT-1 andisoform JM-B CYT-1 mediate reorganization of the actincytoskeleton and promote cell migration in response to NRG1.Isoform JM-A CYT-2 and isoform JM-B CYT-2 lack the phosphotyrosinethat mediates interaction with PIK3R1, and hence do notphosphorylate PIK3R1, do not protect cells against apoptosis, anddo not promote reorganization of the actin cytoskeleton and cellmigration. Proteolytic processing of isoform JM-A CYT-1 andisoform JM-A CYT-2 gives rise to the corresponding solubleintracellular domains (4ICD) that translocate to the nucleus,promote nuclear import of STAT5A, activation of STAT5A, mammaryepithelium differentiation, cell proliferation and activation ofgene expression. The ERBB4 soluble intracellular domains (4ICD)colocalize with STAT5A at the CSN2 promoter to regulatetranscription of milk proteins during lactation. The ERBB4 solubleintracellular domains can also translocate to mitochondria andpromote apoptosis. {ECO:0000269|PubMed:10348342,ECO:0000269|PubMed:10353604, ECO:0000269|PubMed:10358079,ECO:0000269|PubMed:10722704, ECO:0000269|PubMed:10867024,ECO:0000269|PubMed:11178955, ECO:0000269|PubMed:11390655,ECO:0000269|PubMed:12807903, ECO:0000269|PubMed:15534001,ECO:0000269|PubMed:15746097, ECO:0000269|PubMed:16251361,ECO:0000269|PubMed:16778220, ECO:0000269|PubMed:16837552,ECO:0000269|PubMed:17486069, ECO:0000269|PubMed:17638867,ECO:0000269|PubMed:19098003, ECO:0000269|PubMed:20858735,ECO:0000269|PubMed:8383326, ECO:0000269|PubMed:8617750,ECO:0000269|PubMed:9135143, ECO:0000269|PubMed:9168115,ECO:0000269|PubMed:9334263}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneERBB4chr2:210993755chr2:212495319ENST00000342788-1528718_9856481309DomainProtein kinase
TgeneERBB4chr2:210993755chr2:212495319ENST00000402597-1528718_9856381299DomainProtein kinase
TgeneERBB4chr2:210993755chr2:212495319ENST00000436443-1527718_9856481293DomainProtein kinase
TgeneERBB4chr2:210993755chr2:212495319ENST00000342788-15281032_10356481309MotifNote=PPxY motif 1
TgeneERBB4chr2:210993755chr2:212495319ENST00000342788-15281053_10566481309MotifNote=PPxY motif 2
TgeneERBB4chr2:210993755chr2:212495319ENST00000342788-15281298_13016481309MotifNote=PPxY motif 3
TgeneERBB4chr2:210993755chr2:212495319ENST00000342788-15281306_13086481309MotifNote=PDZ-binding
TgeneERBB4chr2:210993755chr2:212495319ENST00000342788-1528676_6846481309MotifNote=Nuclear localization signal
TgeneERBB4chr2:210993755chr2:212495319ENST00000402597-15281032_10356381299MotifNote=PPxY motif 1
TgeneERBB4chr2:210993755chr2:212495319ENST00000402597-15281053_10566381299MotifNote=PPxY motif 2
TgeneERBB4chr2:210993755chr2:212495319ENST00000402597-15281298_13016381299MotifNote=PPxY motif 3
TgeneERBB4chr2:210993755chr2:212495319ENST00000402597-15281306_13086381299MotifNote=PDZ-binding
TgeneERBB4chr2:210993755chr2:212495319ENST00000402597-1528676_6846381299MotifNote=Nuclear localization signal
TgeneERBB4chr2:210993755chr2:212495319ENST00000436443-15271032_10356481293MotifNote=PPxY motif 1
TgeneERBB4chr2:210993755chr2:212495319ENST00000436443-15271053_10566481293MotifNote=PPxY motif 2
TgeneERBB4chr2:210993755chr2:212495319ENST00000436443-15271298_13016481293MotifNote=PPxY motif 3
TgeneERBB4chr2:210993755chr2:212495319ENST00000436443-15271306_13086481293MotifNote=PDZ-binding
TgeneERBB4chr2:210993755chr2:212495319ENST00000436443-1527676_6846481293MotifNote=Nuclear localization signal
TgeneERBB4chr2:210993755chr2:212495319ENST00000342788-1528724_7326481309Nucleotide bindingATP
TgeneERBB4chr2:210993755chr2:212495319ENST00000342788-1528797_7996481309Nucleotide bindingATP
TgeneERBB4chr2:210993755chr2:212495319ENST00000342788-1528843_8486481309Nucleotide bindingATP
TgeneERBB4chr2:210993755chr2:212495319ENST00000402597-1528724_7326381299Nucleotide bindingATP
TgeneERBB4chr2:210993755chr2:212495319ENST00000402597-1528797_7996381299Nucleotide bindingATP
TgeneERBB4chr2:210993755chr2:212495319ENST00000402597-1528843_8486381299Nucleotide bindingATP
TgeneERBB4chr2:210993755chr2:212495319ENST00000436443-1527724_7326481293Nucleotide bindingATP
TgeneERBB4chr2:210993755chr2:212495319ENST00000436443-1527797_7996481293Nucleotide bindingATP
TgeneERBB4chr2:210993755chr2:212495319ENST00000436443-1527843_8486481293Nucleotide bindingATP
TgeneERBB4chr2:210993755chr2:212495319ENST00000342788-1528676_13086481309Topological domainCytoplasmic
TgeneERBB4chr2:210993755chr2:212495319ENST00000402597-1528676_13086381299Topological domainCytoplasmic
TgeneERBB4chr2:210993755chr2:212495319ENST00000436443-1527676_13086481293Topological domainCytoplasmic
TgeneERBB4chr2:210993755chr2:212495319ENST00000342788-1528652_6756481309TransmembraneHelical
TgeneERBB4chr2:210993755chr2:212495319ENST00000402597-1528652_6756381299TransmembraneHelical
TgeneERBB4chr2:210993755chr2:212495319ENST00000436443-1527652_6756481293TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneERBB4chr2:210993755chr2:212495319ENST00000342788-1528186_3346481309Compositional biasNote=Cys-rich
TgeneERBB4chr2:210993755chr2:212495319ENST00000342788-1528496_6336481309Compositional biasNote=Cys-rich
TgeneERBB4chr2:210993755chr2:212495319ENST00000402597-1528186_3346381299Compositional biasNote=Cys-rich
TgeneERBB4chr2:210993755chr2:212495319ENST00000402597-1528496_6336381299Compositional biasNote=Cys-rich
TgeneERBB4chr2:210993755chr2:212495319ENST00000436443-1527186_3346481293Compositional biasNote=Cys-rich
TgeneERBB4chr2:210993755chr2:212495319ENST00000436443-1527496_6336481293Compositional biasNote=Cys-rich
TgeneERBB4chr2:210993755chr2:212495319ENST00000342788-152826_6516481309Topological domainExtracellular
TgeneERBB4chr2:210993755chr2:212495319ENST00000402597-152826_6516381299Topological domainExtracellular
TgeneERBB4chr2:210993755chr2:212495319ENST00000436443-152726_6516481293Topological domainExtracellular


Top

FusionGeneSequence for KANSL1L_ERBB4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_KANSL1L_ENST00000281772_chr2_210993755_-_ERBB4_ENST00000436443_chr2_212495319_-_1054aa
MTPALREATAKGISFSSLPSTMESDKMLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGSPQSSKHYQTVFLMRSNSTLN
KHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSHSEEFIKKEPLSDTTSQCMKDVQIILDSNITKDTNVDKVQLQNCKWYQENALL
DKVTDAEIKKGLLHCTQKKIVPGHSNVPVSSSAAEKEEEVHARLLHCVSKQKILLSQARRTQKHLQMLLAKHVVKHYGQQMKLSMKHQLP
KMKTFHEPTTILGNSLPKCTEIKPEVNTLTAENKLWDDAKNGFARCTAAEIQRFAFSATGLLSHVEEGLDSDATDSSSDDDLDEYTLRKN
VAVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKNSPDCSWSNWWALHSGHCGSDICCLCXKEEHQKEKSLEKI
LGNRVGGTINSQWHSTQSSSTSYFERNXAEEGKSPWLRCFWNGLXRYLGTXRRNCEDSCGYXDSXXDNWSQGKCGVHGXSSDHGKYGSST
PSPVAGCVSEPNHPAGYSTYAPWLPVGVCPRAQGXHWITTAAXLVCPDSXGNDVPGRKTTRSSGFGSPXCLSEISKPCENHRFWASQTLG
RRXKRVQCXWRKDANXMDGSGVYTLQEIHPSEXRLELWSYYMGTDDLWRKTLXWNSNARNPXFIRERRTFASASHLHYXRLHGHGQMLDD
XCXQXTXIXGTGCXVFKDGSRPSKIPSYSGXXSYEASQSKXQQVLSESLGXRGFGRYDGCXGVLGPSGFQHPTSHLYFQSKNXLEXEPVC
IPRWRFCCXTRSVCALQSPNXHNSRSSCGTGCYCXDFXXLLLXWHPTQASGTPCPRGQXHPEVQCXPHRVCPRTEPTRRAGXGRLHDSYA
RQTQTRIPESSGGEPFCFSEKKWRPSSIGXSRISQCIQWSTQGRGXVCEXATVPQHLCQHLGKSXVPEEQHTVNAREGQESVXQPXLLEP

>In-frame_KANSL1L_ENST00000281772_chr2_210993755_-_ERBB4_ENST00000342788_chr2_212495319_-_1070aa
MTPALREATAKGISFSSLPSTMESDKMLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGSPQSSKHYQTVFLMRSNSTLN
KHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSHSEEFIKKEPLSDTTSQCMKDVQIILDSNITKDTNVDKVQLQNCKWYQENALL
DKVTDAEIKKGLLHCTQKKIVPGHSNVPVSSSAAEKEEEVHARLLHCVSKQKILLSQARRTQKHLQMLLAKHVVKHYGQQMKLSMKHQLP
KMKTFHEPTTILGNSLPKCTEIKPEVNTLTAENKLWDDAKNGFARCTAAEIQRFAFSATGLLSHVEEGLDSDATDSSSDDDLDEYTLRKN
VAVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKNSPDCSWSNWWALHSGHCGSDICCLCXKEEHQKEKSLEKI
LGNRVGGTINSQWHSTQSSSTSYFERNXAEEGKSPWLRCFWNGLXRYLGTXRRNCEDSCGYXDSXXDNWSQGKCGVHGXSSDHGKYGSST
PSPVAGCVSEPNHPAGYSTYAPWLPVGVCPRAQGXHWITTAAXLVCPDSXGNDVPGRKTTRSSGFGSPXCLSEISKPCENHRFWASQTLG
RRXKRVQCXWRKDANXMDGSGVYTLQEIHPSEXRLELWSYYMGTDDLWRKTLXWNSNARNPXFIRERRTFASASHLHYXRLHGHGQMLDD
XCXQXTXIXGTGCXVFKDGSRPSKIPSYSGXXSYEASQSKXQQVLSESLGXRGFGRYDGCXGVLGPSGFQHPTSHLYFQSKNXLEXEXNW
TQPSSCLHPHVRKPVCIPRWRFCCXTRSVCALQSPNXHNSRSSCGTGCYCXDFXXLLLXWHPTQASGTPCPRGQXHPEVQCXPHRVCPRT
EPTRRAGXGRLHDSYARQTQTRIPESSGGEPFCFSEKKWRPSSIGXSRISQCIQWSTQGRGXVCEXATVPQHLCQHLGKSXVPEEQHTVN

>In-frame_KANSL1L_ENST00000281772_chr2_210993755_-_ERBB4_ENST00000402597_chr2_212495319_-_1070aa
MTPALREATAKGISFSSLPSTMESDKMLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGSPQSSKHYQTVFLMRSNSTLN
KHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSHSEEFIKKEPLSDTTSQCMKDVQIILDSNITKDTNVDKVQLQNCKWYQENALL
DKVTDAEIKKGLLHCTQKKIVPGHSNVPVSSSAAEKEEEVHARLLHCVSKQKILLSQARRTQKHLQMLLAKHVVKHYGQQMKLSMKHQLP
KMKTFHEPTTILGNSLPKCTEIKPEVNTLTAENKLWDDAKNGFARCTAAEIQRFAFSATGLLSHVEEGLDSDATDSSSDDDLDEYTLRKN
VAVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKNSPDCSWSNWWALHSGHCGSDICCLCXKEEHQKEKSLEKI
LGNRVGGTINSQWHSTQSSSTSYFERNXAEEGKSPWLRCFWNGLXRYLGTXRRNCEDSCGYXDSXXDNWSQGKCGVHGXSSDHGKYGSST
PSPVAGCVSEPNHPAGYSTYAPWLPVGVCPRAQGXHWITTAAXLVCPDSXGNDVPGRKTTRSSGFGSPXCLSEISKPCENHRFWASQTLG
RRXKRVQCXWRKDANXMDGSGVYTLQEIHPSEXRLELWSYYMGTDDLWRKTLXWNSNARNPXFIRERRTFASASHLHYXRLHGHGQMLDD
XCXQXTXIXGTGCXVFKDGSRPSKIPSYSGXXSYEASQSKXQQVLSESLGXRGFGRYDGCXGVLGPSGFQHPTSHLYFQSKNXLEXEXNW
TQPSSCLHPHVRKPVCIPRWRFCCXTRSVCALQSPNXHNSRSSCGTGCYCXDFXXLLLXWHPTQASGTPCPRGQXHPEVQCXPHRVCPRT
EPTRRAGXGRLHDSYARQTQTRIPESSGGEPFCFSEKKWRPSSIGXSRISQCIQWSTQGRGXVCEXATVPQHLCQHLGKSXVPEEQHTVN

>In-frame_KANSL1L_ENST00000418791_chr2_210993755_-_ERBB4_ENST00000436443_chr2_212495319_-_1054aa
MTPALREATAKGISFSSLPSTMESDKMLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGSPQSSKHYQTVFLMRSNSTLN
KHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSHSEEFIKKEPLSDTTSQCMKDVQIILDSNITKDTNVDKVQLQNCKWYQENALL
DKVTDAEIKKGLLHCTQKKIVPGHSNVPVSSSAAEKEEEVHARLLHCVSKQKILLSQARRTQKHLQMLLAKHVVKHYGQQMKLSMKHQLP
KMKTFHEPTTILGNSLPKCTEIKPEVNTLTAENKLWDDAKNGFARCTAAEIQRFAFSATGLLSHVEEGLDSDATDSSSDDDLDEYTLRKN
VAVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKNSPDCSWSNWWALHSGHCGSDICCLCXKEEHQKEKSLEKI
LGNRVGGTINSQWHSTQSSSTSYFERNXAEEGKSPWLRCFWNGLXRYLGTXRRNCEDSCGYXDSXXDNWSQGKCGVHGXSSDHGKYGSST
PSPVAGCVSEPNHPAGYSTYAPWLPVGVCPRAQGXHWITTAAXLVCPDSXGNDVPGRKTTRSSGFGSPXCLSEISKPCENHRFWASQTLG
RRXKRVQCXWRKDANXMDGSGVYTLQEIHPSEXRLELWSYYMGTDDLWRKTLXWNSNARNPXFIRERRTFASASHLHYXRLHGHGQMLDD
XCXQXTXIXGTGCXVFKDGSRPSKIPSYSGXXSYEASQSKXQQVLSESLGXRGFGRYDGCXGVLGPSGFQHPTSHLYFQSKNXLEXEPVC
IPRWRFCCXTRSVCALQSPNXHNSRSSCGTGCYCXDFXXLLLXWHPTQASGTPCPRGQXHPEVQCXPHRVCPRTEPTRRAGXGRLHDSYA
RQTQTRIPESSGGEPFCFSEKKWRPSSIGXSRISQCIQWSTQGRGXVCEXATVPQHLCQHLGKSXVPEEQHTVNAREGQESVXQPXLLEP

>In-frame_KANSL1L_ENST00000418791_chr2_210993755_-_ERBB4_ENST00000342788_chr2_212495319_-_1070aa
MTPALREATAKGISFSSLPSTMESDKMLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGSPQSSKHYQTVFLMRSNSTLN
KHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSHSEEFIKKEPLSDTTSQCMKDVQIILDSNITKDTNVDKVQLQNCKWYQENALL
DKVTDAEIKKGLLHCTQKKIVPGHSNVPVSSSAAEKEEEVHARLLHCVSKQKILLSQARRTQKHLQMLLAKHVVKHYGQQMKLSMKHQLP
KMKTFHEPTTILGNSLPKCTEIKPEVNTLTAENKLWDDAKNGFARCTAAEIQRFAFSATGLLSHVEEGLDSDATDSSSDDDLDEYTLRKN
VAVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKNSPDCSWSNWWALHSGHCGSDICCLCXKEEHQKEKSLEKI
LGNRVGGTINSQWHSTQSSSTSYFERNXAEEGKSPWLRCFWNGLXRYLGTXRRNCEDSCGYXDSXXDNWSQGKCGVHGXSSDHGKYGSST
PSPVAGCVSEPNHPAGYSTYAPWLPVGVCPRAQGXHWITTAAXLVCPDSXGNDVPGRKTTRSSGFGSPXCLSEISKPCENHRFWASQTLG
RRXKRVQCXWRKDANXMDGSGVYTLQEIHPSEXRLELWSYYMGTDDLWRKTLXWNSNARNPXFIRERRTFASASHLHYXRLHGHGQMLDD
XCXQXTXIXGTGCXVFKDGSRPSKIPSYSGXXSYEASQSKXQQVLSESLGXRGFGRYDGCXGVLGPSGFQHPTSHLYFQSKNXLEXEXNW
TQPSSCLHPHVRKPVCIPRWRFCCXTRSVCALQSPNXHNSRSSCGTGCYCXDFXXLLLXWHPTQASGTPCPRGQXHPEVQCXPHRVCPRT
EPTRRAGXGRLHDSYARQTQTRIPESSGGEPFCFSEKKWRPSSIGXSRISQCIQWSTQGRGXVCEXATVPQHLCQHLGKSXVPEEQHTVN

>In-frame_KANSL1L_ENST00000418791_chr2_210993755_-_ERBB4_ENST00000402597_chr2_212495319_-_1070aa
MTPALREATAKGISFSSLPSTMESDKMLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGSPQSSKHYQTVFLMRSNSTLN
KHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSHSEEFIKKEPLSDTTSQCMKDVQIILDSNITKDTNVDKVQLQNCKWYQENALL
DKVTDAEIKKGLLHCTQKKIVPGHSNVPVSSSAAEKEEEVHARLLHCVSKQKILLSQARRTQKHLQMLLAKHVVKHYGQQMKLSMKHQLP
KMKTFHEPTTILGNSLPKCTEIKPEVNTLTAENKLWDDAKNGFARCTAAEIQRFAFSATGLLSHVEEGLDSDATDSSSDDDLDEYTLRKN
VAVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKNSPDCSWSNWWALHSGHCGSDICCLCXKEEHQKEKSLEKI
LGNRVGGTINSQWHSTQSSSTSYFERNXAEEGKSPWLRCFWNGLXRYLGTXRRNCEDSCGYXDSXXDNWSQGKCGVHGXSSDHGKYGSST
PSPVAGCVSEPNHPAGYSTYAPWLPVGVCPRAQGXHWITTAAXLVCPDSXGNDVPGRKTTRSSGFGSPXCLSEISKPCENHRFWASQTLG
RRXKRVQCXWRKDANXMDGSGVYTLQEIHPSEXRLELWSYYMGTDDLWRKTLXWNSNARNPXFIRERRTFASASHLHYXRLHGHGQMLDD
XCXQXTXIXGTGCXVFKDGSRPSKIPSYSGXXSYEASQSKXQQVLSESLGXRGFGRYDGCXGVLGPSGFQHPTSHLYFQSKNXLEXEXNW
TQPSSCLHPHVRKPVCIPRWRFCCXTRSVCALQSPNXHNSRSSCGTGCYCXDFXXLLLXWHPTQASGTPCPRGQXHPEVQCXPHRVCPRT
EPTRRAGXGRLHDSYARQTQTRIPESSGGEPFCFSEKKWRPSSIGXSRISQCIQWSTQGRGXVCEXATVPQHLCQHLGKSXVPEEQHTVN

>In-frame_KANSL1L_ENST00000452086_chr2_210993755_-_ERBB4_ENST00000436443_chr2_212495319_-_1054aa
MTPALREATAKGISFSSLPSTMESDKMLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGSPQSSKHYQTVFLMRSNSTLN
KHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSHSEEFIKKEPLSDTTSQCMKDVQIILDSNITKDTNVDKVQLQNCKWYQENALL
DKVTDAEIKKGLLHCTQKKIVPGHSNVPVSSSAAEKEEEVHARLLHCVSKQKILLSQARRTQKHLQMLLAKHVVKHYGQQMKLSMKHQLP
KMKTFHEPTTILGNSLPKCTEIKPEVNTLTAENKLWDDAKNGFARCTAAEIQRFAFSATGLLSHVEEGLDSDATDSSSDDDLDEYTLRKN
VAVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKNSPDCSWSNWWALHSGHCGSDICCLCXKEEHQKEKSLEKI
LGNRVGGTINSQWHSTQSSSTSYFERNXAEEGKSPWLRCFWNGLXRYLGTXRRNCEDSCGYXDSXXDNWSQGKCGVHGXSSDHGKYGSST
PSPVAGCVSEPNHPAGYSTYAPWLPVGVCPRAQGXHWITTAAXLVCPDSXGNDVPGRKTTRSSGFGSPXCLSEISKPCENHRFWASQTLG
RRXKRVQCXWRKDANXMDGSGVYTLQEIHPSEXRLELWSYYMGTDDLWRKTLXWNSNARNPXFIRERRTFASASHLHYXRLHGHGQMLDD
XCXQXTXIXGTGCXVFKDGSRPSKIPSYSGXXSYEASQSKXQQVLSESLGXRGFGRYDGCXGVLGPSGFQHPTSHLYFQSKNXLEXEPVC
IPRWRFCCXTRSVCALQSPNXHNSRSSCGTGCYCXDFXXLLLXWHPTQASGTPCPRGQXHPEVQCXPHRVCPRTEPTRRAGXGRLHDSYA
RQTQTRIPESSGGEPFCFSEKKWRPSSIGXSRISQCIQWSTQGRGXVCEXATVPQHLCQHLGKSXVPEEQHTVNAREGQESVXQPXLLEP

