FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 17845

FusionGeneSummary for ITGA9_SEC13

check button Fusion gene summary
Fusion gene informationFusion gene name: ITGA9_SEC13
Fusion gene ID: 17845
HgeneTgene
Gene symbol

ITGA9

SEC13

Gene ID

3680

6396

Gene nameintegrin subunit alpha 9SEC13 homolog, nuclear pore and COPII coat complex component
SynonymsALPHA-RLC|ITGA4L|RLCD3S1231E|SEC13L1|SEC13R|npp-20
Cytomap

3p22.2

3p25.3

Type of geneprotein-codingprotein-coding
Descriptionintegrin alpha-9integrin alpha-RLCprotein SEC13 homologGATOR complex protein SEC13SEC13 homolog, nuclear pore and COPII coating complex componentSEC13-like 1 isoformSEC13-like protein 1SEC13-related protein
Modification date2018051920180523
UniProtAcc

Q13797

P55735

Ensembl transtripts involved in fusion geneENST00000264741, ENST00000422441, 
ENST00000397109, ENST00000337354, 
ENST00000350697, ENST00000397117, 
ENST00000383801, ENST00000492602, 
Fusion gene scores* DoF score6 X 6 X 7=2528 X 5 X 4=160
# samples 76
** MAII scorelog2(7/252*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/160*10)=-1.41503749927884
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ITGA9 [Title/Abstract] AND SEC13 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSEC13

GO:0090110

cargo loading into COPII-coated vesicle

17499046|18843296


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-MP-A4TK-01AITGA9chr3

37792060

+SEC13chr3

10347376

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000264741ENST00000397109ITGA9chr3

37792060

+SEC13chr3

10347376

-
In-frameENST00000264741ENST00000337354ITGA9chr3

37792060

+SEC13chr3

10347376

-
In-frameENST00000264741ENST00000350697ITGA9chr3

37792060

+SEC13chr3

10347376

-
In-frameENST00000264741ENST00000397117ITGA9chr3

37792060

+SEC13chr3

10347376

-
In-frameENST00000264741ENST00000383801ITGA9chr3

37792060

+SEC13chr3

10347376

-
5CDS-intronENST00000264741ENST00000492602ITGA9chr3

37792060

+SEC13chr3

10347376

-
intron-3CDSENST00000422441ENST00000397109ITGA9chr3

37792060

+SEC13chr3

10347376

-
intron-3CDSENST00000422441ENST00000337354ITGA9chr3

37792060

+SEC13chr3

10347376

-
intron-3CDSENST00000422441ENST00000350697ITGA9chr3

37792060

+SEC13chr3

10347376

-
intron-3CDSENST00000422441ENST00000397117ITGA9chr3

37792060

+SEC13chr3

10347376

-
intron-3CDSENST00000422441ENST00000383801ITGA9chr3

37792060

+SEC13chr3

10347376

-
intron-intronENST00000422441ENST00000492602ITGA9chr3

37792060

+SEC13chr3

10347376

-

Top

FusionProtFeatures for ITGA9_SEC13


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ITGA9

Q13797

SEC13

P55735

Integrin alpha-9/beta-1 (ITGA9:ITGB1) is a receptor forVCAM1, cytotactin and osteopontin. It recognizes the sequence A-E-I-D-G-I-E-L in cytotactin. {ECO:0000250}. Functions as a component of the nuclear pore complex(NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 isinvolved in the biogenesis of COPII-coated vesicles.{ECO:0000269|PubMed:8972206}. As a component of the GATOR subcomplex GATOR2, functionswithin the amino acid-sensing branch of the TORC1 signalingpathway. Indirectly activates mTORC1 and the TORC1 signalingpathway through the inhibition of the GATOR1 subcomplex(PubMed:23723238). It is negatively regulated by the upstreamamino acid sensors SESN2 and CASTOR1 (PubMed:25457612,PubMed:27487210). {ECO:0000269|PubMed:23723238,ECO:0000269|PubMed:25457612, ECO:0000269|PubMed:27487210}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneITGA9chr3:37792060chr3:10347376ENST00000264741+2328312_3208471036Calcium bindingOntology_term=ECO:0000255
HgeneITGA9chr3:37792060chr3:10347376ENST00000264741+2328373_3818471036Calcium bindingOntology_term=ECO:0000255
HgeneITGA9chr3:37792060chr3:10347376ENST00000264741+2328435_4438471036Calcium bindingOntology_term=ECO:0000255
HgeneITGA9chr3:37792060chr3:10347376ENST00000264741+2328111_1748471036RepeatFG-GAP 2
HgeneITGA9chr3:37792060chr3:10347376ENST00000264741+2328182_2328471036RepeatFG-GAP 3
HgeneITGA9chr3:37792060chr3:10347376ENST00000264741+2328233_2898471036RepeatFG-GAP 4
HgeneITGA9chr3:37792060chr3:10347376ENST00000264741+2328290_3498471036RepeatFG-GAP 5