>In-frame_KANSL1L_ENST00000452086_chr2_210993755_-_ERBB4_ENST00000342788_chr2_212495319_-_1070aa
MTPALREATAKGISFSSLPSTMESDKMLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGSPQSSKHYQTVFLMRSNSTLN
KHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSHSEEFIKKEPLSDTTSQCMKDVQIILDSNITKDTNVDKVQLQNCKWYQENALL
DKVTDAEIKKGLLHCTQKKIVPGHSNVPVSSSAAEKEEEVHARLLHCVSKQKILLSQARRTQKHLQMLLAKHVVKHYGQQMKLSMKHQLP
KMKTFHEPTTILGNSLPKCTEIKPEVNTLTAENKLWDDAKNGFARCTAAEIQRFAFSATGLLSHVEEGLDSDATDSSSDDDLDEYTLRKN
VAVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKNSPDCSWSNWWALHSGHCGSDICCLCXKEEHQKEKSLEKI
LGNRVGGTINSQWHSTQSSSTSYFERNXAEEGKSPWLRCFWNGLXRYLGTXRRNCEDSCGYXDSXXDNWSQGKCGVHGXSSDHGKYGSST
PSPVAGCVSEPNHPAGYSTYAPWLPVGVCPRAQGXHWITTAAXLVCPDSXGNDVPGRKTTRSSGFGSPXCLSEISKPCENHRFWASQTLG
RRXKRVQCXWRKDANXMDGSGVYTLQEIHPSEXRLELWSYYMGTDDLWRKTLXWNSNARNPXFIRERRTFASASHLHYXRLHGHGQMLDD
XCXQXTXIXGTGCXVFKDGSRPSKIPSYSGXXSYEASQSKXQQVLSESLGXRGFGRYDGCXGVLGPSGFQHPTSHLYFQSKNXLEXEXNW
TQPSSCLHPHVRKPVCIPRWRFCCXTRSVCALQSPNXHNSRSSCGTGCYCXDFXXLLLXWHPTQASGTPCPRGQXHPEVQCXPHRVCPRT
EPTRRAGXGRLHDSYARQTQTRIPESSGGEPFCFSEKKWRPSSIGXSRISQCIQWSTQGRGXVCEXATVPQHLCQHLGKSXVPEEQHTVN

>In-frame_KANSL1L_ENST00000452086_chr2_210993755_-_ERBB4_ENST00000402597_chr2_212495319_-_1070aa
MTPALREATAKGISFSSLPSTMESDKMLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNTNFVNLKHFGSPQSSKHYQTVFLMRSNSTLN
KHNENYKQKKLGEPSCNKLKNILYNGSNIQLSKICLSHSEEFIKKEPLSDTTSQCMKDVQIILDSNITKDTNVDKVQLQNCKWYQENALL
DKVTDAEIKKGLLHCTQKKIVPGHSNVPVSSSAAEKEEEVHARLLHCVSKQKILLSQARRTQKHLQMLLAKHVVKHYGQQMKLSMKHQLP
KMKTFHEPTTILGNSLPKCTEIKPEVNTLTAENKLWDDAKNGFARCTAAEIQRFAFSATGLLSHVEEGLDSDATDSSSDDDLDEYTLRKN
VAVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKNSPDCSWSNWWALHSGHCGSDICCLCXKEEHQKEKSLEKI
LGNRVGGTINSQWHSTQSSSTSYFERNXAEEGKSPWLRCFWNGLXRYLGTXRRNCEDSCGYXDSXXDNWSQGKCGVHGXSSDHGKYGSST
PSPVAGCVSEPNHPAGYSTYAPWLPVGVCPRAQGXHWITTAAXLVCPDSXGNDVPGRKTTRSSGFGSPXCLSEISKPCENHRFWASQTLG
RRXKRVQCXWRKDANXMDGSGVYTLQEIHPSEXRLELWSYYMGTDDLWRKTLXWNSNARNPXFIRERRTFASASHLHYXRLHGHGQMLDD
XCXQXTXIXGTGCXVFKDGSRPSKIPSYSGXXSYEASQSKXQQVLSESLGXRGFGRYDGCXGVLGPSGFQHPTSHLYFQSKNXLEXEXNW
TQPSSCLHPHVRKPVCIPRWRFCCXTRSVCALQSPNXHNSRSSCGTGCYCXDFXXLLLXWHPTQASGTPCPRGQXHPEVQCXPHRVCPRT
EPTRRAGXGRLHDSYARQTQTRIPESSGGEPFCFSEKKWRPSSIGXSRISQCIQWSTQGRGXVCEXATVPQHLCQHLGKSXVPEEQHTVN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_KANSL1L_ENST00000281772_chr2_210993755_-_ERBB4_ENST00000436443_chr2_212495319_-_3163nt
ATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTACCATGGAGTCTGACAAGATGCTCTACATG
GAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATTTCCAACTCCTGAACCTACTCTTAATACT
AATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTTTTTAATGAGATCTAATTCTACATTAAAT
AAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAACATACTGTATAATGGCAGCAACATTCAG
CTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATACCACGAGCCAGTGCATGAAAGATGTACAA
ATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTGTAAATGGTATCAAGAGAATGCACTTTTG
GATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGTACCTGGCCACTCAAATGTGCCTGTTAGT
TCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACAGAAAATTTTACTTAGCCAGGCTAGAAGA
ACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGATGAAATTGTCTATGAAACATCAACTCCCC
AAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGAAATTAAGCCAGAAGTTAACACATTGACT
GCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAATCCAAAGATTTGCATTTTCTGCTACAGGG
CTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGATTTGGATGAATATACCCTTAGAAAAAAT
GTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCGATGGACTTGGCTTCAAGCTCAGATTTCA
GACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAACTCCCCTGATTGCAGCTGGAGTAATTGG
TGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATT
CTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGAGCTGAA
GAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTGAAGGAGAAACTGTGAAGATTCCTGTGGC
TATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTGATCATGGCAAGTATGGATCATCCACA
CCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCA
CGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAGACGACT
CGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCACAGATTTTGGGCTAGCCAGACTCTTGGA
AGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGGAGTGTATACATTACAGGAAATTCACCCA
TCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAACCCTATGATGGAATTCCAACGCGAGAAAT
CCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTGGATGAT
TGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAGACCCTCAAAGATACCTAGTTATTCAGGG
TGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGATGGATGC
TGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAAGAATTGACTCGAATAGGAACCAGTTTGT
ATACCGAGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGTGCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACA
GGGTGCTACTGCTGAGATTTTTGATGACTCCTGCTGTAATGGCACCCTACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCAC
CCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACGGAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCG
AGACAAACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAACCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAA
TCCCGAATATCACAATGCATCCAATGGTCCACCCAAGGCCGAGGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACAC
CTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAATGCCAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCA
CAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGACTACCTGCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCG
GCCTATTGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTCCCTGAAGCCAGGCACTGTGCTGCCGCCTCCACCTTACAGACACCGGAA

>In-frame_KANSL1L_ENST00000281772_chr2_210993755_-_ERBB4_ENST00000342788_chr2_212495319_-_3211nt
ATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTACCATGGAGTCTGACAAGATGCTCTACATG
GAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATTTCCAACTCCTGAACCTACTCTTAATACT
AATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTTTTTAATGAGATCTAATTCTACATTAAAT
AAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAACATACTGTATAATGGCAGCAACATTCAG
CTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATACCACGAGCCAGTGCATGAAAGATGTACAA
ATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTGTAAATGGTATCAAGAGAATGCACTTTTG
GATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGTACCTGGCCACTCAAATGTGCCTGTTAGT
TCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACAGAAAATTTTACTTAGCCAGGCTAGAAGA
ACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGATGAAATTGTCTATGAAACATCAACTCCCC
AAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGAAATTAAGCCAGAAGTTAACACATTGACT
GCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAATCCAAAGATTTGCATTTTCTGCTACAGGG
CTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGATTTGGATGAATATACCCTTAGAAAAAAT
GTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCGATGGACTTGGCTTCAAGCTCAGATTTCA
GACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAACTCCCCTGATTGCAGCTGGAGTAATTGG
TGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATT
CTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGAGCTGAA
GAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTGAAGGAGAAACTGTGAAGATTCCTGTGGC
TATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTGATCATGGCAAGTATGGATCATCCACA
CCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCA
CGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAGACGACT
CGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCACAGATTTTGGGCTAGCCAGACTCTTGGA
AGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGGAGTGTATACATTACAGGAAATTCACCCA
TCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAACCCTATGATGGAATTCCAACGCGAGAAAT
CCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTGGATGAT
TGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAGACCCTCAAAGATACCTAGTTATTCAGGG
TGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGATGGATGC
TGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAAGAATTGACTCGAATAGGAGTGAAATTGG
ACACAGCCCTCCTCCTGCCTACACCCCCATGTCAGGAAACCAGTTTGTATACCGAGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGT
GCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGCTACTGCTGAGATTTTTGATGACTCCTGCTGTAATGG
CACCCTACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACG
GAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAA
CCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACAATGCATCCAATGGTCCACCCAAGGCCGA
GGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAAT
GCCAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGACTACCT
GCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTC

>In-frame_KANSL1L_ENST00000281772_chr2_210993755_-_ERBB4_ENST00000402597_chr2_212495319_-_3211nt
ATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTACCATGGAGTCTGACAAGATGCTCTACATG
GAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATTTCCAACTCCTGAACCTACTCTTAATACT
AATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTTTTTAATGAGATCTAATTCTACATTAAAT
AAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAACATACTGTATAATGGCAGCAACATTCAG
CTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATACCACGAGCCAGTGCATGAAAGATGTACAA
ATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTGTAAATGGTATCAAGAGAATGCACTTTTG
GATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGTACCTGGCCACTCAAATGTGCCTGTTAGT
TCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACAGAAAATTTTACTTAGCCAGGCTAGAAGA
ACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGATGAAATTGTCTATGAAACATCAACTCCCC
AAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGAAATTAAGCCAGAAGTTAACACATTGACT
GCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAATCCAAAGATTTGCATTTTCTGCTACAGGG
CTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGATTTGGATGAATATACCCTTAGAAAAAAT
GTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCGATGGACTTGGCTTCAAGCTCAGATTTCA
GACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAACTCCCCTGATTGCAGCTGGAGTAATTGG
TGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATT
CTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGAGCTGAA
GAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTGAAGGAGAAACTGTGAAGATTCCTGTGGC
TATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTGATCATGGCAAGTATGGATCATCCACA
CCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCA
CGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAGACGACT
CGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCACAGATTTTGGGCTAGCCAGACTCTTGGA
AGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGGAGTGTATACATTACAGGAAATTCACCCA
TCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAACCCTATGATGGAATTCCAACGCGAGAAAT
CCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTGGATGAT
TGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAGACCCTCAAAGATACCTAGTTATTCAGGG
TGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGATGGATGC
TGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAAGAATTGACTCGAATAGGAGTGAAATTGG
ACACAGCCCTCCTCCTGCCTACACCCCCATGTCAGGAAACCAGTTTGTATACCGAGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGT
GCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGCTACTGCTGAGATTTTTGATGACTCCTGCTGTAATGG
CACCCTACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACG
GAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAA
CCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACAATGCATCCAATGGTCCACCCAAGGCCGA
GGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAAT
GCCAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGACTACCT
GCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTC

>In-frame_KANSL1L_ENST00000418791_chr2_210993755_-_ERBB4_ENST00000436443_chr2_212495319_-_3163nt
ATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTACCATGGAGTCTGACAAGATGCTCTACATG
GAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATTTCCAACTCCTGAACCTACTCTTAATACT
AATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTTTTTAATGAGATCTAATTCTACATTAAAT
AAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAACATACTGTATAATGGCAGCAACATTCAG
CTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATACCACGAGCCAGTGCATGAAAGATGTACAA
ATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTGTAAATGGTATCAAGAGAATGCACTTTTG
GATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGTACCTGGCCACTCAAATGTGCCTGTTAGT
TCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACAGAAAATTTTACTTAGCCAGGCTAGAAGA
ACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGATGAAATTGTCTATGAAACATCAACTCCCC
AAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGAAATTAAGCCAGAAGTTAACACATTGACT
GCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAATCCAAAGATTTGCATTTTCTGCTACAGGG
CTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGATTTGGATGAATATACCCTTAGAAAAAAT
GTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCGATGGACTTGGCTTCAAGCTCAGATTTCA
GACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAACTCCCCTGATTGCAGCTGGAGTAATTGG
TGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATT
CTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGAGCTGAA
GAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTGAAGGAGAAACTGTGAAGATTCCTGTGGC
TATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTGATCATGGCAAGTATGGATCATCCACA
CCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCA
CGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAGACGACT
CGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCACAGATTTTGGGCTAGCCAGACTCTTGGA
AGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGGAGTGTATACATTACAGGAAATTCACCCA
TCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAACCCTATGATGGAATTCCAACGCGAGAAAT
CCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTGGATGAT
TGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAGACCCTCAAAGATACCTAGTTATTCAGGG
TGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGATGGATGC
TGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAAGAATTGACTCGAATAGGAACCAGTTTGT
ATACCGAGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGTGCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACA
GGGTGCTACTGCTGAGATTTTTGATGACTCCTGCTGTAATGGCACCCTACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCAC
CCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACGGAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCG
AGACAAACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAACCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAA
TCCCGAATATCACAATGCATCCAATGGTCCACCCAAGGCCGAGGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACAC
CTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAATGCCAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCA
CAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGACTACCTGCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCG
GCCTATTGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTCCCTGAAGCCAGGCACTGTGCTGCCGCCTCCACCTTACAGACACCGGAA

>In-frame_KANSL1L_ENST00000418791_chr2_210993755_-_ERBB4_ENST00000342788_chr2_212495319_-_3211nt
ATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTACCATGGAGTCTGACAAGATGCTCTACATG
GAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATTTCCAACTCCTGAACCTACTCTTAATACT
AATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTTTTTAATGAGATCTAATTCTACATTAAAT
AAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAACATACTGTATAATGGCAGCAACATTCAG
CTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATACCACGAGCCAGTGCATGAAAGATGTACAA
ATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTGTAAATGGTATCAAGAGAATGCACTTTTG
GATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGTACCTGGCCACTCAAATGTGCCTGTTAGT
TCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACAGAAAATTTTACTTAGCCAGGCTAGAAGA
ACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGATGAAATTGTCTATGAAACATCAACTCCCC
AAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGAAATTAAGCCAGAAGTTAACACATTGACT
GCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAATCCAAAGATTTGCATTTTCTGCTACAGGG
CTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGATTTGGATGAATATACCCTTAGAAAAAAT
GTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCGATGGACTTGGCTTCAAGCTCAGATTTCA
GACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAACTCCCCTGATTGCAGCTGGAGTAATTGG
TGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATT
CTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGAGCTGAA
GAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTGAAGGAGAAACTGTGAAGATTCCTGTGGC
TATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTGATCATGGCAAGTATGGATCATCCACA
CCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCA
CGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAGACGACT
CGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCACAGATTTTGGGCTAGCCAGACTCTTGGA
AGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGGAGTGTATACATTACAGGAAATTCACCCA
TCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAACCCTATGATGGAATTCCAACGCGAGAAAT
CCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTGGATGAT
TGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAGACCCTCAAAGATACCTAGTTATTCAGGG
TGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGATGGATGC
TGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAAGAATTGACTCGAATAGGAGTGAAATTGG
ACACAGCCCTCCTCCTGCCTACACCCCCATGTCAGGAAACCAGTTTGTATACCGAGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGT
GCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGCTACTGCTGAGATTTTTGATGACTCCTGCTGTAATGG
CACCCTACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACG
GAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAA
CCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACAATGCATCCAATGGTCCACCCAAGGCCGA
GGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAAT
GCCAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGACTACCT
GCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTC

>In-frame_KANSL1L_ENST00000418791_chr2_210993755_-_ERBB4_ENST00000402597_chr2_212495319_-_3211nt
ATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTACCATGGAGTCTGACAAGATGCTCTACATG
GAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATTTCCAACTCCTGAACCTACTCTTAATACT
AATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTTTTTAATGAGATCTAATTCTACATTAAAT
AAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAACATACTGTATAATGGCAGCAACATTCAG
CTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATACCACGAGCCAGTGCATGAAAGATGTACAA
ATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTGTAAATGGTATCAAGAGAATGCACTTTTG
GATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGTACCTGGCCACTCAAATGTGCCTGTTAGT
TCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACAGAAAATTTTACTTAGCCAGGCTAGAAGA
ACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGATGAAATTGTCTATGAAACATCAACTCCCC
AAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGAAATTAAGCCAGAAGTTAACACATTGACT
GCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAATCCAAAGATTTGCATTTTCTGCTACAGGG
CTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGATTTGGATGAATATACCCTTAGAAAAAAT
GTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCGATGGACTTGGCTTCAAGCTCAGATTTCA
GACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAACTCCCCTGATTGCAGCTGGAGTAATTGG
TGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATT
CTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGAGCTGAA
GAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTGAAGGAGAAACTGTGAAGATTCCTGTGGC
TATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTGATCATGGCAAGTATGGATCATCCACA
CCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCA
CGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAGACGACT
CGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCACAGATTTTGGGCTAGCCAGACTCTTGGA
AGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGGAGTGTATACATTACAGGAAATTCACCCA
TCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAACCCTATGATGGAATTCCAACGCGAGAAAT
CCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTGGATGAT
TGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAGACCCTCAAAGATACCTAGTTATTCAGGG
TGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGATGGATGC
TGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAAGAATTGACTCGAATAGGAGTGAAATTGG
ACACAGCCCTCCTCCTGCCTACACCCCCATGTCAGGAAACCAGTTTGTATACCGAGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGT
GCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGCTACTGCTGAGATTTTTGATGACTCCTGCTGTAATGG
CACCCTACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACG
GAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAA
CCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACAATGCATCCAATGGTCCACCCAAGGCCGA
GGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAAT
GCCAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGACTACCT
GCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTC

>In-frame_KANSL1L_ENST00000452086_chr2_210993755_-_ERBB4_ENST00000436443_chr2_212495319_-_3163nt
ATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTACCATGGAGTCTGACAAGATGCTCTACATG
GAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATTTCCAACTCCTGAACCTACTCTTAATACT
AATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTTTTTAATGAGATCTAATTCTACATTAAAT
AAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAACATACTGTATAATGGCAGCAACATTCAG
CTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATACCACGAGCCAGTGCATGAAAGATGTACAA
ATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTGTAAATGGTATCAAGAGAATGCACTTTTG
GATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGTACCTGGCCACTCAAATGTGCCTGTTAGT
TCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACAGAAAATTTTACTTAGCCAGGCTAGAAGA
ACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGATGAAATTGTCTATGAAACATCAACTCCCC
AAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGAAATTAAGCCAGAAGTTAACACATTGACT
GCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAATCCAAAGATTTGCATTTTCTGCTACAGGG
CTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGATTTGGATGAATATACCCTTAGAAAAAAT
GTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCGATGGACTTGGCTTCAAGCTCAGATTTCA
GACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAACTCCCCTGATTGCAGCTGGAGTAATTGG
TGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATT
CTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGAGCTGAA
GAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTGAAGGAGAAACTGTGAAGATTCCTGTGGC
TATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTGATCATGGCAAGTATGGATCATCCACA
CCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCA
CGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAGACGACT
CGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCACAGATTTTGGGCTAGCCAGACTCTTGGA
AGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGGAGTGTATACATTACAGGAAATTCACCCA
TCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAACCCTATGATGGAATTCCAACGCGAGAAAT
CCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTGGATGAT
TGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAGACCCTCAAAGATACCTAGTTATTCAGGG
TGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGATGGATGC
TGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAAGAATTGACTCGAATAGGAACCAGTTTGT
ATACCGAGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGTGCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACA
GGGTGCTACTGCTGAGATTTTTGATGACTCCTGCTGTAATGGCACCCTACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCAC
CCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACGGAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCG
AGACAAACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAACCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAA
TCCCGAATATCACAATGCATCCAATGGTCCACCCAAGGCCGAGGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACAC
CTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAATGCCAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCA
CAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGACTACCTGCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCG
GCCTATTGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTCCCTGAAGCCAGGCACTGTGCTGCCGCCTCCACCTTACAGACACCGGAA

>In-frame_KANSL1L_ENST00000452086_chr2_210993755_-_ERBB4_ENST00000342788_chr2_212495319_-_3211nt
ATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTACCATGGAGTCTGACAAGATGCTCTACATG
GAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATTTCCAACTCCTGAACCTACTCTTAATACT
AATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTTTTTAATGAGATCTAATTCTACATTAAAT
AAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAACATACTGTATAATGGCAGCAACATTCAG
CTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATACCACGAGCCAGTGCATGAAAGATGTACAA
ATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTGTAAATGGTATCAAGAGAATGCACTTTTG
GATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGTACCTGGCCACTCAAATGTGCCTGTTAGT
TCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACAGAAAATTTTACTTAGCCAGGCTAGAAGA
ACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGATGAAATTGTCTATGAAACATCAACTCCCC
AAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGAAATTAAGCCAGAAGTTAACACATTGACT
GCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAATCCAAAGATTTGCATTTTCTGCTACAGGG
CTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGATTTGGATGAATATACCCTTAGAAAAAAT
GTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCGATGGACTTGGCTTCAAGCTCAGATTTCA
GACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAACTCCCCTGATTGCAGCTGGAGTAATTGG
TGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATT
CTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGAGCTGAA
GAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTGAAGGAGAAACTGTGAAGATTCCTGTGGC
TATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTGATCATGGCAAGTATGGATCATCCACA
CCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCA
CGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAGACGACT
CGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCACAGATTTTGGGCTAGCCAGACTCTTGGA
AGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGGAGTGTATACATTACAGGAAATTCACCCA
TCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAACCCTATGATGGAATTCCAACGCGAGAAAT
CCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTGGATGAT
TGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAGACCCTCAAAGATACCTAGTTATTCAGGG
TGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGATGGATGC
TGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAAGAATTGACTCGAATAGGAGTGAAATTGG
ACACAGCCCTCCTCCTGCCTACACCCCCATGTCAGGAAACCAGTTTGTATACCGAGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGT
GCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGCTACTGCTGAGATTTTTGATGACTCCTGCTGTAATGG
CACCCTACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACG
GAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAA
CCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACAATGCATCCAATGGTCCACCCAAGGCCGA
GGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAAT
GCCAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGACTACCT
GCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTC

>In-frame_KANSL1L_ENST00000452086_chr2_210993755_-_ERBB4_ENST00000402597_chr2_212495319_-_3211nt
ATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTACCATGGAGTCTGACAAGATGCTCTACATG
GAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATTTCCAACTCCTGAACCTACTCTTAATACT
AATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTTTTTAATGAGATCTAATTCTACATTAAAT
AAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAACATACTGTATAATGGCAGCAACATTCAG
CTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATACCACGAGCCAGTGCATGAAAGATGTACAA
ATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTGTAAATGGTATCAAGAGAATGCACTTTTG
GATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGTACCTGGCCACTCAAATGTGCCTGTTAGT
TCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACAGAAAATTTTACTTAGCCAGGCTAGAAGA
ACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGATGAAATTGTCTATGAAACATCAACTCCCC
AAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGAAATTAAGCCAGAAGTTAACACATTGACT
GCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAATCCAAAGATTTGCATTTTCTGCTACAGGG
CTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGATTTGGATGAATATACCCTTAGAAAAAAT
GTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCGATGGACTTGGCTTCAAGCTCAGATTTCA
GACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAACTCCCCTGATTGCAGCTGGAGTAATTGG
TGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATT
CTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGAGCTGAA
GAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTGAAGGAGAAACTGTGAAGATTCCTGTGGC
TATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTGATCATGGCAAGTATGGATCATCCACA
CCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCA
CGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAGACGACT
CGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCACAGATTTTGGGCTAGCCAGACTCTTGGA
AGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGGAGTGTATACATTACAGGAAATTCACCCA
TCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAACCCTATGATGGAATTCCAACGCGAGAAAT
CCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTGGATGAT
TGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAGACCCTCAAAGATACCTAGTTATTCAGGG
TGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGATGGATGC
TGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAAGAATTGACTCGAATAGGAGTGAAATTGG
ACACAGCCCTCCTCCTGCCTACACCCCCATGTCAGGAAACCAGTTTGTATACCGAGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGT
GCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGCTACTGCTGAGATTTTTGATGACTCCTGCTGTAATGG
CACCCTACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACG
GAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAA
CCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACAATGCATCCAATGGTCCACCCAAGGCCGA
GGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAAT
GCCAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGACTACCT
GCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_KANSL1L_ENST00000281772_chr2_210993755_-_ERBB4_ENST00000436443_chr2_212495319_-_11321nt
GAGCCGCACGGAGCTGCGGGCAGCGGGCGGACTGTTAAACCGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCCG
GGGCGGGAGCGGGGCGCGCTCTGGAGACGAGTCAGCGGCGCCCCGGGTGGGGGAGGCGGGCGGGCAGCTAGAGATCACCTCAGCAGCCCC
CACCACGGCCGGACCGAAGGTGCGGCGGCGGAGGGGAGCCAGGGCGCCCCAGCAGGTTTCCAATACTTATCTACAGGAATCGCCATGACC
CCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTACCATGGAGTCTGACAAGATGCTCTACATGGAAAGT
CCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATTTCCAACTCCTGAACCTACTCTTAATACTAATTTT
GTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTTTTTAATGAGATCTAATTCTACATTAAATAAACAC
AATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAACATACTGTATAATGGCAGCAACATTCAGCTCAGT
AAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATACCACGAGCCAGTGCATGAAAGATGTACAAATTATT
CTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTGTAAATGGTATCAAGAGAATGCACTTTTGGATAAA
GTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGTACCTGGCCACTCAAATGTGCCTGTTAGTTCTTCA
GCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACAGAAAATTTTACTTAGCCAGGCTAGAAGAACTCAG
AAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGATGAAATTGTCTATGAAACATCAACTCCCCAAAATG
AAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGAAATTAAGCCAGAAGTTAACACATTGACTGCAGAG
AATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAATCCAAAGATTTGCATTTTCTGCTACAGGGCTGTTG
TCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGATTTGGATGAATATACCCTTAGAAAAAATGTGGCA
GTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCGATGGACTTGGCTTCAAGCTCAGATTTCAGACCTA
GAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAACTCCCCTGATTGCAGCTGGAGTAATTGGTGGGCT
CTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATTCTTGGA
AACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGAGCTGAAGAGGGT
AAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTGAAGGAGAAACTGTGAAGATTCCTGTGGCTATTAA
GATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTGATCATGGCAAGTATGGATCATCCACACCTAGT
CCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCACGAGCA
CAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAGACGACTCGTTCA
TCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCACAGATTTTGGGCTAGCCAGACTCTTGGAAGGAGA
TGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGGAGTGTATACATTACAGGAAATTCACCCATCAGAG
TGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAACCCTATGATGGAATTCCAACGCGAGAAATCCCTGA
TTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTGGATGATTGATGC
TGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAGACCCTCAAAGATACCTAGTTATTCAGGGTGATGA
TCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGATGGATGCTGAGGA
GTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAAGAATTGACTCGAATAGGAACCAGTTTGTATACCG
AGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGTGCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGC
TACTGCTGAGATTTTTGATGACTCCTGCTGTAATGGCACCCTACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACCCAGAG
GTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACGGAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAA
ACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAACCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAATCCCGA
ATATCACAATGCATCCAATGGTCCACCCAAGGCCGAGGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACACCTTGGG
AAAAGCTGAGTACCTGAAGAACAACATACTGTCAATGCCAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCACAGCCT
GCCACCTCGGAGCACCCTTCAGCACCCAGACTACCTGCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTAT
TGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTCCCTGAAGCCAGGCACTGTGCTGCCGCCTCCACCTTACAGACACCGGAATACTGT
GGTGTAAGCTCAGTTGTGGTTTTTTAGGTGGAGAGACACACCTGCTCCAATTTCCCCACCCCCCTCTCTTTCTCTGGTGGTCTTCCTTCT
ACCCCAAGGCCAGTAGTTTTGACACTTCCCAGTGGAAGATACAGAGATGCAATGATAGTTATGTGCTTACCTAACTTGAACATTAGAGGG
AAAGACTGAAAGAGAAAGATAGGAGGAACCACAATGTTTCTTCATTTCTCTGCATGGGTTGGTCAGGAGAATGAAACAGCTAGAGAAGGA
CCAGAAAATGTAAGGCAATGCTGCCTACTATCAAACTAGCTGTCACTTTTTTTCTTTTTCTTTTTCTTTCTTTGTTTCTTTCTTCCTCTT
CTTTTTTTTTTTTTTTTTTAAAGCAGATGGTTGAAACACCCATGCTATCTGTTCCTATCTGCAGGAACTGATGTGTGCATATTTAGCATC
CCTGGAAATCATAATAAAGTTTCCATTAGAACAAAAGAATAACATTTTCTATAACATATGATGGTGTCTGAAATTGAGAATCCAGTTTCT
TTCCCCAGCAGTTTCTGTCCTAGCAAGTAAGAATGGCCAACTCAACTTTCATAATTTAAAAATCTCCATTAAAGTTATAACTAGTAATTA
TGTTTTCAACACTTTTTGGTTTTTTTCATTTTGTTTTGCTCTGACCGATTCCTTTATATTTGCTCCCCTATTTTTGGCTTTAATTTCTAA
TTGCAAAGATGTTTACATCAAAGCTTCTTCACAGAATTTAAGCAAGAAATATTTTAATATAGTGAAATGGCCACTACTTTAAGTATACAA
TCTTTAAAATAAGAAAGGGAGGCTAATATTTTTCATGCTATCAAATTATCTTCACCCTCATCCTTTACATTTTTCAACATTTTTTTTTCT
CCATAAATGACACTACTTGATAGGCCGTTGGTTGTCTGAAGAGTAGAAGGGAAACTAAGAGACAGTTCTCTGTGGTTCAGGAAAACTACT
GATACTTTCAGGGGTGGCCCAATGAGGGAATCCATTGAACTGGAAGAAACACACTGGATTGGGTATGTCTACCTGGCAGATACTCAGAAA
TGTAGTTTGCACTTAAGCTGTAATTTTATTTGTTCTTTTTCTGAACTCCATTTTGGATTTTGAATCAAGCAATATGGAAGCAACCAGCAA
ATTAACTAATTTAAGTACATTTTTAAAAAAAGAGCTAAGATAAAGACTGTGGAAATGCCAAACCAAGCAAATTAGGAACCTTGCAACGGT
ATCCAGGGACTATGATGAGAGGCCAGCACATTATCTTCATATGTCACCTTTGCTACGCAAGGAAATTTGTTCAGTTCGTATACTTCGTAA
GAAGGAATGCGAGTAAGGATTGGCTTGAATTCCATGGAATTTCTAGTATGAGACTATTTATATGAAGTAGAAGGTAACTCTTTGCACATA
AATTGGTATAATAAAAAGAAAAACACAAACATTCAAAGCTTAGGGATAGGTCCTTGGGTCAAAAGTTGTAAATAAATGTGAAACATCTTC
TCATGCAATTATTTTATTATCCAACACACTAATCTTTTGATACTTTATATAATTCCCTTTCTTCATATACTGCATCCAGTACTAGAACCA
TCATTATTATGTATCATTTTGAAAGAATACCTGATGAGATGAAGGATGAGAACAAATGACAGAGATGAGTCTCCAAGTAAAGGGGGCCTC
ACATCAATAATTAGGAAACTTAGATATAAGTCGCCCTTTTCTGAAAATTCTACCCCAAGTCATTTAGATTTTTAAAAAATATTTCTAATG
TTAAAATATTGGGACCAAATTAGAATCAATAGTATAAGATTAATTAATTAGAGTAAAAATATCTATTAAGGCAGAGAAAGTTTAGAGAAA
AAAATCCAAAGAAATTTGTGTTTCTTCCTATTCTGAACAAGTAAATCCATCCATCCATCCATCCAAACCTCCTTTATCTAACTGTGTCTA
CTAAAAGCACCATGTTTTGTGGGGAACACTCAGATAAATGGAATATCATCCTCAACTTCAAAATTCTATGATCTAGGAGATTTAATTAAA
ATGACATTTTAATTTTTCTATGCGTTCCAACAATCAGATTGCATAGTCTCTTTTGTGAATAGCTGTCATATAATCAGTTGTACTGTAAGA
TATCTCCTTTAAACTCATTTGGGATATAAGTTAAACATCCTTCAAATTGTTGATGTTGACAAACAGGATAATTTCAATAATATTATTCAA
ACATAAACTGGTCTAGGAGAATATTGCATCACTGACTAATTAGCCTATCTAGAGTCTAACTTCACCATTAAACCAAAAGCAGATGGTGGT
CCTTGGCCAAGAATATTGGAGACATTGGAGTTGGTTTTTTTCTAAGCTATAAGAAGTGAGGCGAGCTGAAAAAGTATGGTAGAGCAGGAG
AAGGGTTTGTGAGATTCCTTCTAGTGAAGTTCACCCTCAAACTTTTCAGGGGTAAAGACACAGAGTGATTCAGGGGCCACAATCTAATAG
CTCAGGGCTCTCCTATCCATTCAGAGAAGTCTCTAGGAAAAGGGATCTCATATCAGTACTTATGAAAAATTGAATATAAGCCTCCCTTTC
TAAATAAATCTGCATCGAGTCATCACAGCCCTCTTTTTGGATACTATACCTTGATTTTTTTTTTCTGATTTACAATATGCATATGGTTTC
TACTGGGCTATAGAAAGCAGAATCACTCATTTTGGAGAAGGAAAAAATGAATAGTTAAAACAAACTTTTAACTGTTAAGGTAACAGAAAT
GTATTTAGTGAATGTCTCTTTCCTCCTAAGAACACAAGACTTCTACATGTTGGGTAATACCTAGAGATGCATGTAGGAATAATCCAAAAT
GACCCAAATGCTTTATAATAGCACCACTTTATAATTCTTTTGAATGATTTCTGTAGTATATAATTGACTTCAGTTGTTTGAGTGTTTTTT
GTTTTATTTTTGTCCCCCCTGGGAAAACATATTTCAGCATGTATAAGAGGGAGAAAAAAAGTTTCATTCCTTCCAGAGAATAACTTATTT
AGTCCAGTAGGGTAGAATTTTAAAATGTCAGTTAAAGTCTTCAAAGTGCTTGGGGGGATATCAGATTCCAGAGGCCAATTGTAGCAATTG
AAATTTGCAGAATCAATTATGTAAATCTGAGACAAATTAGTATTAAAATTACACGGAGTATATTTTTTAAATCACCCAACTTTGTAGATT
ATACCTATTTTGGGCAGGTATGGAAAAATTTTGCAGTTAAATGATTGCCTAAAGAAAGTGGTAAACAGGTGAGGAAAGATGGCCTCTGAT
CTAGGATAGATCCAGAACCACAAAGCATCTGCACCACAAAAGGTGTTAGACTACCAAGCAGCTCCTGGTTTTCTGCATAGTATTAGTAGC
ACAGCTTAGGATGAGAATCCTTTCTCCAGTAACATTCTTAAAATAGCATGAAAAACAACGCAAAACTCAAATTTCTATTAAAACACACAA
ACTAAAATCAAGTGATTCTTTTTTGTAGATTAGGGAGAAGGACTGAATATCTAATTTAAGAGAAGGAATAGTGTTTAAGTGTTATAGTGT
GTGAGCTAATACCTTCTAAAGGAAAGACATGGCATGAAGATTGTGCATACTTACAATGCTAAGGAAAAATCAAGAAAAGGACTGTGTGAG
GCTCTGCTACTAGATGAAGTTGGAAGGACTATTAATGTGCTTCTTGAAGTATCAAAAATGAAAAGAAAATTAAAATTGTTTAAGCCTGAC
AGGGAAGGATGTAAATACAAGTTTTTCTAGAGCTCTCTAACCTTTATTTCAAAACTGGAATTATTCATCCATCTGTAATTGTTGATAATT
TAACTAGTATATGTAGTTCATAAGGTAATAGAAAAGGTGATCATGAAAGCATGTATATAACTGGACAGAACCACGATAATGCTATAAGAT
GTAGATTTAGTTAGGTTATCAGATGTTAAATGATTTTAATATTATTAAATAAATCAAACTAGAAAACTAACCACAAGTATAATGTAACAA
AGTTAAATGCAGGATATAAAAATGTAGGATGGATTTTGCATAGTAAAAAGATAAGTTTGCCATTTAAAATTGTTGTTTGTTGGGTTTAGC
TGAAAGTAGGCATATATGGTTCCACTTGGGAAAACTTGCTTTAAAGCATTACAATGAACAATTTTTTCTCATTCTCTTATTCCTTTATCA
CTTTTTAAATGTAAAGAAAATTGTATTTATTTATTTTTTTAAATAAACACCACCTTGCAGAATTTAATAGGCAAACATGTTACATATGAC
TAAGTAAGGGTCTTCAAGATGAAGTAAAGAAAATGTAAATGTTCTATTACCTTATGCAGAGACAAAAAAAAAAAGGAGTGGTGTCATTTA
GCTAGCAAACAAACAAAATACAGTTAATTGGTGATATGTCCTTTCTTTTCTCACTATGCCCTCTTGCCTCCAAAAATGACAACAAAGAAT
CACAATTTTTCTGATAAATAAATGCTAAACCAAGCGTTTCAAACTATTGCATTGCCATTCTTTTGGACTTTAGTTATTAGAATGATGATT
GTTATAGGGCAAATGAGAAATCCATGTGCATCAGCTTCTAGTTGTTAAAAAAACCAGATAAATTAACTTCTACTGTATACTGTGGGCAGA
GGATCCTAGAGCTGATCCTACAACATCAGCTTCTAGTTGTTAAAAAAAAAAAAAGAAACAGATAAATTAACTTCTACTGTATATACTGTG
GGCAGAGGATCTTACTGTGCCTCTGTTTGTGTACATGGACTTCGGTGTGTATCAGTTTGAAGGACAGCCTTGCCCCATGTAAACATATAA
ATGCAGATTGGTATCGCCTGGTTGCTATTTGCTTAAGAACAAATATTATACAGATGAGATCAGGCATAATTTTAAAAGATCATTATCAGT
GGAGACCTCATTATTACTGATATTACAATGGGGCCAGTTTTTATACTTCTGGGTAGAATTAATAAAATTTTTCTGATCCCAGAGATCTGA
GTTCTCTCTGCAGTTGGAAACAAGAAGCTGTTGTGGGCATTGTGTCGGGCCAGGGGCCCTTGTGTTTGTGTGGGCAAATATCTTTTAGCA
GTGTGAGCTGCTTTTTTCTTTTCATTAAAAGTCTCTCTAAAATAATAGAAATTTCAGATACTCGGTTCAAGTCTCACTGATTTTGTAGAG
GTCCAAAAATGTAGGATCTGTCACTTTTGCAGGCCCCTGCCTCACCTAATTCCTGGCCAGGTGACATTTTGGGCAGAAGTAAATGCTTCT
ATAGTCACAAGCTAAAATGACTCTAAGCCCCAATTTCACGGGGGGTATTCACATGCTTCCTCTGGAAAATACTCTTTGACAGTCAGCTTT
GCAAGTAAGTGATTACCTTGTTAGGAATCAAAGAAAAATGTATTTCTCTCTGACCTTTAGAGGAAAATAGAATCCTTCCCTTTTTTGCCC
ATTGACACAACTGGCACTGCTCTCTTCCCTTTCTACCACCCTGGTTCAAAGTAGTCCCCCGATGCTGTCCTGTTCCTTTCTTAAGCCATA
GTGGATCTCTGAGATCCTACACCCCACTTTGTGAAACACTGACTTCATCTTTGCCCTCGAATGCCTGATTTTTTCATAAGAGATTCTAGC
AATTTGGACACTGTTTAAGTGAACTATCAAACTACCGCATAGAGAATATTTAAGCTATTAAAATTATGGTTTCCCATGAAGATCAATTCT
CTGTGTCCTTCCCTATAGGAATTTGAGACGAGTTAGCCCTGTGATGAATCTTGAAACTCACATATGTCCACATACACTTGGTAGAACTTC
GATTTAATCTTTACATAAAAGCTGTACATATAACCAAGAAGTTATTTTTGCCAGTAAATTAACTTATTTGCTTTATTCATCTTATTTGGT
TCCTAATCGTAAATATTTTGTAGCTGCTGTAAATTTTTTTCTCCCAAATGAGGAGTCTTATTATCATAAAGGTAAAGGCTATTCAGCTTT
GATAACCACCTGCAATTCTTTTTTGGATCATTCATCCATCTAACAAATACATAATGAGGACAGTTCATGTTAATGAAAATCCATGTTGTT
TAATAGAATGCCATCCTTTACCTACTTTTGCTCTTTATGGACGTTTTTCTTTTCATGCTCTAGTGAGCTTTCCCTATATCATGAGAAGTG
GTTATATTTGTGCAAATATACAAATATAGGAAAACAAAGATTCATACCTGTAGGCAATAGTCTAACTTGTCCAAACCACTTTGCCTTTAC
TGCTATTTTTATCCCCAATGCGTAGATATTTCCCCCAGGCCTATAGCCTTTGTGAAGGAAAGCAAATCATACCTCCTGTATATTGACACG
AATCTGGTTTTCAAATGTCATTTCCAGATTTTTTAGTTAATTGGGGGTTGTCCTTTTCCCTTAATGTGAGAGTCATTTTCCTGTATATTT
CTGGATCTCTCAGGGGCTGGGAGGGGGGAGTGAGGGGACTACAACCATAGCACTCCAAGAACCCTTTTGGGATTACTCCAGTAATCAACT
ACGAAAGTTATTTTCTAAATGTAGATATGTAAGGTGTTCTTTTAAAGTAAGGTACTTTGAAATATGTAGCATAAACTGGTACTGCTGTTA
AATGGGTCGATTATTAAACGGAGCAGCTGTGTGAGGGCAGCTAACTTTGAATGCCTGTCTCCCTGGCTGGTGTGTCTCCTTCTCATGTTG
AGAGCACCAGGGATTGCGTGGCTGCATGCTGAAACCGCATTTTCCCATGGTGTATGACTAGTTCATCTCTTTCTTGAGCACCATTACAAG
AAGATCAAATGAAAATGAGATCAATGTGGAAGACAATTCATAGCACAAAAAAAGTCATCTTAAATCTACTCTCAAACATTCATCTTATAC
ATGCATCAAAGTAATTTACTGACATCAGTTTGGGTGAGAGAGGGAGTCACTTTACTGAAAAGGCAGAGGCTTAAGGTGTATACATTTGTA
CTCACTTCCTTATTTTCTTAACTTGTAAGCAGAAAACAAGCCCTCTCTCTTGTGAAGTATCTTCAAAGGATTGGGGTGCAAAAATACCTT
GCTGGTAAGCCATCAATGTTTTATTTAAATCCCTGCATTCAAAGTTAGCTGCCTTTTTGAAATAAACAAACAAAAAATACTACTGTATGT
TTGAAAATGTGAATAGTATTTTTATAGCTTGTTAAAGACATGGCTAGTTGCATTTGTAAATAAGTATAATGTTGCTTTGATTTTCTTTTG
TGGACATCTTTATTTGGAACATAATTGTCTTTAGGGTTGATTTGTATATAAGTAATTGGCCTGTGATTGTTTCTTTTTTGGTTGGAAGTT
ATCATTTTGACATTACTTGTGATTCTGTGTTCAGCACTATTGTGATGTGTTCAACCTCTGCACTCGCTTACACAATAGGATATGCCAATT
GTGTGTGGTGTAATGTTATTTTGATTTTTTTCCATGTTATTGATGAAGGATCATGCACCTAACACATACTAACTTTTTTAATGTTAGGCA
TATTTTTAGTATACTTTCTCTTATTCTTTCTTCTCCTCCAACCTTTTACCCATCCTCCTTCCTTTCCCTCATTCCTGTTGTTATTTGAGA
ATGAGGGAGAAACAGTATTTTACATTTATGTAATTAGGCTTTTCCGTTAGTTCTCAAGGATCCTCTTTTGGCTCTTGGGAAAGAATTGTA
CCTGTACAAGGCAATTATAGAATGCGAACTGCTTTGCCTCATTCCATACTGATCATCCCAGCTGAACAATTTGAAAACTGTTCTGCCTTT

>In-frame_KANSL1L_ENST00000281772_chr2_210993755_-_ERBB4_ENST00000342788_chr2_212495319_-_11369nt
GAGCCGCACGGAGCTGCGGGCAGCGGGCGGACTGTTAAACCGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCCG
GGGCGGGAGCGGGGCGCGCTCTGGAGACGAGTCAGCGGCGCCCCGGGTGGGGGAGGCGGGCGGGCAGCTAGAGATCACCTCAGCAGCCCC
CACCACGGCCGGACCGAAGGTGCGGCGGCGGAGGGGAGCCAGGGCGCCCCAGCAGGTTTCCAATACTTATCTACAGGAATCGCCATGACC
CCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTACCATGGAGTCTGACAAGATGCTCTACATGGAAAGT
CCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATTTCCAACTCCTGAACCTACTCTTAATACTAATTTT
GTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTTTTTAATGAGATCTAATTCTACATTAAATAAACAC
AATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAACATACTGTATAATGGCAGCAACATTCAGCTCAGT
AAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATACCACGAGCCAGTGCATGAAAGATGTACAAATTATT
CTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTGTAAATGGTATCAAGAGAATGCACTTTTGGATAAA
GTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGTACCTGGCCACTCAAATGTGCCTGTTAGTTCTTCA
GCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACAGAAAATTTTACTTAGCCAGGCTAGAAGAACTCAG
AAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGATGAAATTGTCTATGAAACATCAACTCCCCAAAATG
AAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGAAATTAAGCCAGAAGTTAACACATTGACTGCAGAG
AATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAATCCAAAGATTTGCATTTTCTGCTACAGGGCTGTTG
TCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGATTTGGATGAATATACCCTTAGAAAAAATGTGGCA
GTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCGATGGACTTGGCTTCAAGCTCAGATTTCAGACCTA
GAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAACTCCCCTGATTGCAGCTGGAGTAATTGGTGGGCT
CTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATTCTTGGA
AACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGAGCTGAAGAGGGT
AAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTGAAGGAGAAACTGTGAAGATTCCTGTGGCTATTAA
GATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTGATCATGGCAAGTATGGATCATCCACACCTAGT
CCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCACGAGCA
CAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAGACGACTCGTTCA
TCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCACAGATTTTGGGCTAGCCAGACTCTTGGAAGGAGA
TGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGGAGTGTATACATTACAGGAAATTCACCCATCAGAG
TGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAACCCTATGATGGAATTCCAACGCGAGAAATCCCTGA
TTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTGGATGATTGATGC
TGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAGACCCTCAAAGATACCTAGTTATTCAGGGTGATGA
TCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGATGGATGCTGAGGA
GTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAAGAATTGACTCGAATAGGAGTGAAATTGGACACAG
CCCTCCTCCTGCCTACACCCCCATGTCAGGAAACCAGTTTGTATACCGAGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGTGCCCTA
CAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGCTACTGCTGAGATTTTTGATGACTCCTGCTGTAATGGCACCCT
ACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACGGAGCCC
ACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAACCCTTT
TGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACAATGCATCCAATGGTCCACCCAAGGCCGAGGATGA
GTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAATGCCAGA
GAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGACTACCTGCAGGA
GTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTCCCTGAA
GCCAGGCACTGTGCTGCCGCCTCCACCTTACAGACACCGGAATACTGTGGTGTAAGCTCAGTTGTGGTTTTTTAGGTGGAGAGACACACC
TGCTCCAATTTCCCCACCCCCCTCTCTTTCTCTGGTGGTCTTCCTTCTACCCCAAGGCCAGTAGTTTTGACACTTCCCAGTGGAAGATAC
AGAGATGCAATGATAGTTATGTGCTTACCTAACTTGAACATTAGAGGGAAAGACTGAAAGAGAAAGATAGGAGGAACCACAATGTTTCTT
CATTTCTCTGCATGGGTTGGTCAGGAGAATGAAACAGCTAGAGAAGGACCAGAAAATGTAAGGCAATGCTGCCTACTATCAAACTAGCTG
TCACTTTTTTTCTTTTTCTTTTTCTTTCTTTGTTTCTTTCTTCCTCTTCTTTTTTTTTTTTTTTTTTAAAGCAGATGGTTGAAACACCCA
TGCTATCTGTTCCTATCTGCAGGAACTGATGTGTGCATATTTAGCATCCCTGGAAATCATAATAAAGTTTCCATTAGAACAAAAGAATAA
CATTTTCTATAACATATGATGGTGTCTGAAATTGAGAATCCAGTTTCTTTCCCCAGCAGTTTCTGTCCTAGCAAGTAAGAATGGCCAACT
CAACTTTCATAATTTAAAAATCTCCATTAAAGTTATAACTAGTAATTATGTTTTCAACACTTTTTGGTTTTTTTCATTTTGTTTTGCTCT
GACCGATTCCTTTATATTTGCTCCCCTATTTTTGGCTTTAATTTCTAATTGCAAAGATGTTTACATCAAAGCTTCTTCACAGAATTTAAG
CAAGAAATATTTTAATATAGTGAAATGGCCACTACTTTAAGTATACAATCTTTAAAATAAGAAAGGGAGGCTAATATTTTTCATGCTATC
AAATTATCTTCACCCTCATCCTTTACATTTTTCAACATTTTTTTTTCTCCATAAATGACACTACTTGATAGGCCGTTGGTTGTCTGAAGA
GTAGAAGGGAAACTAAGAGACAGTTCTCTGTGGTTCAGGAAAACTACTGATACTTTCAGGGGTGGCCCAATGAGGGAATCCATTGAACTG
GAAGAAACACACTGGATTGGGTATGTCTACCTGGCAGATACTCAGAAATGTAGTTTGCACTTAAGCTGTAATTTTATTTGTTCTTTTTCT
GAACTCCATTTTGGATTTTGAATCAAGCAATATGGAAGCAACCAGCAAATTAACTAATTTAAGTACATTTTTAAAAAAAGAGCTAAGATA
AAGACTGTGGAAATGCCAAACCAAGCAAATTAGGAACCTTGCAACGGTATCCAGGGACTATGATGAGAGGCCAGCACATTATCTTCATAT
GTCACCTTTGCTACGCAAGGAAATTTGTTCAGTTCGTATACTTCGTAAGAAGGAATGCGAGTAAGGATTGGCTTGAATTCCATGGAATTT
CTAGTATGAGACTATTTATATGAAGTAGAAGGTAACTCTTTGCACATAAATTGGTATAATAAAAAGAAAAACACAAACATTCAAAGCTTA
GGGATAGGTCCTTGGGTCAAAAGTTGTAAATAAATGTGAAACATCTTCTCATGCAATTATTTTATTATCCAACACACTAATCTTTTGATA
CTTTATATAATTCCCTTTCTTCATATACTGCATCCAGTACTAGAACCATCATTATTATGTATCATTTTGAAAGAATACCTGATGAGATGA
AGGATGAGAACAAATGACAGAGATGAGTCTCCAAGTAAAGGGGGCCTCACATCAATAATTAGGAAACTTAGATATAAGTCGCCCTTTTCT
GAAAATTCTACCCCAAGTCATTTAGATTTTTAAAAAATATTTCTAATGTTAAAATATTGGGACCAAATTAGAATCAATAGTATAAGATTA
ATTAATTAGAGTAAAAATATCTATTAAGGCAGAGAAAGTTTAGAGAAAAAAATCCAAAGAAATTTGTGTTTCTTCCTATTCTGAACAAGT
AAATCCATCCATCCATCCATCCAAACCTCCTTTATCTAACTGTGTCTACTAAAAGCACCATGTTTTGTGGGGAACACTCAGATAAATGGA
ATATCATCCTCAACTTCAAAATTCTATGATCTAGGAGATTTAATTAAAATGACATTTTAATTTTTCTATGCGTTCCAACAATCAGATTGC
ATAGTCTCTTTTGTGAATAGCTGTCATATAATCAGTTGTACTGTAAGATATCTCCTTTAAACTCATTTGGGATATAAGTTAAACATCCTT
CAAATTGTTGATGTTGACAAACAGGATAATTTCAATAATATTATTCAAACATAAACTGGTCTAGGAGAATATTGCATCACTGACTAATTA
GCCTATCTAGAGTCTAACTTCACCATTAAACCAAAAGCAGATGGTGGTCCTTGGCCAAGAATATTGGAGACATTGGAGTTGGTTTTTTTC
TAAGCTATAAGAAGTGAGGCGAGCTGAAAAAGTATGGTAGAGCAGGAGAAGGGTTTGTGAGATTCCTTCTAGTGAAGTTCACCCTCAAAC
TTTTCAGGGGTAAAGACACAGAGTGATTCAGGGGCCACAATCTAATAGCTCAGGGCTCTCCTATCCATTCAGAGAAGTCTCTAGGAAAAG
GGATCTCATATCAGTACTTATGAAAAATTGAATATAAGCCTCCCTTTCTAAATAAATCTGCATCGAGTCATCACAGCCCTCTTTTTGGAT
ACTATACCTTGATTTTTTTTTTCTGATTTACAATATGCATATGGTTTCTACTGGGCTATAGAAAGCAGAATCACTCATTTTGGAGAAGGA
AAAAATGAATAGTTAAAACAAACTTTTAACTGTTAAGGTAACAGAAATGTATTTAGTGAATGTCTCTTTCCTCCTAAGAACACAAGACTT
CTACATGTTGGGTAATACCTAGAGATGCATGTAGGAATAATCCAAAATGACCCAAATGCTTTATAATAGCACCACTTTATAATTCTTTTG
AATGATTTCTGTAGTATATAATTGACTTCAGTTGTTTGAGTGTTTTTTGTTTTATTTTTGTCCCCCCTGGGAAAACATATTTCAGCATGT
ATAAGAGGGAGAAAAAAAGTTTCATTCCTTCCAGAGAATAACTTATTTAGTCCAGTAGGGTAGAATTTTAAAATGTCAGTTAAAGTCTTC
AAAGTGCTTGGGGGGATATCAGATTCCAGAGGCCAATTGTAGCAATTGAAATTTGCAGAATCAATTATGTAAATCTGAGACAAATTAGTA
TTAAAATTACACGGAGTATATTTTTTAAATCACCCAACTTTGTAGATTATACCTATTTTGGGCAGGTATGGAAAAATTTTGCAGTTAAAT
GATTGCCTAAAGAAAGTGGTAAACAGGTGAGGAAAGATGGCCTCTGATCTAGGATAGATCCAGAACCACAAAGCATCTGCACCACAAAAG
GTGTTAGACTACCAAGCAGCTCCTGGTTTTCTGCATAGTATTAGTAGCACAGCTTAGGATGAGAATCCTTTCTCCAGTAACATTCTTAAA
ATAGCATGAAAAACAACGCAAAACTCAAATTTCTATTAAAACACACAAACTAAAATCAAGTGATTCTTTTTTGTAGATTAGGGAGAAGGA
CTGAATATCTAATTTAAGAGAAGGAATAGTGTTTAAGTGTTATAGTGTGTGAGCTAATACCTTCTAAAGGAAAGACATGGCATGAAGATT
GTGCATACTTACAATGCTAAGGAAAAATCAAGAAAAGGACTGTGTGAGGCTCTGCTACTAGATGAAGTTGGAAGGACTATTAATGTGCTT
CTTGAAGTATCAAAAATGAAAAGAAAATTAAAATTGTTTAAGCCTGACAGGGAAGGATGTAAATACAAGTTTTTCTAGAGCTCTCTAACC
TTTATTTCAAAACTGGAATTATTCATCCATCTGTAATTGTTGATAATTTAACTAGTATATGTAGTTCATAAGGTAATAGAAAAGGTGATC
ATGAAAGCATGTATATAACTGGACAGAACCACGATAATGCTATAAGATGTAGATTTAGTTAGGTTATCAGATGTTAAATGATTTTAATAT
TATTAAATAAATCAAACTAGAAAACTAACCACAAGTATAATGTAACAAAGTTAAATGCAGGATATAAAAATGTAGGATGGATTTTGCATA
GTAAAAAGATAAGTTTGCCATTTAAAATTGTTGTTTGTTGGGTTTAGCTGAAAGTAGGCATATATGGTTCCACTTGGGAAAACTTGCTTT
AAAGCATTACAATGAACAATTTTTTCTCATTCTCTTATTCCTTTATCACTTTTTAAATGTAAAGAAAATTGTATTTATTTATTTTTTTAA
ATAAACACCACCTTGCAGAATTTAATAGGCAAACATGTTACATATGACTAAGTAAGGGTCTTCAAGATGAAGTAAAGAAAATGTAAATGT
TCTATTACCTTATGCAGAGACAAAAAAAAAAAGGAGTGGTGTCATTTAGCTAGCAAACAAACAAAATACAGTTAATTGGTGATATGTCCT
TTCTTTTCTCACTATGCCCTCTTGCCTCCAAAAATGACAACAAAGAATCACAATTTTTCTGATAAATAAATGCTAAACCAAGCGTTTCAA
ACTATTGCATTGCCATTCTTTTGGACTTTAGTTATTAGAATGATGATTGTTATAGGGCAAATGAGAAATCCATGTGCATCAGCTTCTAGT
TGTTAAAAAAACCAGATAAATTAACTTCTACTGTATACTGTGGGCAGAGGATCCTAGAGCTGATCCTACAACATCAGCTTCTAGTTGTTA
AAAAAAAAAAAAGAAACAGATAAATTAACTTCTACTGTATATACTGTGGGCAGAGGATCTTACTGTGCCTCTGTTTGTGTACATGGACTT
CGGTGTGTATCAGTTTGAAGGACAGCCTTGCCCCATGTAAACATATAAATGCAGATTGGTATCGCCTGGTTGCTATTTGCTTAAGAACAA
ATATTATACAGATGAGATCAGGCATAATTTTAAAAGATCATTATCAGTGGAGACCTCATTATTACTGATATTACAATGGGGCCAGTTTTT
ATACTTCTGGGTAGAATTAATAAAATTTTTCTGATCCCAGAGATCTGAGTTCTCTCTGCAGTTGGAAACAAGAAGCTGTTGTGGGCATTG
TGTCGGGCCAGGGGCCCTTGTGTTTGTGTGGGCAAATATCTTTTAGCAGTGTGAGCTGCTTTTTTCTTTTCATTAAAAGTCTCTCTAAAA
TAATAGAAATTTCAGATACTCGGTTCAAGTCTCACTGATTTTGTAGAGGTCCAAAAATGTAGGATCTGTCACTTTTGCAGGCCCCTGCCT
CACCTAATTCCTGGCCAGGTGACATTTTGGGCAGAAGTAAATGCTTCTATAGTCACAAGCTAAAATGACTCTAAGCCCCAATTTCACGGG
GGGTATTCACATGCTTCCTCTGGAAAATACTCTTTGACAGTCAGCTTTGCAAGTAAGTGATTACCTTGTTAGGAATCAAAGAAAAATGTA
TTTCTCTCTGACCTTTAGAGGAAAATAGAATCCTTCCCTTTTTTGCCCATTGACACAACTGGCACTGCTCTCTTCCCTTTCTACCACCCT
GGTTCAAAGTAGTCCCCCGATGCTGTCCTGTTCCTTTCTTAAGCCATAGTGGATCTCTGAGATCCTACACCCCACTTTGTGAAACACTGA
CTTCATCTTTGCCCTCGAATGCCTGATTTTTTCATAAGAGATTCTAGCAATTTGGACACTGTTTAAGTGAACTATCAAACTACCGCATAG
AGAATATTTAAGCTATTAAAATTATGGTTTCCCATGAAGATCAATTCTCTGTGTCCTTCCCTATAGGAATTTGAGACGAGTTAGCCCTGT
GATGAATCTTGAAACTCACATATGTCCACATACACTTGGTAGAACTTCGATTTAATCTTTACATAAAAGCTGTACATATAACCAAGAAGT
TATTTTTGCCAGTAAATTAACTTATTTGCTTTATTCATCTTATTTGGTTCCTAATCGTAAATATTTTGTAGCTGCTGTAAATTTTTTTCT
CCCAAATGAGGAGTCTTATTATCATAAAGGTAAAGGCTATTCAGCTTTGATAACCACCTGCAATTCTTTTTTGGATCATTCATCCATCTA
ACAAATACATAATGAGGACAGTTCATGTTAATGAAAATCCATGTTGTTTAATAGAATGCCATCCTTTACCTACTTTTGCTCTTTATGGAC
GTTTTTCTTTTCATGCTCTAGTGAGCTTTCCCTATATCATGAGAAGTGGTTATATTTGTGCAAATATACAAATATAGGAAAACAAAGATT
CATACCTGTAGGCAATAGTCTAACTTGTCCAAACCACTTTGCCTTTACTGCTATTTTTATCCCCAATGCGTAGATATTTCCCCCAGGCCT
ATAGCCTTTGTGAAGGAAAGCAAATCATACCTCCTGTATATTGACACGAATCTGGTTTTCAAATGTCATTTCCAGATTTTTTAGTTAATT
GGGGGTTGTCCTTTTCCCTTAATGTGAGAGTCATTTTCCTGTATATTTCTGGATCTCTCAGGGGCTGGGAGGGGGGAGTGAGGGGACTAC
AACCATAGCACTCCAAGAACCCTTTTGGGATTACTCCAGTAATCAACTACGAAAGTTATTTTCTAAATGTAGATATGTAAGGTGTTCTTT
TAAAGTAAGGTACTTTGAAATATGTAGCATAAACTGGTACTGCTGTTAAATGGGTCGATTATTAAACGGAGCAGCTGTGTGAGGGCAGCT
AACTTTGAATGCCTGTCTCCCTGGCTGGTGTGTCTCCTTCTCATGTTGAGAGCACCAGGGATTGCGTGGCTGCATGCTGAAACCGCATTT
TCCCATGGTGTATGACTAGTTCATCTCTTTCTTGAGCACCATTACAAGAAGATCAAATGAAAATGAGATCAATGTGGAAGACAATTCATA
GCACAAAAAAAGTCATCTTAAATCTACTCTCAAACATTCATCTTATACATGCATCAAAGTAATTTACTGACATCAGTTTGGGTGAGAGAG
GGAGTCACTTTACTGAAAAGGCAGAGGCTTAAGGTGTATACATTTGTACTCACTTCCTTATTTTCTTAACTTGTAAGCAGAAAACAAGCC
CTCTCTCTTGTGAAGTATCTTCAAAGGATTGGGGTGCAAAAATACCTTGCTGGTAAGCCATCAATGTTTTATTTAAATCCCTGCATTCAA
AGTTAGCTGCCTTTTTGAAATAAACAAACAAAAAATACTACTGTATGTTTGAAAATGTGAATAGTATTTTTATAGCTTGTTAAAGACATG
GCTAGTTGCATTTGTAAATAAGTATAATGTTGCTTTGATTTTCTTTTGTGGACATCTTTATTTGGAACATAATTGTCTTTAGGGTTGATT
TGTATATAAGTAATTGGCCTGTGATTGTTTCTTTTTTGGTTGGAAGTTATCATTTTGACATTACTTGTGATTCTGTGTTCAGCACTATTG
TGATGTGTTCAACCTCTGCACTCGCTTACACAATAGGATATGCCAATTGTGTGTGGTGTAATGTTATTTTGATTTTTTTCCATGTTATTG
ATGAAGGATCATGCACCTAACACATACTAACTTTTTTAATGTTAGGCATATTTTTAGTATACTTTCTCTTATTCTTTCTTCTCCTCCAAC
CTTTTACCCATCCTCCTTCCTTTCCCTCATTCCTGTTGTTATTTGAGAATGAGGGAGAAACAGTATTTTACATTTATGTAATTAGGCTTT
TCCGTTAGTTCTCAAGGATCCTCTTTTGGCTCTTGGGAAAGAATTGTACCTGTACAAGGCAATTATAGAATGCGAACTGCTTTGCCTCAT
TCCATACTGATCATCCCAGCTGAACAATTTGAAAACTGTTCTGCCTTTTTGTTACATGAATCTGTCAGAAATATATTTTTAATTTAATAT

>In-frame_KANSL1L_ENST00000281772_chr2_210993755_-_ERBB4_ENST00000402597_chr2_212495319_-_3475nt
GAGCCGCACGGAGCTGCGGGCAGCGGGCGGACTGTTAAACCGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCCG
GGGCGGGAGCGGGGCGCGCTCTGGAGACGAGTCAGCGGCGCCCCGGGTGGGGGAGGCGGGCGGGCAGCTAGAGATCACCTCAGCAGCCCC
CACCACGGCCGGACCGAAGGTGCGGCGGCGGAGGGGAGCCAGGGCGCCCCAGCAGGTTTCCAATACTTATCTACAGGAATCGCCATGACC
CCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTACCATGGAGTCTGACAAGATGCTCTACATGGAAAGT
CCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATTTCCAACTCCTGAACCTACTCTTAATACTAATTTT
GTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTTTTTAATGAGATCTAATTCTACATTAAATAAACAC
AATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAACATACTGTATAATGGCAGCAACATTCAGCTCAGT
AAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATACCACGAGCCAGTGCATGAAAGATGTACAAATTATT
CTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTGTAAATGGTATCAAGAGAATGCACTTTTGGATAAA
GTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGTACCTGGCCACTCAAATGTGCCTGTTAGTTCTTCA
GCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACAGAAAATTTTACTTAGCCAGGCTAGAAGAACTCAG
AAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGATGAAATTGTCTATGAAACATCAACTCCCCAAAATG
AAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGAAATTAAGCCAGAAGTTAACACATTGACTGCAGAG
AATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAATCCAAAGATTTGCATTTTCTGCTACAGGGCTGTTG
TCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGATTTGGATGAATATACCCTTAGAAAAAATGTGGCA
GTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCGATGGACTTGGCTTCAAGCTCAGATTTCAGACCTA
GAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAACTCCCCTGATTGCAGCTGGAGTAATTGGTGGGCT
CTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCATCAAAAAGAAAAGAGCCTTGAGAAGATTCTTGGA
AACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAACTTCGTATTTTGAAAGAAACTGAGCTGAAGAGGGT
AAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTGAAGGAGAAACTGTGAAGATTCCTGTGGCTATTAA
GATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTCTGATCATGGCAAGTATGGATCATCCACACCTAGT
CCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGCCCCATGGCTGCCTGTTGGAGTATGTCCACGAGCA
CAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGGGAATGATGTACCTGGAAGAAAGACGACTCGTTCA
TCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCACAGATTTTGGGCTAGCCAGACTCTTGGAAGGAGA
TGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGGAGTGTATACATTACAGGAAATTCACCCATCAGAG
TGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAACCCTATGATGGAATTCCAACGCGAGAAATCCCTGA
TTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTTACATGGTCATGGTCAAATGTTGGATGATTGATGC
TGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAGACCCTCAAAGATACCTAGTTATTCAGGGTGATGA
TCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATGAAGAGGATTTGGAAGATATGATGGATGCTGAGGA
GTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAAGAATTGACTCGAATAGGAGTGAAATTGGACACAG
CCCTCCTCCTGCCTACACCCCCATGTCAGGAAACCAGTTTGTATACCGAGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGTGCCCTA
CAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGCTACTGCTGAGATTTTTGATGACTCCTGCTGTAATGGCACCCT
ACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACGGAGCCC
ACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAACCCTTT
TGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACAATGCATCCAATGGTCCACCCAAGGCCGAGGATGA
GTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAATGCCAGA
GAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGACTACCTGCAGGA
GTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTCCCTGAA

>In-frame_KANSL1L_ENST00000418791_chr2_210993755_-_ERBB4_ENST00000436443_chr2_212495319_-_11265nt
GCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCCGGGGCGGGAGCGGGGCGCGCTCTGGAGACGAGTCAGCGGCGCCCCGGGTGGGGGAGG
CGGGCGGGCAGCTAGAGATCACCTCAGCAGCCCCCACCACGGCCGGACCGAAGGTGCGGCGGCGGAGGGGAGCCAGGGCGCCCCAGCAGG
TTTCCAATACTTATCTACAGGAATCGCCATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTAC
CATGGAGTCTGACAAGATGCTCTACATGGAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATT
TCCAACTCCTGAACCTACTCTTAATACTAATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTT
TTTAATGAGATCTAATTCTACATTAAATAAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAA
CATACTGTATAATGGCAGCAACATTCAGCTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATAC
CACGAGCCAGTGCATGAAAGATGTACAAATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTG
TAAATGGTATCAAGAGAATGCACTTTTGGATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGT
ACCTGGCCACTCAAATGTGCCTGTTAGTTCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACA
GAAAATTTTACTTAGCCAGGCTAGAAGAACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGAT
GAAATTGTCTATGAAACATCAACTCCCCAAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGA
AATTAAGCCAGAAGTTAACACATTGACTGCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAAT
CCAAAGATTTGCATTTTCTGCTACAGGGCTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGA
TTTGGATGAATATACCCTTAGAAAAAATGTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCG
ATGGACTTGGCTTCAAGCTCAGATTTCAGACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAA
CTCCCCTGATTGCAGCTGGAGTAATTGGTGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCA
TCAAAAAGAAAAGAGCCTTGAGAAGATTCTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAAC
TTCGTATTTTGAAAGAAACTGAGCTGAAGAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTG
AAGGAGAAACTGTGAAGATTCCTGTGGCTATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTC
TGATCATGGCAAGTATGGATCATCCACACCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGC
CCCATGGCTGCCTGTTGGAGTATGTCCACGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGG
GAATGATGTACCTGGAAGAAAGACGACTCGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCA
CAGATTTTGGGCTAGCCAGACTCTTGGAAGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGG
AGTGTATACATTACAGGAAATTCACCCATCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAAC
CCTATGATGGAATTCCAACGCGAGAAATCCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTT
ACATGGTCATGGTCAAATGTTGGATGATTGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAG
ACCCTCAAAGATACCTAGTTATTCAGGGTGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATG
AAGAGGATTTGGAAGATATGATGGATGCTGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAA
GAATTGACTCGAATAGGAACCAGTTTGTATACCGAGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGTGCCCTACAGAGCCCCAACTA
GCACAATTCCAGAAGCTCCTGTGGCACAGGGTGCTACTGCTGAGATTTTTGATGACTCCTGCTGTAATGGCACCCTACGCAAGCCAGTGG
CACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACGGAGCCCACGAGGAGAGCTGG
ATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAACCCTTTTGTTTCTCGGAGAA
AAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACAATGCATCCAATGGTCCACCCAAGGCCGAGGATGAGTATGTGAATGAGC
CACTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAATGCCAGAGAAGGCCAAGAAAG
CGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGACTACCTGCAGGAGTACAGCACAAAAT
ATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTCCCTGAAGCCAGGCACTGTGC
TGCCGCCTCCACCTTACAGACACCGGAATACTGTGGTGTAAGCTCAGTTGTGGTTTTTTAGGTGGAGAGACACACCTGCTCCAATTTCCC
CACCCCCCTCTCTTTCTCTGGTGGTCTTCCTTCTACCCCAAGGCCAGTAGTTTTGACACTTCCCAGTGGAAGATACAGAGATGCAATGAT
AGTTATGTGCTTACCTAACTTGAACATTAGAGGGAAAGACTGAAAGAGAAAGATAGGAGGAACCACAATGTTTCTTCATTTCTCTGCATG
GGTTGGTCAGGAGAATGAAACAGCTAGAGAAGGACCAGAAAATGTAAGGCAATGCTGCCTACTATCAAACTAGCTGTCACTTTTTTTCTT
TTTCTTTTTCTTTCTTTGTTTCTTTCTTCCTCTTCTTTTTTTTTTTTTTTTTTAAAGCAGATGGTTGAAACACCCATGCTATCTGTTCCT
ATCTGCAGGAACTGATGTGTGCATATTTAGCATCCCTGGAAATCATAATAAAGTTTCCATTAGAACAAAAGAATAACATTTTCTATAACA
TATGATGGTGTCTGAAATTGAGAATCCAGTTTCTTTCCCCAGCAGTTTCTGTCCTAGCAAGTAAGAATGGCCAACTCAACTTTCATAATT
TAAAAATCTCCATTAAAGTTATAACTAGTAATTATGTTTTCAACACTTTTTGGTTTTTTTCATTTTGTTTTGCTCTGACCGATTCCTTTA
TATTTGCTCCCCTATTTTTGGCTTTAATTTCTAATTGCAAAGATGTTTACATCAAAGCTTCTTCACAGAATTTAAGCAAGAAATATTTTA
ATATAGTGAAATGGCCACTACTTTAAGTATACAATCTTTAAAATAAGAAAGGGAGGCTAATATTTTTCATGCTATCAAATTATCTTCACC
CTCATCCTTTACATTTTTCAACATTTTTTTTTCTCCATAAATGACACTACTTGATAGGCCGTTGGTTGTCTGAAGAGTAGAAGGGAAACT
AAGAGACAGTTCTCTGTGGTTCAGGAAAACTACTGATACTTTCAGGGGTGGCCCAATGAGGGAATCCATTGAACTGGAAGAAACACACTG
GATTGGGTATGTCTACCTGGCAGATACTCAGAAATGTAGTTTGCACTTAAGCTGTAATTTTATTTGTTCTTTTTCTGAACTCCATTTTGG
ATTTTGAATCAAGCAATATGGAAGCAACCAGCAAATTAACTAATTTAAGTACATTTTTAAAAAAAGAGCTAAGATAAAGACTGTGGAAAT
GCCAAACCAAGCAAATTAGGAACCTTGCAACGGTATCCAGGGACTATGATGAGAGGCCAGCACATTATCTTCATATGTCACCTTTGCTAC
GCAAGGAAATTTGTTCAGTTCGTATACTTCGTAAGAAGGAATGCGAGTAAGGATTGGCTTGAATTCCATGGAATTTCTAGTATGAGACTA
TTTATATGAAGTAGAAGGTAACTCTTTGCACATAAATTGGTATAATAAAAAGAAAAACACAAACATTCAAAGCTTAGGGATAGGTCCTTG
GGTCAAAAGTTGTAAATAAATGTGAAACATCTTCTCATGCAATTATTTTATTATCCAACACACTAATCTTTTGATACTTTATATAATTCC
CTTTCTTCATATACTGCATCCAGTACTAGAACCATCATTATTATGTATCATTTTGAAAGAATACCTGATGAGATGAAGGATGAGAACAAA
TGACAGAGATGAGTCTCCAAGTAAAGGGGGCCTCACATCAATAATTAGGAAACTTAGATATAAGTCGCCCTTTTCTGAAAATTCTACCCC
AAGTCATTTAGATTTTTAAAAAATATTTCTAATGTTAAAATATTGGGACCAAATTAGAATCAATAGTATAAGATTAATTAATTAGAGTAA
AAATATCTATTAAGGCAGAGAAAGTTTAGAGAAAAAAATCCAAAGAAATTTGTGTTTCTTCCTATTCTGAACAAGTAAATCCATCCATCC
ATCCATCCAAACCTCCTTTATCTAACTGTGTCTACTAAAAGCACCATGTTTTGTGGGGAACACTCAGATAAATGGAATATCATCCTCAAC
TTCAAAATTCTATGATCTAGGAGATTTAATTAAAATGACATTTTAATTTTTCTATGCGTTCCAACAATCAGATTGCATAGTCTCTTTTGT
GAATAGCTGTCATATAATCAGTTGTACTGTAAGATATCTCCTTTAAACTCATTTGGGATATAAGTTAAACATCCTTCAAATTGTTGATGT
TGACAAACAGGATAATTTCAATAATATTATTCAAACATAAACTGGTCTAGGAGAATATTGCATCACTGACTAATTAGCCTATCTAGAGTC
TAACTTCACCATTAAACCAAAAGCAGATGGTGGTCCTTGGCCAAGAATATTGGAGACATTGGAGTTGGTTTTTTTCTAAGCTATAAGAAG
TGAGGCGAGCTGAAAAAGTATGGTAGAGCAGGAGAAGGGTTTGTGAGATTCCTTCTAGTGAAGTTCACCCTCAAACTTTTCAGGGGTAAA
GACACAGAGTGATTCAGGGGCCACAATCTAATAGCTCAGGGCTCTCCTATCCATTCAGAGAAGTCTCTAGGAAAAGGGATCTCATATCAG
TACTTATGAAAAATTGAATATAAGCCTCCCTTTCTAAATAAATCTGCATCGAGTCATCACAGCCCTCTTTTTGGATACTATACCTTGATT
TTTTTTTTCTGATTTACAATATGCATATGGTTTCTACTGGGCTATAGAAAGCAGAATCACTCATTTTGGAGAAGGAAAAAATGAATAGTT
AAAACAAACTTTTAACTGTTAAGGTAACAGAAATGTATTTAGTGAATGTCTCTTTCCTCCTAAGAACACAAGACTTCTACATGTTGGGTA
ATACCTAGAGATGCATGTAGGAATAATCCAAAATGACCCAAATGCTTTATAATAGCACCACTTTATAATTCTTTTGAATGATTTCTGTAG
TATATAATTGACTTCAGTTGTTTGAGTGTTTTTTGTTTTATTTTTGTCCCCCCTGGGAAAACATATTTCAGCATGTATAAGAGGGAGAAA
AAAAGTTTCATTCCTTCCAGAGAATAACTTATTTAGTCCAGTAGGGTAGAATTTTAAAATGTCAGTTAAAGTCTTCAAAGTGCTTGGGGG
GATATCAGATTCCAGAGGCCAATTGTAGCAATTGAAATTTGCAGAATCAATTATGTAAATCTGAGACAAATTAGTATTAAAATTACACGG
AGTATATTTTTTAAATCACCCAACTTTGTAGATTATACCTATTTTGGGCAGGTATGGAAAAATTTTGCAGTTAAATGATTGCCTAAAGAA
AGTGGTAAACAGGTGAGGAAAGATGGCCTCTGATCTAGGATAGATCCAGAACCACAAAGCATCTGCACCACAAAAGGTGTTAGACTACCA
AGCAGCTCCTGGTTTTCTGCATAGTATTAGTAGCACAGCTTAGGATGAGAATCCTTTCTCCAGTAACATTCTTAAAATAGCATGAAAAAC
AACGCAAAACTCAAATTTCTATTAAAACACACAAACTAAAATCAAGTGATTCTTTTTTGTAGATTAGGGAGAAGGACTGAATATCTAATT
TAAGAGAAGGAATAGTGTTTAAGTGTTATAGTGTGTGAGCTAATACCTTCTAAAGGAAAGACATGGCATGAAGATTGTGCATACTTACAA
TGCTAAGGAAAAATCAAGAAAAGGACTGTGTGAGGCTCTGCTACTAGATGAAGTTGGAAGGACTATTAATGTGCTTCTTGAAGTATCAAA
AATGAAAAGAAAATTAAAATTGTTTAAGCCTGACAGGGAAGGATGTAAATACAAGTTTTTCTAGAGCTCTCTAACCTTTATTTCAAAACT
GGAATTATTCATCCATCTGTAATTGTTGATAATTTAACTAGTATATGTAGTTCATAAGGTAATAGAAAAGGTGATCATGAAAGCATGTAT
ATAACTGGACAGAACCACGATAATGCTATAAGATGTAGATTTAGTTAGGTTATCAGATGTTAAATGATTTTAATATTATTAAATAAATCA
AACTAGAAAACTAACCACAAGTATAATGTAACAAAGTTAAATGCAGGATATAAAAATGTAGGATGGATTTTGCATAGTAAAAAGATAAGT
TTGCCATTTAAAATTGTTGTTTGTTGGGTTTAGCTGAAAGTAGGCATATATGGTTCCACTTGGGAAAACTTGCTTTAAAGCATTACAATG
AACAATTTTTTCTCATTCTCTTATTCCTTTATCACTTTTTAAATGTAAAGAAAATTGTATTTATTTATTTTTTTAAATAAACACCACCTT
GCAGAATTTAATAGGCAAACATGTTACATATGACTAAGTAAGGGTCTTCAAGATGAAGTAAAGAAAATGTAAATGTTCTATTACCTTATG
CAGAGACAAAAAAAAAAAGGAGTGGTGTCATTTAGCTAGCAAACAAACAAAATACAGTTAATTGGTGATATGTCCTTTCTTTTCTCACTA
TGCCCTCTTGCCTCCAAAAATGACAACAAAGAATCACAATTTTTCTGATAAATAAATGCTAAACCAAGCGTTTCAAACTATTGCATTGCC
ATTCTTTTGGACTTTAGTTATTAGAATGATGATTGTTATAGGGCAAATGAGAAATCCATGTGCATCAGCTTCTAGTTGTTAAAAAAACCA
GATAAATTAACTTCTACTGTATACTGTGGGCAGAGGATCCTAGAGCTGATCCTACAACATCAGCTTCTAGTTGTTAAAAAAAAAAAAAGA
AACAGATAAATTAACTTCTACTGTATATACTGTGGGCAGAGGATCTTACTGTGCCTCTGTTTGTGTACATGGACTTCGGTGTGTATCAGT
TTGAAGGACAGCCTTGCCCCATGTAAACATATAAATGCAGATTGGTATCGCCTGGTTGCTATTTGCTTAAGAACAAATATTATACAGATG
AGATCAGGCATAATTTTAAAAGATCATTATCAGTGGAGACCTCATTATTACTGATATTACAATGGGGCCAGTTTTTATACTTCTGGGTAG
AATTAATAAAATTTTTCTGATCCCAGAGATCTGAGTTCTCTCTGCAGTTGGAAACAAGAAGCTGTTGTGGGCATTGTGTCGGGCCAGGGG
CCCTTGTGTTTGTGTGGGCAAATATCTTTTAGCAGTGTGAGCTGCTTTTTTCTTTTCATTAAAAGTCTCTCTAAAATAATAGAAATTTCA
GATACTCGGTTCAAGTCTCACTGATTTTGTAGAGGTCCAAAAATGTAGGATCTGTCACTTTTGCAGGCCCCTGCCTCACCTAATTCCTGG
CCAGGTGACATTTTGGGCAGAAGTAAATGCTTCTATAGTCACAAGCTAAAATGACTCTAAGCCCCAATTTCACGGGGGGTATTCACATGC
TTCCTCTGGAAAATACTCTTTGACAGTCAGCTTTGCAAGTAAGTGATTACCTTGTTAGGAATCAAAGAAAAATGTATTTCTCTCTGACCT
TTAGAGGAAAATAGAATCCTTCCCTTTTTTGCCCATTGACACAACTGGCACTGCTCTCTTCCCTTTCTACCACCCTGGTTCAAAGTAGTC
CCCCGATGCTGTCCTGTTCCTTTCTTAAGCCATAGTGGATCTCTGAGATCCTACACCCCACTTTGTGAAACACTGACTTCATCTTTGCCC
TCGAATGCCTGATTTTTTCATAAGAGATTCTAGCAATTTGGACACTGTTTAAGTGAACTATCAAACTACCGCATAGAGAATATTTAAGCT
ATTAAAATTATGGTTTCCCATGAAGATCAATTCTCTGTGTCCTTCCCTATAGGAATTTGAGACGAGTTAGCCCTGTGATGAATCTTGAAA
CTCACATATGTCCACATACACTTGGTAGAACTTCGATTTAATCTTTACATAAAAGCTGTACATATAACCAAGAAGTTATTTTTGCCAGTA
AATTAACTTATTTGCTTTATTCATCTTATTTGGTTCCTAATCGTAAATATTTTGTAGCTGCTGTAAATTTTTTTCTCCCAAATGAGGAGT
CTTATTATCATAAAGGTAAAGGCTATTCAGCTTTGATAACCACCTGCAATTCTTTTTTGGATCATTCATCCATCTAACAAATACATAATG
AGGACAGTTCATGTTAATGAAAATCCATGTTGTTTAATAGAATGCCATCCTTTACCTACTTTTGCTCTTTATGGACGTTTTTCTTTTCAT
GCTCTAGTGAGCTTTCCCTATATCATGAGAAGTGGTTATATTTGTGCAAATATACAAATATAGGAAAACAAAGATTCATACCTGTAGGCA
ATAGTCTAACTTGTCCAAACCACTTTGCCTTTACTGCTATTTTTATCCCCAATGCGTAGATATTTCCCCCAGGCCTATAGCCTTTGTGAA
GGAAAGCAAATCATACCTCCTGTATATTGACACGAATCTGGTTTTCAAATGTCATTTCCAGATTTTTTAGTTAATTGGGGGTTGTCCTTT
TCCCTTAATGTGAGAGTCATTTTCCTGTATATTTCTGGATCTCTCAGGGGCTGGGAGGGGGGAGTGAGGGGACTACAACCATAGCACTCC
AAGAACCCTTTTGGGATTACTCCAGTAATCAACTACGAAAGTTATTTTCTAAATGTAGATATGTAAGGTGTTCTTTTAAAGTAAGGTACT
TTGAAATATGTAGCATAAACTGGTACTGCTGTTAAATGGGTCGATTATTAAACGGAGCAGCTGTGTGAGGGCAGCTAACTTTGAATGCCT
GTCTCCCTGGCTGGTGTGTCTCCTTCTCATGTTGAGAGCACCAGGGATTGCGTGGCTGCATGCTGAAACCGCATTTTCCCATGGTGTATG
ACTAGTTCATCTCTTTCTTGAGCACCATTACAAGAAGATCAAATGAAAATGAGATCAATGTGGAAGACAATTCATAGCACAAAAAAAGTC
ATCTTAAATCTACTCTCAAACATTCATCTTATACATGCATCAAAGTAATTTACTGACATCAGTTTGGGTGAGAGAGGGAGTCACTTTACT
GAAAAGGCAGAGGCTTAAGGTGTATACATTTGTACTCACTTCCTTATTTTCTTAACTTGTAAGCAGAAAACAAGCCCTCTCTCTTGTGAA
GTATCTTCAAAGGATTGGGGTGCAAAAATACCTTGCTGGTAAGCCATCAATGTTTTATTTAAATCCCTGCATTCAAAGTTAGCTGCCTTT
TTGAAATAAACAAACAAAAAATACTACTGTATGTTTGAAAATGTGAATAGTATTTTTATAGCTTGTTAAAGACATGGCTAGTTGCATTTG
TAAATAAGTATAATGTTGCTTTGATTTTCTTTTGTGGACATCTTTATTTGGAACATAATTGTCTTTAGGGTTGATTTGTATATAAGTAAT
TGGCCTGTGATTGTTTCTTTTTTGGTTGGAAGTTATCATTTTGACATTACTTGTGATTCTGTGTTCAGCACTATTGTGATGTGTTCAACC
TCTGCACTCGCTTACACAATAGGATATGCCAATTGTGTGTGGTGTAATGTTATTTTGATTTTTTTCCATGTTATTGATGAAGGATCATGC
ACCTAACACATACTAACTTTTTTAATGTTAGGCATATTTTTAGTATACTTTCTCTTATTCTTTCTTCTCCTCCAACCTTTTACCCATCCT
CCTTCCTTTCCCTCATTCCTGTTGTTATTTGAGAATGAGGGAGAAACAGTATTTTACATTTATGTAATTAGGCTTTTCCGTTAGTTCTCA
AGGATCCTCTTTTGGCTCTTGGGAAAGAATTGTACCTGTACAAGGCAATTATAGAATGCGAACTGCTTTGCCTCATTCCATACTGATCAT
CCCAGCTGAACAATTTGAAAACTGTTCTGCCTTTTTGTTACATGAATCTGTCAGAAATATATTTTTAATTTAATATAAATGAAATTCAAT

>In-frame_KANSL1L_ENST00000418791_chr2_210993755_-_ERBB4_ENST00000342788_chr2_212495319_-_11313nt
GCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCCGGGGCGGGAGCGGGGCGCGCTCTGGAGACGAGTCAGCGGCGCCCCGGGTGGGGGAGG
CGGGCGGGCAGCTAGAGATCACCTCAGCAGCCCCCACCACGGCCGGACCGAAGGTGCGGCGGCGGAGGGGAGCCAGGGCGCCCCAGCAGG
TTTCCAATACTTATCTACAGGAATCGCCATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTAC
CATGGAGTCTGACAAGATGCTCTACATGGAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATT
TCCAACTCCTGAACCTACTCTTAATACTAATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTT
TTTAATGAGATCTAATTCTACATTAAATAAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAA
CATACTGTATAATGGCAGCAACATTCAGCTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATAC
CACGAGCCAGTGCATGAAAGATGTACAAATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTG
TAAATGGTATCAAGAGAATGCACTTTTGGATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGT
ACCTGGCCACTCAAATGTGCCTGTTAGTTCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACA
GAAAATTTTACTTAGCCAGGCTAGAAGAACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGAT
GAAATTGTCTATGAAACATCAACTCCCCAAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGA
AATTAAGCCAGAAGTTAACACATTGACTGCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAAT
CCAAAGATTTGCATTTTCTGCTACAGGGCTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGA
TTTGGATGAATATACCCTTAGAAAAAATGTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCG
ATGGACTTGGCTTCAAGCTCAGATTTCAGACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAA
CTCCCCTGATTGCAGCTGGAGTAATTGGTGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCA
TCAAAAAGAAAAGAGCCTTGAGAAGATTCTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAAC
TTCGTATTTTGAAAGAAACTGAGCTGAAGAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTG
AAGGAGAAACTGTGAAGATTCCTGTGGCTATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTC
TGATCATGGCAAGTATGGATCATCCACACCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGC
CCCATGGCTGCCTGTTGGAGTATGTCCACGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGG
GAATGATGTACCTGGAAGAAAGACGACTCGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCA
CAGATTTTGGGCTAGCCAGACTCTTGGAAGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGG
AGTGTATACATTACAGGAAATTCACCCATCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAAC
CCTATGATGGAATTCCAACGCGAGAAATCCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTT
ACATGGTCATGGTCAAATGTTGGATGATTGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAG
ACCCTCAAAGATACCTAGTTATTCAGGGTGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATG
AAGAGGATTTGGAAGATATGATGGATGCTGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAA
GAATTGACTCGAATAGGAGTGAAATTGGACACAGCCCTCCTCCTGCCTACACCCCCATGTCAGGAAACCAGTTTGTATACCGAGATGGAG
GTTTTGCTGCTGAACAAGGAGTGTCTGTGCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGCTACTGCTG
AGATTTTTGATGACTCCTGCTGTAATGGCACCCTACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTG
CTGACCCCACCGTGTTTGCCCCAGAACGGAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAAC
AAGAATACCTGAATCCAGTGGAGGAGAACCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACA
ATGCATCCAATGGTCCACCCAAGGCCGAGGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTG
AGTACCTGAAGAACAACATACTGTCAATGCCAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTC
GGAGCACCCTTCAGCACCCAGACTACCTGCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAG
AGAATCCTGAATACCTCTCTGAGTTCTCCCTGAAGCCAGGCACTGTGCTGCCGCCTCCACCTTACAGACACCGGAATACTGTGGTGTAAG
CTCAGTTGTGGTTTTTTAGGTGGAGAGACACACCTGCTCCAATTTCCCCACCCCCCTCTCTTTCTCTGGTGGTCTTCCTTCTACCCCAAG
GCCAGTAGTTTTGACACTTCCCAGTGGAAGATACAGAGATGCAATGATAGTTATGTGCTTACCTAACTTGAACATTAGAGGGAAAGACTG
AAAGAGAAAGATAGGAGGAACCACAATGTTTCTTCATTTCTCTGCATGGGTTGGTCAGGAGAATGAAACAGCTAGAGAAGGACCAGAAAA
TGTAAGGCAATGCTGCCTACTATCAAACTAGCTGTCACTTTTTTTCTTTTTCTTTTTCTTTCTTTGTTTCTTTCTTCCTCTTCTTTTTTT
TTTTTTTTTTTAAAGCAGATGGTTGAAACACCCATGCTATCTGTTCCTATCTGCAGGAACTGATGTGTGCATATTTAGCATCCCTGGAAA
TCATAATAAAGTTTCCATTAGAACAAAAGAATAACATTTTCTATAACATATGATGGTGTCTGAAATTGAGAATCCAGTTTCTTTCCCCAG
CAGTTTCTGTCCTAGCAAGTAAGAATGGCCAACTCAACTTTCATAATTTAAAAATCTCCATTAAAGTTATAACTAGTAATTATGTTTTCA
ACACTTTTTGGTTTTTTTCATTTTGTTTTGCTCTGACCGATTCCTTTATATTTGCTCCCCTATTTTTGGCTTTAATTTCTAATTGCAAAG
ATGTTTACATCAAAGCTTCTTCACAGAATTTAAGCAAGAAATATTTTAATATAGTGAAATGGCCACTACTTTAAGTATACAATCTTTAAA
ATAAGAAAGGGAGGCTAATATTTTTCATGCTATCAAATTATCTTCACCCTCATCCTTTACATTTTTCAACATTTTTTTTTCTCCATAAAT
GACACTACTTGATAGGCCGTTGGTTGTCTGAAGAGTAGAAGGGAAACTAAGAGACAGTTCTCTGTGGTTCAGGAAAACTACTGATACTTT
CAGGGGTGGCCCAATGAGGGAATCCATTGAACTGGAAGAAACACACTGGATTGGGTATGTCTACCTGGCAGATACTCAGAAATGTAGTTT
GCACTTAAGCTGTAATTTTATTTGTTCTTTTTCTGAACTCCATTTTGGATTTTGAATCAAGCAATATGGAAGCAACCAGCAAATTAACTA
ATTTAAGTACATTTTTAAAAAAAGAGCTAAGATAAAGACTGTGGAAATGCCAAACCAAGCAAATTAGGAACCTTGCAACGGTATCCAGGG
ACTATGATGAGAGGCCAGCACATTATCTTCATATGTCACCTTTGCTACGCAAGGAAATTTGTTCAGTTCGTATACTTCGTAAGAAGGAAT
GCGAGTAAGGATTGGCTTGAATTCCATGGAATTTCTAGTATGAGACTATTTATATGAAGTAGAAGGTAACTCTTTGCACATAAATTGGTA
TAATAAAAAGAAAAACACAAACATTCAAAGCTTAGGGATAGGTCCTTGGGTCAAAAGTTGTAAATAAATGTGAAACATCTTCTCATGCAA
TTATTTTATTATCCAACACACTAATCTTTTGATACTTTATATAATTCCCTTTCTTCATATACTGCATCCAGTACTAGAACCATCATTATT
ATGTATCATTTTGAAAGAATACCTGATGAGATGAAGGATGAGAACAAATGACAGAGATGAGTCTCCAAGTAAAGGGGGCCTCACATCAAT
AATTAGGAAACTTAGATATAAGTCGCCCTTTTCTGAAAATTCTACCCCAAGTCATTTAGATTTTTAAAAAATATTTCTAATGTTAAAATA
TTGGGACCAAATTAGAATCAATAGTATAAGATTAATTAATTAGAGTAAAAATATCTATTAAGGCAGAGAAAGTTTAGAGAAAAAAATCCA
AAGAAATTTGTGTTTCTTCCTATTCTGAACAAGTAAATCCATCCATCCATCCATCCAAACCTCCTTTATCTAACTGTGTCTACTAAAAGC
ACCATGTTTTGTGGGGAACACTCAGATAAATGGAATATCATCCTCAACTTCAAAATTCTATGATCTAGGAGATTTAATTAAAATGACATT
TTAATTTTTCTATGCGTTCCAACAATCAGATTGCATAGTCTCTTTTGTGAATAGCTGTCATATAATCAGTTGTACTGTAAGATATCTCCT
TTAAACTCATTTGGGATATAAGTTAAACATCCTTCAAATTGTTGATGTTGACAAACAGGATAATTTCAATAATATTATTCAAACATAAAC
TGGTCTAGGAGAATATTGCATCACTGACTAATTAGCCTATCTAGAGTCTAACTTCACCATTAAACCAAAAGCAGATGGTGGTCCTTGGCC
AAGAATATTGGAGACATTGGAGTTGGTTTTTTTCTAAGCTATAAGAAGTGAGGCGAGCTGAAAAAGTATGGTAGAGCAGGAGAAGGGTTT
GTGAGATTCCTTCTAGTGAAGTTCACCCTCAAACTTTTCAGGGGTAAAGACACAGAGTGATTCAGGGGCCACAATCTAATAGCTCAGGGC
TCTCCTATCCATTCAGAGAAGTCTCTAGGAAAAGGGATCTCATATCAGTACTTATGAAAAATTGAATATAAGCCTCCCTTTCTAAATAAA
TCTGCATCGAGTCATCACAGCCCTCTTTTTGGATACTATACCTTGATTTTTTTTTTCTGATTTACAATATGCATATGGTTTCTACTGGGC
TATAGAAAGCAGAATCACTCATTTTGGAGAAGGAAAAAATGAATAGTTAAAACAAACTTTTAACTGTTAAGGTAACAGAAATGTATTTAG
TGAATGTCTCTTTCCTCCTAAGAACACAAGACTTCTACATGTTGGGTAATACCTAGAGATGCATGTAGGAATAATCCAAAATGACCCAAA
TGCTTTATAATAGCACCACTTTATAATTCTTTTGAATGATTTCTGTAGTATATAATTGACTTCAGTTGTTTGAGTGTTTTTTGTTTTATT
TTTGTCCCCCCTGGGAAAACATATTTCAGCATGTATAAGAGGGAGAAAAAAAGTTTCATTCCTTCCAGAGAATAACTTATTTAGTCCAGT
AGGGTAGAATTTTAAAATGTCAGTTAAAGTCTTCAAAGTGCTTGGGGGGATATCAGATTCCAGAGGCCAATTGTAGCAATTGAAATTTGC
AGAATCAATTATGTAAATCTGAGACAAATTAGTATTAAAATTACACGGAGTATATTTTTTAAATCACCCAACTTTGTAGATTATACCTAT
TTTGGGCAGGTATGGAAAAATTTTGCAGTTAAATGATTGCCTAAAGAAAGTGGTAAACAGGTGAGGAAAGATGGCCTCTGATCTAGGATA
GATCCAGAACCACAAAGCATCTGCACCACAAAAGGTGTTAGACTACCAAGCAGCTCCTGGTTTTCTGCATAGTATTAGTAGCACAGCTTA
GGATGAGAATCCTTTCTCCAGTAACATTCTTAAAATAGCATGAAAAACAACGCAAAACTCAAATTTCTATTAAAACACACAAACTAAAAT
CAAGTGATTCTTTTTTGTAGATTAGGGAGAAGGACTGAATATCTAATTTAAGAGAAGGAATAGTGTTTAAGTGTTATAGTGTGTGAGCTA
ATACCTTCTAAAGGAAAGACATGGCATGAAGATTGTGCATACTTACAATGCTAAGGAAAAATCAAGAAAAGGACTGTGTGAGGCTCTGCT
ACTAGATGAAGTTGGAAGGACTATTAATGTGCTTCTTGAAGTATCAAAAATGAAAAGAAAATTAAAATTGTTTAAGCCTGACAGGGAAGG
ATGTAAATACAAGTTTTTCTAGAGCTCTCTAACCTTTATTTCAAAACTGGAATTATTCATCCATCTGTAATTGTTGATAATTTAACTAGT
ATATGTAGTTCATAAGGTAATAGAAAAGGTGATCATGAAAGCATGTATATAACTGGACAGAACCACGATAATGCTATAAGATGTAGATTT
AGTTAGGTTATCAGATGTTAAATGATTTTAATATTATTAAATAAATCAAACTAGAAAACTAACCACAAGTATAATGTAACAAAGTTAAAT
GCAGGATATAAAAATGTAGGATGGATTTTGCATAGTAAAAAGATAAGTTTGCCATTTAAAATTGTTGTTTGTTGGGTTTAGCTGAAAGTA
GGCATATATGGTTCCACTTGGGAAAACTTGCTTTAAAGCATTACAATGAACAATTTTTTCTCATTCTCTTATTCCTTTATCACTTTTTAA
ATGTAAAGAAAATTGTATTTATTTATTTTTTTAAATAAACACCACCTTGCAGAATTTAATAGGCAAACATGTTACATATGACTAAGTAAG
GGTCTTCAAGATGAAGTAAAGAAAATGTAAATGTTCTATTACCTTATGCAGAGACAAAAAAAAAAAGGAGTGGTGTCATTTAGCTAGCAA
ACAAACAAAATACAGTTAATTGGTGATATGTCCTTTCTTTTCTCACTATGCCCTCTTGCCTCCAAAAATGACAACAAAGAATCACAATTT
TTCTGATAAATAAATGCTAAACCAAGCGTTTCAAACTATTGCATTGCCATTCTTTTGGACTTTAGTTATTAGAATGATGATTGTTATAGG
GCAAATGAGAAATCCATGTGCATCAGCTTCTAGTTGTTAAAAAAACCAGATAAATTAACTTCTACTGTATACTGTGGGCAGAGGATCCTA
GAGCTGATCCTACAACATCAGCTTCTAGTTGTTAAAAAAAAAAAAAGAAACAGATAAATTAACTTCTACTGTATATACTGTGGGCAGAGG
ATCTTACTGTGCCTCTGTTTGTGTACATGGACTTCGGTGTGTATCAGTTTGAAGGACAGCCTTGCCCCATGTAAACATATAAATGCAGAT
TGGTATCGCCTGGTTGCTATTTGCTTAAGAACAAATATTATACAGATGAGATCAGGCATAATTTTAAAAGATCATTATCAGTGGAGACCT
CATTATTACTGATATTACAATGGGGCCAGTTTTTATACTTCTGGGTAGAATTAATAAAATTTTTCTGATCCCAGAGATCTGAGTTCTCTC
TGCAGTTGGAAACAAGAAGCTGTTGTGGGCATTGTGTCGGGCCAGGGGCCCTTGTGTTTGTGTGGGCAAATATCTTTTAGCAGTGTGAGC
TGCTTTTTTCTTTTCATTAAAAGTCTCTCTAAAATAATAGAAATTTCAGATACTCGGTTCAAGTCTCACTGATTTTGTAGAGGTCCAAAA
ATGTAGGATCTGTCACTTTTGCAGGCCCCTGCCTCACCTAATTCCTGGCCAGGTGACATTTTGGGCAGAAGTAAATGCTTCTATAGTCAC
AAGCTAAAATGACTCTAAGCCCCAATTTCACGGGGGGTATTCACATGCTTCCTCTGGAAAATACTCTTTGACAGTCAGCTTTGCAAGTAA
GTGATTACCTTGTTAGGAATCAAAGAAAAATGTATTTCTCTCTGACCTTTAGAGGAAAATAGAATCCTTCCCTTTTTTGCCCATTGACAC
AACTGGCACTGCTCTCTTCCCTTTCTACCACCCTGGTTCAAAGTAGTCCCCCGATGCTGTCCTGTTCCTTTCTTAAGCCATAGTGGATCT
CTGAGATCCTACACCCCACTTTGTGAAACACTGACTTCATCTTTGCCCTCGAATGCCTGATTTTTTCATAAGAGATTCTAGCAATTTGGA
CACTGTTTAAGTGAACTATCAAACTACCGCATAGAGAATATTTAAGCTATTAAAATTATGGTTTCCCATGAAGATCAATTCTCTGTGTCC
TTCCCTATAGGAATTTGAGACGAGTTAGCCCTGTGATGAATCTTGAAACTCACATATGTCCACATACACTTGGTAGAACTTCGATTTAAT
CTTTACATAAAAGCTGTACATATAACCAAGAAGTTATTTTTGCCAGTAAATTAACTTATTTGCTTTATTCATCTTATTTGGTTCCTAATC
GTAAATATTTTGTAGCTGCTGTAAATTTTTTTCTCCCAAATGAGGAGTCTTATTATCATAAAGGTAAAGGCTATTCAGCTTTGATAACCA
CCTGCAATTCTTTTTTGGATCATTCATCCATCTAACAAATACATAATGAGGACAGTTCATGTTAATGAAAATCCATGTTGTTTAATAGAA
TGCCATCCTTTACCTACTTTTGCTCTTTATGGACGTTTTTCTTTTCATGCTCTAGTGAGCTTTCCCTATATCATGAGAAGTGGTTATATT
TGTGCAAATATACAAATATAGGAAAACAAAGATTCATACCTGTAGGCAATAGTCTAACTTGTCCAAACCACTTTGCCTTTACTGCTATTT
TTATCCCCAATGCGTAGATATTTCCCCCAGGCCTATAGCCTTTGTGAAGGAAAGCAAATCATACCTCCTGTATATTGACACGAATCTGGT
TTTCAAATGTCATTTCCAGATTTTTTAGTTAATTGGGGGTTGTCCTTTTCCCTTAATGTGAGAGTCATTTTCCTGTATATTTCTGGATCT
CTCAGGGGCTGGGAGGGGGGAGTGAGGGGACTACAACCATAGCACTCCAAGAACCCTTTTGGGATTACTCCAGTAATCAACTACGAAAGT
TATTTTCTAAATGTAGATATGTAAGGTGTTCTTTTAAAGTAAGGTACTTTGAAATATGTAGCATAAACTGGTACTGCTGTTAAATGGGTC
GATTATTAAACGGAGCAGCTGTGTGAGGGCAGCTAACTTTGAATGCCTGTCTCCCTGGCTGGTGTGTCTCCTTCTCATGTTGAGAGCACC
AGGGATTGCGTGGCTGCATGCTGAAACCGCATTTTCCCATGGTGTATGACTAGTTCATCTCTTTCTTGAGCACCATTACAAGAAGATCAA
ATGAAAATGAGATCAATGTGGAAGACAATTCATAGCACAAAAAAAGTCATCTTAAATCTACTCTCAAACATTCATCTTATACATGCATCA
AAGTAATTTACTGACATCAGTTTGGGTGAGAGAGGGAGTCACTTTACTGAAAAGGCAGAGGCTTAAGGTGTATACATTTGTACTCACTTC
CTTATTTTCTTAACTTGTAAGCAGAAAACAAGCCCTCTCTCTTGTGAAGTATCTTCAAAGGATTGGGGTGCAAAAATACCTTGCTGGTAA
GCCATCAATGTTTTATTTAAATCCCTGCATTCAAAGTTAGCTGCCTTTTTGAAATAAACAAACAAAAAATACTACTGTATGTTTGAAAAT
GTGAATAGTATTTTTATAGCTTGTTAAAGACATGGCTAGTTGCATTTGTAAATAAGTATAATGTTGCTTTGATTTTCTTTTGTGGACATC
TTTATTTGGAACATAATTGTCTTTAGGGTTGATTTGTATATAAGTAATTGGCCTGTGATTGTTTCTTTTTTGGTTGGAAGTTATCATTTT
GACATTACTTGTGATTCTGTGTTCAGCACTATTGTGATGTGTTCAACCTCTGCACTCGCTTACACAATAGGATATGCCAATTGTGTGTGG
TGTAATGTTATTTTGATTTTTTTCCATGTTATTGATGAAGGATCATGCACCTAACACATACTAACTTTTTTAATGTTAGGCATATTTTTA
GTATACTTTCTCTTATTCTTTCTTCTCCTCCAACCTTTTACCCATCCTCCTTCCTTTCCCTCATTCCTGTTGTTATTTGAGAATGAGGGA
GAAACAGTATTTTACATTTATGTAATTAGGCTTTTCCGTTAGTTCTCAAGGATCCTCTTTTGGCTCTTGGGAAAGAATTGTACCTGTACA
AGGCAATTATAGAATGCGAACTGCTTTGCCTCATTCCATACTGATCATCCCAGCTGAACAATTTGAAAACTGTTCTGCCTTTTTGTTACA

>In-frame_KANSL1L_ENST00000418791_chr2_210993755_-_ERBB4_ENST00000402597_chr2_212495319_-_3419nt
GCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCCGGGGCGGGAGCGGGGCGCGCTCTGGAGACGAGTCAGCGGCGCCCCGGGTGGGGGAGG
CGGGCGGGCAGCTAGAGATCACCTCAGCAGCCCCCACCACGGCCGGACCGAAGGTGCGGCGGCGGAGGGGAGCCAGGGCGCCCCAGCAGG
TTTCCAATACTTATCTACAGGAATCGCCATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTAC
CATGGAGTCTGACAAGATGCTCTACATGGAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATT
TCCAACTCCTGAACCTACTCTTAATACTAATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTT
TTTAATGAGATCTAATTCTACATTAAATAAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAA
CATACTGTATAATGGCAGCAACATTCAGCTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATAC
CACGAGCCAGTGCATGAAAGATGTACAAATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTG
TAAATGGTATCAAGAGAATGCACTTTTGGATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGT
ACCTGGCCACTCAAATGTGCCTGTTAGTTCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACA
GAAAATTTTACTTAGCCAGGCTAGAAGAACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGAT
GAAATTGTCTATGAAACATCAACTCCCCAAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGA
AATTAAGCCAGAAGTTAACACATTGACTGCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAAT
CCAAAGATTTGCATTTTCTGCTACAGGGCTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGA
TTTGGATGAATATACCCTTAGAAAAAATGTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCG
ATGGACTTGGCTTCAAGCTCAGATTTCAGACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAA
CTCCCCTGATTGCAGCTGGAGTAATTGGTGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCA
TCAAAAAGAAAAGAGCCTTGAGAAGATTCTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAAC
TTCGTATTTTGAAAGAAACTGAGCTGAAGAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTG
AAGGAGAAACTGTGAAGATTCCTGTGGCTATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTC
TGATCATGGCAAGTATGGATCATCCACACCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGC
CCCATGGCTGCCTGTTGGAGTATGTCCACGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGG
GAATGATGTACCTGGAAGAAAGACGACTCGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCA
CAGATTTTGGGCTAGCCAGACTCTTGGAAGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGG
AGTGTATACATTACAGGAAATTCACCCATCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAAC
CCTATGATGGAATTCCAACGCGAGAAATCCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTT
ACATGGTCATGGTCAAATGTTGGATGATTGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAG
ACCCTCAAAGATACCTAGTTATTCAGGGTGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATG
AAGAGGATTTGGAAGATATGATGGATGCTGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAA
GAATTGACTCGAATAGGAGTGAAATTGGACACAGCCCTCCTCCTGCCTACACCCCCATGTCAGGAAACCAGTTTGTATACCGAGATGGAG
GTTTTGCTGCTGAACAAGGAGTGTCTGTGCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGCTACTGCTG
AGATTTTTGATGACTCCTGCTGTAATGGCACCCTACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTG
CTGACCCCACCGTGTTTGCCCCAGAACGGAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAAC
AAGAATACCTGAATCCAGTGGAGGAGAACCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACA
ATGCATCCAATGGTCCACCCAAGGCCGAGGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTG
AGTACCTGAAGAACAACATACTGTCAATGCCAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTC
GGAGCACCCTTCAGCACCCAGACTACCTGCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAG

>In-frame_KANSL1L_ENST00000452086_chr2_210993755_-_ERBB4_ENST00000436443_chr2_212495319_-_11265nt
GCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCCGGGGCGGGAGCGGGGCGCGCTCTGGAGACGAGTCAGCGGCGCCCCGGGTGGGGGAGG
CGGGCGGGCAGCTAGAGATCACCTCAGCAGCCCCCACCACGGCCGGACCGAAGGTGCGGCGGCGGAGGGGAGCCAGGGCGCCCCAGCAGG
TTTCCAATACTTATCTACAGGAATCGCCATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTAC
CATGGAGTCTGACAAGATGCTCTACATGGAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATT
TCCAACTCCTGAACCTACTCTTAATACTAATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTT
TTTAATGAGATCTAATTCTACATTAAATAAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAA
CATACTGTATAATGGCAGCAACATTCAGCTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATAC
CACGAGCCAGTGCATGAAAGATGTACAAATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTG
TAAATGGTATCAAGAGAATGCACTTTTGGATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGT
ACCTGGCCACTCAAATGTGCCTGTTAGTTCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACA
GAAAATTTTACTTAGCCAGGCTAGAAGAACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGAT
GAAATTGTCTATGAAACATCAACTCCCCAAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGA
AATTAAGCCAGAAGTTAACACATTGACTGCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAAT
CCAAAGATTTGCATTTTCTGCTACAGGGCTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGA
TTTGGATGAATATACCCTTAGAAAAAATGTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCG
ATGGACTTGGCTTCAAGCTCAGATTTCAGACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAA
CTCCCCTGATTGCAGCTGGAGTAATTGGTGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCA
TCAAAAAGAAAAGAGCCTTGAGAAGATTCTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAAC
TTCGTATTTTGAAAGAAACTGAGCTGAAGAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTG
AAGGAGAAACTGTGAAGATTCCTGTGGCTATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTC
TGATCATGGCAAGTATGGATCATCCACACCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGC
CCCATGGCTGCCTGTTGGAGTATGTCCACGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGG
GAATGATGTACCTGGAAGAAAGACGACTCGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCA
CAGATTTTGGGCTAGCCAGACTCTTGGAAGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGG
AGTGTATACATTACAGGAAATTCACCCATCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAAC
CCTATGATGGAATTCCAACGCGAGAAATCCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTT
ACATGGTCATGGTCAAATGTTGGATGATTGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAG
ACCCTCAAAGATACCTAGTTATTCAGGGTGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATG
AAGAGGATTTGGAAGATATGATGGATGCTGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAA
GAATTGACTCGAATAGGAACCAGTTTGTATACCGAGATGGAGGTTTTGCTGCTGAACAAGGAGTGTCTGTGCCCTACAGAGCCCCAACTA
GCACAATTCCAGAAGCTCCTGTGGCACAGGGTGCTACTGCTGAGATTTTTGATGACTCCTGCTGTAATGGCACCCTACGCAAGCCAGTGG
CACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTGCTGACCCCACCGTGTTTGCCCCAGAACGGAGCCCACGAGGAGAGCTGG
ATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAACAAGAATACCTGAATCCAGTGGAGGAGAACCCTTTTGTTTCTCGGAGAA
AAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACAATGCATCCAATGGTCCACCCAAGGCCGAGGATGAGTATGTGAATGAGC
CACTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTGAGTACCTGAAGAACAACATACTGTCAATGCCAGAGAAGGCCAAGAAAG
CGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTCGGAGCACCCTTCAGCACCCAGACTACCTGCAGGAGTACAGCACAAAAT
ATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAGAGAATCCTGAATACCTCTCTGAGTTCTCCCTGAAGCCAGGCACTGTGC
TGCCGCCTCCACCTTACAGACACCGGAATACTGTGGTGTAAGCTCAGTTGTGGTTTTTTAGGTGGAGAGACACACCTGCTCCAATTTCCC
CACCCCCCTCTCTTTCTCTGGTGGTCTTCCTTCTACCCCAAGGCCAGTAGTTTTGACACTTCCCAGTGGAAGATACAGAGATGCAATGAT
AGTTATGTGCTTACCTAACTTGAACATTAGAGGGAAAGACTGAAAGAGAAAGATAGGAGGAACCACAATGTTTCTTCATTTCTCTGCATG
GGTTGGTCAGGAGAATGAAACAGCTAGAGAAGGACCAGAAAATGTAAGGCAATGCTGCCTACTATCAAACTAGCTGTCACTTTTTTTCTT
TTTCTTTTTCTTTCTTTGTTTCTTTCTTCCTCTTCTTTTTTTTTTTTTTTTTTAAAGCAGATGGTTGAAACACCCATGCTATCTGTTCCT
ATCTGCAGGAACTGATGTGTGCATATTTAGCATCCCTGGAAATCATAATAAAGTTTCCATTAGAACAAAAGAATAACATTTTCTATAACA
TATGATGGTGTCTGAAATTGAGAATCCAGTTTCTTTCCCCAGCAGTTTCTGTCCTAGCAAGTAAGAATGGCCAACTCAACTTTCATAATT
TAAAAATCTCCATTAAAGTTATAACTAGTAATTATGTTTTCAACACTTTTTGGTTTTTTTCATTTTGTTTTGCTCTGACCGATTCCTTTA
TATTTGCTCCCCTATTTTTGGCTTTAATTTCTAATTGCAAAGATGTTTACATCAAAGCTTCTTCACAGAATTTAAGCAAGAAATATTTTA
ATATAGTGAAATGGCCACTACTTTAAGTATACAATCTTTAAAATAAGAAAGGGAGGCTAATATTTTTCATGCTATCAAATTATCTTCACC
CTCATCCTTTACATTTTTCAACATTTTTTTTTCTCCATAAATGACACTACTTGATAGGCCGTTGGTTGTCTGAAGAGTAGAAGGGAAACT
AAGAGACAGTTCTCTGTGGTTCAGGAAAACTACTGATACTTTCAGGGGTGGCCCAATGAGGGAATCCATTGAACTGGAAGAAACACACTG
GATTGGGTATGTCTACCTGGCAGATACTCAGAAATGTAGTTTGCACTTAAGCTGTAATTTTATTTGTTCTTTTTCTGAACTCCATTTTGG
ATTTTGAATCAAGCAATATGGAAGCAACCAGCAAATTAACTAATTTAAGTACATTTTTAAAAAAAGAGCTAAGATAAAGACTGTGGAAAT
GCCAAACCAAGCAAATTAGGAACCTTGCAACGGTATCCAGGGACTATGATGAGAGGCCAGCACATTATCTTCATATGTCACCTTTGCTAC
GCAAGGAAATTTGTTCAGTTCGTATACTTCGTAAGAAGGAATGCGAGTAAGGATTGGCTTGAATTCCATGGAATTTCTAGTATGAGACTA
TTTATATGAAGTAGAAGGTAACTCTTTGCACATAAATTGGTATAATAAAAAGAAAAACACAAACATTCAAAGCTTAGGGATAGGTCCTTG
GGTCAAAAGTTGTAAATAAATGTGAAACATCTTCTCATGCAATTATTTTATTATCCAACACACTAATCTTTTGATACTTTATATAATTCC
CTTTCTTCATATACTGCATCCAGTACTAGAACCATCATTATTATGTATCATTTTGAAAGAATACCTGATGAGATGAAGGATGAGAACAAA
TGACAGAGATGAGTCTCCAAGTAAAGGGGGCCTCACATCAATAATTAGGAAACTTAGATATAAGTCGCCCTTTTCTGAAAATTCTACCCC
AAGTCATTTAGATTTTTAAAAAATATTTCTAATGTTAAAATATTGGGACCAAATTAGAATCAATAGTATAAGATTAATTAATTAGAGTAA
AAATATCTATTAAGGCAGAGAAAGTTTAGAGAAAAAAATCCAAAGAAATTTGTGTTTCTTCCTATTCTGAACAAGTAAATCCATCCATCC
ATCCATCCAAACCTCCTTTATCTAACTGTGTCTACTAAAAGCACCATGTTTTGTGGGGAACACTCAGATAAATGGAATATCATCCTCAAC
TTCAAAATTCTATGATCTAGGAGATTTAATTAAAATGACATTTTAATTTTTCTATGCGTTCCAACAATCAGATTGCATAGTCTCTTTTGT
GAATAGCTGTCATATAATCAGTTGTACTGTAAGATATCTCCTTTAAACTCATTTGGGATATAAGTTAAACATCCTTCAAATTGTTGATGT
TGACAAACAGGATAATTTCAATAATATTATTCAAACATAAACTGGTCTAGGAGAATATTGCATCACTGACTAATTAGCCTATCTAGAGTC
TAACTTCACCATTAAACCAAAAGCAGATGGTGGTCCTTGGCCAAGAATATTGGAGACATTGGAGTTGGTTTTTTTCTAAGCTATAAGAAG
TGAGGCGAGCTGAAAAAGTATGGTAGAGCAGGAGAAGGGTTTGTGAGATTCCTTCTAGTGAAGTTCACCCTCAAACTTTTCAGGGGTAAA
GACACAGAGTGATTCAGGGGCCACAATCTAATAGCTCAGGGCTCTCCTATCCATTCAGAGAAGTCTCTAGGAAAAGGGATCTCATATCAG
TACTTATGAAAAATTGAATATAAGCCTCCCTTTCTAAATAAATCTGCATCGAGTCATCACAGCCCTCTTTTTGGATACTATACCTTGATT
TTTTTTTTCTGATTTACAATATGCATATGGTTTCTACTGGGCTATAGAAAGCAGAATCACTCATTTTGGAGAAGGAAAAAATGAATAGTT
AAAACAAACTTTTAACTGTTAAGGTAACAGAAATGTATTTAGTGAATGTCTCTTTCCTCCTAAGAACACAAGACTTCTACATGTTGGGTA
ATACCTAGAGATGCATGTAGGAATAATCCAAAATGACCCAAATGCTTTATAATAGCACCACTTTATAATTCTTTTGAATGATTTCTGTAG
TATATAATTGACTTCAGTTGTTTGAGTGTTTTTTGTTTTATTTTTGTCCCCCCTGGGAAAACATATTTCAGCATGTATAAGAGGGAGAAA
AAAAGTTTCATTCCTTCCAGAGAATAACTTATTTAGTCCAGTAGGGTAGAATTTTAAAATGTCAGTTAAAGTCTTCAAAGTGCTTGGGGG
GATATCAGATTCCAGAGGCCAATTGTAGCAATTGAAATTTGCAGAATCAATTATGTAAATCTGAGACAAATTAGTATTAAAATTACACGG
AGTATATTTTTTAAATCACCCAACTTTGTAGATTATACCTATTTTGGGCAGGTATGGAAAAATTTTGCAGTTAAATGATTGCCTAAAGAA
AGTGGTAAACAGGTGAGGAAAGATGGCCTCTGATCTAGGATAGATCCAGAACCACAAAGCATCTGCACCACAAAAGGTGTTAGACTACCA
AGCAGCTCCTGGTTTTCTGCATAGTATTAGTAGCACAGCTTAGGATGAGAATCCTTTCTCCAGTAACATTCTTAAAATAGCATGAAAAAC
AACGCAAAACTCAAATTTCTATTAAAACACACAAACTAAAATCAAGTGATTCTTTTTTGTAGATTAGGGAGAAGGACTGAATATCTAATT
TAAGAGAAGGAATAGTGTTTAAGTGTTATAGTGTGTGAGCTAATACCTTCTAAAGGAAAGACATGGCATGAAGATTGTGCATACTTACAA
TGCTAAGGAAAAATCAAGAAAAGGACTGTGTGAGGCTCTGCTACTAGATGAAGTTGGAAGGACTATTAATGTGCTTCTTGAAGTATCAAA
AATGAAAAGAAAATTAAAATTGTTTAAGCCTGACAGGGAAGGATGTAAATACAAGTTTTTCTAGAGCTCTCTAACCTTTATTTCAAAACT
GGAATTATTCATCCATCTGTAATTGTTGATAATTTAACTAGTATATGTAGTTCATAAGGTAATAGAAAAGGTGATCATGAAAGCATGTAT
ATAACTGGACAGAACCACGATAATGCTATAAGATGTAGATTTAGTTAGGTTATCAGATGTTAAATGATTTTAATATTATTAAATAAATCA
AACTAGAAAACTAACCACAAGTATAATGTAACAAAGTTAAATGCAGGATATAAAAATGTAGGATGGATTTTGCATAGTAAAAAGATAAGT
TTGCCATTTAAAATTGTTGTTTGTTGGGTTTAGCTGAAAGTAGGCATATATGGTTCCACTTGGGAAAACTTGCTTTAAAGCATTACAATG
AACAATTTTTTCTCATTCTCTTATTCCTTTATCACTTTTTAAATGTAAAGAAAATTGTATTTATTTATTTTTTTAAATAAACACCACCTT
GCAGAATTTAATAGGCAAACATGTTACATATGACTAAGTAAGGGTCTTCAAGATGAAGTAAAGAAAATGTAAATGTTCTATTACCTTATG
CAGAGACAAAAAAAAAAAGGAGTGGTGTCATTTAGCTAGCAAACAAACAAAATACAGTTAATTGGTGATATGTCCTTTCTTTTCTCACTA
TGCCCTCTTGCCTCCAAAAATGACAACAAAGAATCACAATTTTTCTGATAAATAAATGCTAAACCAAGCGTTTCAAACTATTGCATTGCC
ATTCTTTTGGACTTTAGTTATTAGAATGATGATTGTTATAGGGCAAATGAGAAATCCATGTGCATCAGCTTCTAGTTGTTAAAAAAACCA
GATAAATTAACTTCTACTGTATACTGTGGGCAGAGGATCCTAGAGCTGATCCTACAACATCAGCTTCTAGTTGTTAAAAAAAAAAAAAGA
AACAGATAAATTAACTTCTACTGTATATACTGTGGGCAGAGGATCTTACTGTGCCTCTGTTTGTGTACATGGACTTCGGTGTGTATCAGT
TTGAAGGACAGCCTTGCCCCATGTAAACATATAAATGCAGATTGGTATCGCCTGGTTGCTATTTGCTTAAGAACAAATATTATACAGATG
AGATCAGGCATAATTTTAAAAGATCATTATCAGTGGAGACCTCATTATTACTGATATTACAATGGGGCCAGTTTTTATACTTCTGGGTAG
AATTAATAAAATTTTTCTGATCCCAGAGATCTGAGTTCTCTCTGCAGTTGGAAACAAGAAGCTGTTGTGGGCATTGTGTCGGGCCAGGGG
CCCTTGTGTTTGTGTGGGCAAATATCTTTTAGCAGTGTGAGCTGCTTTTTTCTTTTCATTAAAAGTCTCTCTAAAATAATAGAAATTTCA
GATACTCGGTTCAAGTCTCACTGATTTTGTAGAGGTCCAAAAATGTAGGATCTGTCACTTTTGCAGGCCCCTGCCTCACCTAATTCCTGG
CCAGGTGACATTTTGGGCAGAAGTAAATGCTTCTATAGTCACAAGCTAAAATGACTCTAAGCCCCAATTTCACGGGGGGTATTCACATGC
TTCCTCTGGAAAATACTCTTTGACAGTCAGCTTTGCAAGTAAGTGATTACCTTGTTAGGAATCAAAGAAAAATGTATTTCTCTCTGACCT
TTAGAGGAAAATAGAATCCTTCCCTTTTTTGCCCATTGACACAACTGGCACTGCTCTCTTCCCTTTCTACCACCCTGGTTCAAAGTAGTC
CCCCGATGCTGTCCTGTTCCTTTCTTAAGCCATAGTGGATCTCTGAGATCCTACACCCCACTTTGTGAAACACTGACTTCATCTTTGCCC
TCGAATGCCTGATTTTTTCATAAGAGATTCTAGCAATTTGGACACTGTTTAAGTGAACTATCAAACTACCGCATAGAGAATATTTAAGCT
ATTAAAATTATGGTTTCCCATGAAGATCAATTCTCTGTGTCCTTCCCTATAGGAATTTGAGACGAGTTAGCCCTGTGATGAATCTTGAAA
CTCACATATGTCCACATACACTTGGTAGAACTTCGATTTAATCTTTACATAAAAGCTGTACATATAACCAAGAAGTTATTTTTGCCAGTA
AATTAACTTATTTGCTTTATTCATCTTATTTGGTTCCTAATCGTAAATATTTTGTAGCTGCTGTAAATTTTTTTCTCCCAAATGAGGAGT
CTTATTATCATAAAGGTAAAGGCTATTCAGCTTTGATAACCACCTGCAATTCTTTTTTGGATCATTCATCCATCTAACAAATACATAATG
AGGACAGTTCATGTTAATGAAAATCCATGTTGTTTAATAGAATGCCATCCTTTACCTACTTTTGCTCTTTATGGACGTTTTTCTTTTCAT
GCTCTAGTGAGCTTTCCCTATATCATGAGAAGTGGTTATATTTGTGCAAATATACAAATATAGGAAAACAAAGATTCATACCTGTAGGCA
ATAGTCTAACTTGTCCAAACCACTTTGCCTTTACTGCTATTTTTATCCCCAATGCGTAGATATTTCCCCCAGGCCTATAGCCTTTGTGAA
GGAAAGCAAATCATACCTCCTGTATATTGACACGAATCTGGTTTTCAAATGTCATTTCCAGATTTTTTAGTTAATTGGGGGTTGTCCTTT
TCCCTTAATGTGAGAGTCATTTTCCTGTATATTTCTGGATCTCTCAGGGGCTGGGAGGGGGGAGTGAGGGGACTACAACCATAGCACTCC
AAGAACCCTTTTGGGATTACTCCAGTAATCAACTACGAAAGTTATTTTCTAAATGTAGATATGTAAGGTGTTCTTTTAAAGTAAGGTACT
TTGAAATATGTAGCATAAACTGGTACTGCTGTTAAATGGGTCGATTATTAAACGGAGCAGCTGTGTGAGGGCAGCTAACTTTGAATGCCT
GTCTCCCTGGCTGGTGTGTCTCCTTCTCATGTTGAGAGCACCAGGGATTGCGTGGCTGCATGCTGAAACCGCATTTTCCCATGGTGTATG
ACTAGTTCATCTCTTTCTTGAGCACCATTACAAGAAGATCAAATGAAAATGAGATCAATGTGGAAGACAATTCATAGCACAAAAAAAGTC
ATCTTAAATCTACTCTCAAACATTCATCTTATACATGCATCAAAGTAATTTACTGACATCAGTTTGGGTGAGAGAGGGAGTCACTTTACT
GAAAAGGCAGAGGCTTAAGGTGTATACATTTGTACTCACTTCCTTATTTTCTTAACTTGTAAGCAGAAAACAAGCCCTCTCTCTTGTGAA
GTATCTTCAAAGGATTGGGGTGCAAAAATACCTTGCTGGTAAGCCATCAATGTTTTATTTAAATCCCTGCATTCAAAGTTAGCTGCCTTT
TTGAAATAAACAAACAAAAAATACTACTGTATGTTTGAAAATGTGAATAGTATTTTTATAGCTTGTTAAAGACATGGCTAGTTGCATTTG
TAAATAAGTATAATGTTGCTTTGATTTTCTTTTGTGGACATCTTTATTTGGAACATAATTGTCTTTAGGGTTGATTTGTATATAAGTAAT
TGGCCTGTGATTGTTTCTTTTTTGGTTGGAAGTTATCATTTTGACATTACTTGTGATTCTGTGTTCAGCACTATTGTGATGTGTTCAACC
TCTGCACTCGCTTACACAATAGGATATGCCAATTGTGTGTGGTGTAATGTTATTTTGATTTTTTTCCATGTTATTGATGAAGGATCATGC
ACCTAACACATACTAACTTTTTTAATGTTAGGCATATTTTTAGTATACTTTCTCTTATTCTTTCTTCTCCTCCAACCTTTTACCCATCCT
CCTTCCTTTCCCTCATTCCTGTTGTTATTTGAGAATGAGGGAGAAACAGTATTTTACATTTATGTAATTAGGCTTTTCCGTTAGTTCTCA
AGGATCCTCTTTTGGCTCTTGGGAAAGAATTGTACCTGTACAAGGCAATTATAGAATGCGAACTGCTTTGCCTCATTCCATACTGATCAT
CCCAGCTGAACAATTTGAAAACTGTTCTGCCTTTTTGTTACATGAATCTGTCAGAAATATATTTTTAATTTAATATAAATGAAATTCAAT

>In-frame_KANSL1L_ENST00000452086_chr2_210993755_-_ERBB4_ENST00000342788_chr2_212495319_-_11313nt
GCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCCGGGGCGGGAGCGGGGCGCGCTCTGGAGACGAGTCAGCGGCGCCCCGGGTGGGGGAGG
CGGGCGGGCAGCTAGAGATCACCTCAGCAGCCCCCACCACGGCCGGACCGAAGGTGCGGCGGCGGAGGGGAGCCAGGGCGCCCCAGCAGG
TTTCCAATACTTATCTACAGGAATCGCCATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTAC
CATGGAGTCTGACAAGATGCTCTACATGGAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATT
TCCAACTCCTGAACCTACTCTTAATACTAATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTT
TTTAATGAGATCTAATTCTACATTAAATAAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAA
CATACTGTATAATGGCAGCAACATTCAGCTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATAC
CACGAGCCAGTGCATGAAAGATGTACAAATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTG
TAAATGGTATCAAGAGAATGCACTTTTGGATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGT
ACCTGGCCACTCAAATGTGCCTGTTAGTTCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACA
GAAAATTTTACTTAGCCAGGCTAGAAGAACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGAT
GAAATTGTCTATGAAACATCAACTCCCCAAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGA
AATTAAGCCAGAAGTTAACACATTGACTGCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAAT
CCAAAGATTTGCATTTTCTGCTACAGGGCTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGA
TTTGGATGAATATACCCTTAGAAAAAATGTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCG
ATGGACTTGGCTTCAAGCTCAGATTTCAGACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAA
CTCCCCTGATTGCAGCTGGAGTAATTGGTGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCA
TCAAAAAGAAAAGAGCCTTGAGAAGATTCTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAAC
TTCGTATTTTGAAAGAAACTGAGCTGAAGAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTG
AAGGAGAAACTGTGAAGATTCCTGTGGCTATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTC
TGATCATGGCAAGTATGGATCATCCACACCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGC
CCCATGGCTGCCTGTTGGAGTATGTCCACGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGG
GAATGATGTACCTGGAAGAAAGACGACTCGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCA
CAGATTTTGGGCTAGCCAGACTCTTGGAAGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGG
AGTGTATACATTACAGGAAATTCACCCATCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAAC
CCTATGATGGAATTCCAACGCGAGAAATCCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTT
ACATGGTCATGGTCAAATGTTGGATGATTGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAG
ACCCTCAAAGATACCTAGTTATTCAGGGTGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATG
AAGAGGATTTGGAAGATATGATGGATGCTGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAA
GAATTGACTCGAATAGGAGTGAAATTGGACACAGCCCTCCTCCTGCCTACACCCCCATGTCAGGAAACCAGTTTGTATACCGAGATGGAG
GTTTTGCTGCTGAACAAGGAGTGTCTGTGCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGCTACTGCTG
AGATTTTTGATGACTCCTGCTGTAATGGCACCCTACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTG
CTGACCCCACCGTGTTTGCCCCAGAACGGAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAAC
AAGAATACCTGAATCCAGTGGAGGAGAACCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACA
ATGCATCCAATGGTCCACCCAAGGCCGAGGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTG
AGTACCTGAAGAACAACATACTGTCAATGCCAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTC
GGAGCACCCTTCAGCACCCAGACTACCTGCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAG
AGAATCCTGAATACCTCTCTGAGTTCTCCCTGAAGCCAGGCACTGTGCTGCCGCCTCCACCTTACAGACACCGGAATACTGTGGTGTAAG
CTCAGTTGTGGTTTTTTAGGTGGAGAGACACACCTGCTCCAATTTCCCCACCCCCCTCTCTTTCTCTGGTGGTCTTCCTTCTACCCCAAG
GCCAGTAGTTTTGACACTTCCCAGTGGAAGATACAGAGATGCAATGATAGTTATGTGCTTACCTAACTTGAACATTAGAGGGAAAGACTG
AAAGAGAAAGATAGGAGGAACCACAATGTTTCTTCATTTCTCTGCATGGGTTGGTCAGGAGAATGAAACAGCTAGAGAAGGACCAGAAAA
TGTAAGGCAATGCTGCCTACTATCAAACTAGCTGTCACTTTTTTTCTTTTTCTTTTTCTTTCTTTGTTTCTTTCTTCCTCTTCTTTTTTT
TTTTTTTTTTTAAAGCAGATGGTTGAAACACCCATGCTATCTGTTCCTATCTGCAGGAACTGATGTGTGCATATTTAGCATCCCTGGAAA
TCATAATAAAGTTTCCATTAGAACAAAAGAATAACATTTTCTATAACATATGATGGTGTCTGAAATTGAGAATCCAGTTTCTTTCCCCAG
CAGTTTCTGTCCTAGCAAGTAAGAATGGCCAACTCAACTTTCATAATTTAAAAATCTCCATTAAAGTTATAACTAGTAATTATGTTTTCA
ACACTTTTTGGTTTTTTTCATTTTGTTTTGCTCTGACCGATTCCTTTATATTTGCTCCCCTATTTTTGGCTTTAATTTCTAATTGCAAAG
ATGTTTACATCAAAGCTTCTTCACAGAATTTAAGCAAGAAATATTTTAATATAGTGAAATGGCCACTACTTTAAGTATACAATCTTTAAA
ATAAGAAAGGGAGGCTAATATTTTTCATGCTATCAAATTATCTTCACCCTCATCCTTTACATTTTTCAACATTTTTTTTTCTCCATAAAT
GACACTACTTGATAGGCCGTTGGTTGTCTGAAGAGTAGAAGGGAAACTAAGAGACAGTTCTCTGTGGTTCAGGAAAACTACTGATACTTT
CAGGGGTGGCCCAATGAGGGAATCCATTGAACTGGAAGAAACACACTGGATTGGGTATGTCTACCTGGCAGATACTCAGAAATGTAGTTT
GCACTTAAGCTGTAATTTTATTTGTTCTTTTTCTGAACTCCATTTTGGATTTTGAATCAAGCAATATGGAAGCAACCAGCAAATTAACTA
ATTTAAGTACATTTTTAAAAAAAGAGCTAAGATAAAGACTGTGGAAATGCCAAACCAAGCAAATTAGGAACCTTGCAACGGTATCCAGGG
ACTATGATGAGAGGCCAGCACATTATCTTCATATGTCACCTTTGCTACGCAAGGAAATTTGTTCAGTTCGTATACTTCGTAAGAAGGAAT
GCGAGTAAGGATTGGCTTGAATTCCATGGAATTTCTAGTATGAGACTATTTATATGAAGTAGAAGGTAACTCTTTGCACATAAATTGGTA
TAATAAAAAGAAAAACACAAACATTCAAAGCTTAGGGATAGGTCCTTGGGTCAAAAGTTGTAAATAAATGTGAAACATCTTCTCATGCAA
TTATTTTATTATCCAACACACTAATCTTTTGATACTTTATATAATTCCCTTTCTTCATATACTGCATCCAGTACTAGAACCATCATTATT
ATGTATCATTTTGAAAGAATACCTGATGAGATGAAGGATGAGAACAAATGACAGAGATGAGTCTCCAAGTAAAGGGGGCCTCACATCAAT
AATTAGGAAACTTAGATATAAGTCGCCCTTTTCTGAAAATTCTACCCCAAGTCATTTAGATTTTTAAAAAATATTTCTAATGTTAAAATA
TTGGGACCAAATTAGAATCAATAGTATAAGATTAATTAATTAGAGTAAAAATATCTATTAAGGCAGAGAAAGTTTAGAGAAAAAAATCCA
AAGAAATTTGTGTTTCTTCCTATTCTGAACAAGTAAATCCATCCATCCATCCATCCAAACCTCCTTTATCTAACTGTGTCTACTAAAAGC
ACCATGTTTTGTGGGGAACACTCAGATAAATGGAATATCATCCTCAACTTCAAAATTCTATGATCTAGGAGATTTAATTAAAATGACATT
TTAATTTTTCTATGCGTTCCAACAATCAGATTGCATAGTCTCTTTTGTGAATAGCTGTCATATAATCAGTTGTACTGTAAGATATCTCCT
TTAAACTCATTTGGGATATAAGTTAAACATCCTTCAAATTGTTGATGTTGACAAACAGGATAATTTCAATAATATTATTCAAACATAAAC
TGGTCTAGGAGAATATTGCATCACTGACTAATTAGCCTATCTAGAGTCTAACTTCACCATTAAACCAAAAGCAGATGGTGGTCCTTGGCC
AAGAATATTGGAGACATTGGAGTTGGTTTTTTTCTAAGCTATAAGAAGTGAGGCGAGCTGAAAAAGTATGGTAGAGCAGGAGAAGGGTTT
GTGAGATTCCTTCTAGTGAAGTTCACCCTCAAACTTTTCAGGGGTAAAGACACAGAGTGATTCAGGGGCCACAATCTAATAGCTCAGGGC
TCTCCTATCCATTCAGAGAAGTCTCTAGGAAAAGGGATCTCATATCAGTACTTATGAAAAATTGAATATAAGCCTCCCTTTCTAAATAAA
TCTGCATCGAGTCATCACAGCCCTCTTTTTGGATACTATACCTTGATTTTTTTTTTCTGATTTACAATATGCATATGGTTTCTACTGGGC
TATAGAAAGCAGAATCACTCATTTTGGAGAAGGAAAAAATGAATAGTTAAAACAAACTTTTAACTGTTAAGGTAACAGAAATGTATTTAG
TGAATGTCTCTTTCCTCCTAAGAACACAAGACTTCTACATGTTGGGTAATACCTAGAGATGCATGTAGGAATAATCCAAAATGACCCAAA
TGCTTTATAATAGCACCACTTTATAATTCTTTTGAATGATTTCTGTAGTATATAATTGACTTCAGTTGTTTGAGTGTTTTTTGTTTTATT
TTTGTCCCCCCTGGGAAAACATATTTCAGCATGTATAAGAGGGAGAAAAAAAGTTTCATTCCTTCCAGAGAATAACTTATTTAGTCCAGT
AGGGTAGAATTTTAAAATGTCAGTTAAAGTCTTCAAAGTGCTTGGGGGGATATCAGATTCCAGAGGCCAATTGTAGCAATTGAAATTTGC
AGAATCAATTATGTAAATCTGAGACAAATTAGTATTAAAATTACACGGAGTATATTTTTTAAATCACCCAACTTTGTAGATTATACCTAT
TTTGGGCAGGTATGGAAAAATTTTGCAGTTAAATGATTGCCTAAAGAAAGTGGTAAACAGGTGAGGAAAGATGGCCTCTGATCTAGGATA
GATCCAGAACCACAAAGCATCTGCACCACAAAAGGTGTTAGACTACCAAGCAGCTCCTGGTTTTCTGCATAGTATTAGTAGCACAGCTTA
GGATGAGAATCCTTTCTCCAGTAACATTCTTAAAATAGCATGAAAAACAACGCAAAACTCAAATTTCTATTAAAACACACAAACTAAAAT
CAAGTGATTCTTTTTTGTAGATTAGGGAGAAGGACTGAATATCTAATTTAAGAGAAGGAATAGTGTTTAAGTGTTATAGTGTGTGAGCTA
ATACCTTCTAAAGGAAAGACATGGCATGAAGATTGTGCATACTTACAATGCTAAGGAAAAATCAAGAAAAGGACTGTGTGAGGCTCTGCT
ACTAGATGAAGTTGGAAGGACTATTAATGTGCTTCTTGAAGTATCAAAAATGAAAAGAAAATTAAAATTGTTTAAGCCTGACAGGGAAGG
ATGTAAATACAAGTTTTTCTAGAGCTCTCTAACCTTTATTTCAAAACTGGAATTATTCATCCATCTGTAATTGTTGATAATTTAACTAGT
ATATGTAGTTCATAAGGTAATAGAAAAGGTGATCATGAAAGCATGTATATAACTGGACAGAACCACGATAATGCTATAAGATGTAGATTT
AGTTAGGTTATCAGATGTTAAATGATTTTAATATTATTAAATAAATCAAACTAGAAAACTAACCACAAGTATAATGTAACAAAGTTAAAT
GCAGGATATAAAAATGTAGGATGGATTTTGCATAGTAAAAAGATAAGTTTGCCATTTAAAATTGTTGTTTGTTGGGTTTAGCTGAAAGTA
GGCATATATGGTTCCACTTGGGAAAACTTGCTTTAAAGCATTACAATGAACAATTTTTTCTCATTCTCTTATTCCTTTATCACTTTTTAA
ATGTAAAGAAAATTGTATTTATTTATTTTTTTAAATAAACACCACCTTGCAGAATTTAATAGGCAAACATGTTACATATGACTAAGTAAG
GGTCTTCAAGATGAAGTAAAGAAAATGTAAATGTTCTATTACCTTATGCAGAGACAAAAAAAAAAAGGAGTGGTGTCATTTAGCTAGCAA
ACAAACAAAATACAGTTAATTGGTGATATGTCCTTTCTTTTCTCACTATGCCCTCTTGCCTCCAAAAATGACAACAAAGAATCACAATTT
TTCTGATAAATAAATGCTAAACCAAGCGTTTCAAACTATTGCATTGCCATTCTTTTGGACTTTAGTTATTAGAATGATGATTGTTATAGG
GCAAATGAGAAATCCATGTGCATCAGCTTCTAGTTGTTAAAAAAACCAGATAAATTAACTTCTACTGTATACTGTGGGCAGAGGATCCTA
GAGCTGATCCTACAACATCAGCTTCTAGTTGTTAAAAAAAAAAAAAGAAACAGATAAATTAACTTCTACTGTATATACTGTGGGCAGAGG
ATCTTACTGTGCCTCTGTTTGTGTACATGGACTTCGGTGTGTATCAGTTTGAAGGACAGCCTTGCCCCATGTAAACATATAAATGCAGAT
TGGTATCGCCTGGTTGCTATTTGCTTAAGAACAAATATTATACAGATGAGATCAGGCATAATTTTAAAAGATCATTATCAGTGGAGACCT
CATTATTACTGATATTACAATGGGGCCAGTTTTTATACTTCTGGGTAGAATTAATAAAATTTTTCTGATCCCAGAGATCTGAGTTCTCTC
TGCAGTTGGAAACAAGAAGCTGTTGTGGGCATTGTGTCGGGCCAGGGGCCCTTGTGTTTGTGTGGGCAAATATCTTTTAGCAGTGTGAGC
TGCTTTTTTCTTTTCATTAAAAGTCTCTCTAAAATAATAGAAATTTCAGATACTCGGTTCAAGTCTCACTGATTTTGTAGAGGTCCAAAA
ATGTAGGATCTGTCACTTTTGCAGGCCCCTGCCTCACCTAATTCCTGGCCAGGTGACATTTTGGGCAGAAGTAAATGCTTCTATAGTCAC
AAGCTAAAATGACTCTAAGCCCCAATTTCACGGGGGGTATTCACATGCTTCCTCTGGAAAATACTCTTTGACAGTCAGCTTTGCAAGTAA
GTGATTACCTTGTTAGGAATCAAAGAAAAATGTATTTCTCTCTGACCTTTAGAGGAAAATAGAATCCTTCCCTTTTTTGCCCATTGACAC
AACTGGCACTGCTCTCTTCCCTTTCTACCACCCTGGTTCAAAGTAGTCCCCCGATGCTGTCCTGTTCCTTTCTTAAGCCATAGTGGATCT
CTGAGATCCTACACCCCACTTTGTGAAACACTGACTTCATCTTTGCCCTCGAATGCCTGATTTTTTCATAAGAGATTCTAGCAATTTGGA
CACTGTTTAAGTGAACTATCAAACTACCGCATAGAGAATATTTAAGCTATTAAAATTATGGTTTCCCATGAAGATCAATTCTCTGTGTCC
TTCCCTATAGGAATTTGAGACGAGTTAGCCCTGTGATGAATCTTGAAACTCACATATGTCCACATACACTTGGTAGAACTTCGATTTAAT
CTTTACATAAAAGCTGTACATATAACCAAGAAGTTATTTTTGCCAGTAAATTAACTTATTTGCTTTATTCATCTTATTTGGTTCCTAATC
GTAAATATTTTGTAGCTGCTGTAAATTTTTTTCTCCCAAATGAGGAGTCTTATTATCATAAAGGTAAAGGCTATTCAGCTTTGATAACCA
CCTGCAATTCTTTTTTGGATCATTCATCCATCTAACAAATACATAATGAGGACAGTTCATGTTAATGAAAATCCATGTTGTTTAATAGAA
TGCCATCCTTTACCTACTTTTGCTCTTTATGGACGTTTTTCTTTTCATGCTCTAGTGAGCTTTCCCTATATCATGAGAAGTGGTTATATT
TGTGCAAATATACAAATATAGGAAAACAAAGATTCATACCTGTAGGCAATAGTCTAACTTGTCCAAACCACTTTGCCTTTACTGCTATTT
TTATCCCCAATGCGTAGATATTTCCCCCAGGCCTATAGCCTTTGTGAAGGAAAGCAAATCATACCTCCTGTATATTGACACGAATCTGGT
TTTCAAATGTCATTTCCAGATTTTTTAGTTAATTGGGGGTTGTCCTTTTCCCTTAATGTGAGAGTCATTTTCCTGTATATTTCTGGATCT
CTCAGGGGCTGGGAGGGGGGAGTGAGGGGACTACAACCATAGCACTCCAAGAACCCTTTTGGGATTACTCCAGTAATCAACTACGAAAGT
TATTTTCTAAATGTAGATATGTAAGGTGTTCTTTTAAAGTAAGGTACTTTGAAATATGTAGCATAAACTGGTACTGCTGTTAAATGGGTC
GATTATTAAACGGAGCAGCTGTGTGAGGGCAGCTAACTTTGAATGCCTGTCTCCCTGGCTGGTGTGTCTCCTTCTCATGTTGAGAGCACC
AGGGATTGCGTGGCTGCATGCTGAAACCGCATTTTCCCATGGTGTATGACTAGTTCATCTCTTTCTTGAGCACCATTACAAGAAGATCAA
ATGAAAATGAGATCAATGTGGAAGACAATTCATAGCACAAAAAAAGTCATCTTAAATCTACTCTCAAACATTCATCTTATACATGCATCA
AAGTAATTTACTGACATCAGTTTGGGTGAGAGAGGGAGTCACTTTACTGAAAAGGCAGAGGCTTAAGGTGTATACATTTGTACTCACTTC
CTTATTTTCTTAACTTGTAAGCAGAAAACAAGCCCTCTCTCTTGTGAAGTATCTTCAAAGGATTGGGGTGCAAAAATACCTTGCTGGTAA
GCCATCAATGTTTTATTTAAATCCCTGCATTCAAAGTTAGCTGCCTTTTTGAAATAAACAAACAAAAAATACTACTGTATGTTTGAAAAT
GTGAATAGTATTTTTATAGCTTGTTAAAGACATGGCTAGTTGCATTTGTAAATAAGTATAATGTTGCTTTGATTTTCTTTTGTGGACATC
TTTATTTGGAACATAATTGTCTTTAGGGTTGATTTGTATATAAGTAATTGGCCTGTGATTGTTTCTTTTTTGGTTGGAAGTTATCATTTT
GACATTACTTGTGATTCTGTGTTCAGCACTATTGTGATGTGTTCAACCTCTGCACTCGCTTACACAATAGGATATGCCAATTGTGTGTGG
TGTAATGTTATTTTGATTTTTTTCCATGTTATTGATGAAGGATCATGCACCTAACACATACTAACTTTTTTAATGTTAGGCATATTTTTA
GTATACTTTCTCTTATTCTTTCTTCTCCTCCAACCTTTTACCCATCCTCCTTCCTTTCCCTCATTCCTGTTGTTATTTGAGAATGAGGGA
GAAACAGTATTTTACATTTATGTAATTAGGCTTTTCCGTTAGTTCTCAAGGATCCTCTTTTGGCTCTTGGGAAAGAATTGTACCTGTACA
AGGCAATTATAGAATGCGAACTGCTTTGCCTCATTCCATACTGATCATCCCAGCTGAACAATTTGAAAACTGTTCTGCCTTTTTGTTACA

>In-frame_KANSL1L_ENST00000452086_chr2_210993755_-_ERBB4_ENST00000402597_chr2_212495319_-_3419nt
GCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCCGGGGCGGGAGCGGGGCGCGCTCTGGAGACGAGTCAGCGGCGCCCCGGGTGGGGGAGG
CGGGCGGGCAGCTAGAGATCACCTCAGCAGCCCCCACCACGGCCGGACCGAAGGTGCGGCGGCGGAGGGGAGCCAGGGCGCCCCAGCAGG
TTTCCAATACTTATCTACAGGAATCGCCATGACCCCAGCTCTGAGGGAGGCAACAGCAAAGGGTATCAGCTTTTCATCTTTGCCAAGTAC
CATGGAGTCTGACAAGATGCTCTACATGGAAAGTCCCAGAACTGTAGATGAAAAGCTAAAGGGAGACACCTTTTCTCAGATGCTTGGATT
TCCAACTCCTGAACCTACTCTTAATACTAATTTTGTGAATTTAAAACATTTTGGCTCCCCTCAGTCTTCAAAACATTACCAGACTGTTTT
TTTAATGAGATCTAATTCTACATTAAATAAACACAATGAGAATTATAAACAAAAGAAATTAGGGGAGCCCAGTTGCAATAAGCTGAAAAA
CATACTGTATAATGGCAGCAACATTCAGCTCAGTAAAATCTGTCTTTCTCATTCTGAAGAGTTCATCAAAAAGGAGCCTCTATCAGATAC
CACGAGCCAGTGCATGAAAGATGTACAAATTATTCTGGATTCAAATATAACCAAAGACACTAATGTAGATAAAGTACAACTACAAAACTG
TAAATGGTATCAAGAGAATGCACTTTTGGATAAAGTTACTGATGCTGAGATTAAAAAGGGTTTATTGCACTGTACTCAAAAGAAAATTGT
ACCTGGCCACTCAAATGTGCCTGTTAGTTCTTCAGCTGCTGAAAAAGAGGAGGAAGTACATGCTCGTTTACTTCATTGTGTAAGCAAACA
GAAAATTTTACTTAGCCAGGCTAGAAGAACTCAGAAACATTTGCAGATGCTCCTGGCAAAGCATGTTGTTAAGCACTATGGTCAGCAGAT
GAAATTGTCTATGAAACATCAACTCCCCAAAATGAAGACATTTCATGAACCTACCACAATTTTGGGTAATAGTTTACCTAAATGCACTGA
AATTAAGCCAGAAGTTAACACATTGACTGCAGAGAATAAATTGTGGGATGATGCAAAAAATGGCTTTGCACGGTGTACAGCTGCGGAAAT
CCAAAGATTTGCATTTTCTGCTACAGGGCTGTTGTCTCATGTTGAAGAGGGTTTGGATTCCGATGCAACTGATAGCAGCTCTGATGACGA
TTTGGATGAATATACCCTTAGAAAAAATGTGGCAGTTAACTGTAGTACTGAATGGAAGTGGCTTGTAGACAGAGCACGAGTTGGCAGCCG
ATGGACTTGGCTTCAAGCTCAGATTTCAGACCTAGAATGCAAAATCCAACAACTAACAGACATTCACAGGCAAATTCGTGCCTCCAAGAA
CTCCCCTGATTGCAGCTGGAGTAATTGGTGGGCTCTTCATTCTGGTCATTGTGGGTCTGACATTTGCTGTTTATGTTAGAAGGAAGAGCA
TCAAAAAGAAAAGAGCCTTGAGAAGATTCTTGGAAACAGAGTTGGTGGAACCATTAACTCCCAGTGGCACAGCACCCAATCAAGCTCAAC
TTCGTATTTTGAAAGAAACTGAGCTGAAGAGGGTAAAAGTCCTTGGCTCAGGTGCTTTTGGAACGGTTTATAAAGGTATTTGGGTACCTG
AAGGAGAAACTGTGAAGATTCCTGTGGCTATTAAGATTCTTAATGAGACAACTGGTCCCAAGGCAAATGTGGAGTTCATGGATGAAGCTC
TGATCATGGCAAGTATGGATCATCCACACCTAGTCCGGTTGCTGGGTGTGTGTCTGAGCCCAACCATCCAGCTGGTTACTCAACTTATGC
CCCATGGCTGCCTGTTGGAGTATGTCCACGAGCACAAGGATAACATTGGATCACAACTGCTGCTTAACTGGTGTGTCCAGATAGCTAAGG
GAATGATGTACCTGGAAGAAAGACGACTCGTTCATCGGGATTTGGCAGCCCGTAATGTCTTAGTGAAATCTCCAAACCATGTGAAAATCA
CAGATTTTGGGCTAGCCAGACTCTTGGAAGGAGATGAAAAAGAGTACAATGCTGATGGAGGAAAGATGCCAATTAAATGGATGGCTCTGG
AGTGTATACATTACAGGAAATTCACCCATCAGAGTGACGTTTGGAGCTATGGAGTTACTATATGGGAACTGATGACCTTTGGAGGAAAAC
CCTATGATGGAATTCCAACGCGAGAAATCCCTGATTTATTAGAGAAAGGAGAACGTTTGCCTCAGCCTCCCATCTGCACTATTGACGTTT
ACATGGTCATGGTCAAATGTTGGATGATTGATGCTGACAGTAGACCTAAATTTAAGGAACTGGCTGCTGAGTTTTCAAGGATGGCTCGAG
ACCCTCAAAGATACCTAGTTATTCAGGGTGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAGTTCTTTCAGAATCTCTTGGATG
AAGAGGATTTGGAAGATATGATGGATGCTGAGGAGTACTTGGTCCCTCAGGCTTTCAACATCCCACCTCCCATCTATACTTCCAGAGCAA
GAATTGACTCGAATAGGAGTGAAATTGGACACAGCCCTCCTCCTGCCTACACCCCCATGTCAGGAAACCAGTTTGTATACCGAGATGGAG
GTTTTGCTGCTGAACAAGGAGTGTCTGTGCCCTACAGAGCCCCAACTAGCACAATTCCAGAAGCTCCTGTGGCACAGGGTGCTACTGCTG
AGATTTTTGATGACTCCTGCTGTAATGGCACCCTACGCAAGCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACCCAGAGGTACAGTG
CTGACCCCACCGTGTTTGCCCCAGAACGGAGCCCACGAGGAGAGCTGGATGAGGAAGGTTACATGACTCCTATGCGAGACAAACCCAAAC
AAGAATACCTGAATCCAGTGGAGGAGAACCCTTTTGTTTCTCGGAGAAAAAATGGAGACCTTCAAGCATTGGATAATCCCGAATATCACA
ATGCATCCAATGGTCCACCCAAGGCCGAGGATGAGTATGTGAATGAGCCACTGTACCTCAACACCTTTGCCAACACCTTGGGAAAAGCTG
AGTACCTGAAGAACAACATACTGTCAATGCCAGAGAAGGCCAAGAAAGCGTTTGACAACCCTGACTACTGGAACCACAGCCTGCCACCTC
GGAGCACCCTTCAGCACCCAGACTACCTGCAGGAGTACAGCACAAAATATTTTTATAAACAGAATGGGCGGATCCGGCCTATTGTGGCAG


Top

FusionGenePPI for KANSL1L_ERBB4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
KANSL1LERBB4DLG3, SNTB2, DLG4, YAP1, DLG2, STAT5A, SHC1, CRK, GRB2, PTPN11, PIK3R2, NCK1, RNF41, ERBB2, CD44, DLG1, MUC1, EREG, NRG1, NRG2, ITCH, HDAC6, LRIG1, WWP1, NEDD4, TAB2, NCOR1, PIAS3, PIAS4, WWOX, TRIM28, MDM2, TP53, BYSL, TRO, EGFR, USP8, HSP90AA1, ABL1, RASA1, ABL2, SYK, ANKS1B, ANKS1A, NUDCD1, CBL, ERBB4, TFAP2A, TFAP2C, PTPN6, PTPN7, PTPN12, PTPRR, PTPRH, PTPRT, PPM1A, PPM1B, PPM1F, ILKAP, TAB1, PTPN20B, DUSP6, DUSP10, DUSP16, DUSP14, DUSP18, DUSP19, DUSP21, STYX, PTPDC1, MTMR2, MTMR6, MTMR9, CDC25C, ESR1, VANGL1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for KANSL1L_ERBB4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneERBB4Q15303DB08916AfatinibReceptor tyrosine-protein kinase erbB-4small moleculeapproved

Top

RelatedDiseases for KANSL1L_ERBB4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneERBB4C0005586Bipolar Disorder5PSYGENET
TgeneERBB4C0036341Schizophrenia4PSYGENET
TgeneERBB4C0016978gallbladder neoplasm1CTD_human
TgeneERBB4C0025202melanoma1CTD_human
TgeneERBB4C0037286Skin Neoplasms1CTD_human
TgeneERBB4C3715155AMYOTROPHIC LATERAL SCLEROSIS 191UNIPROT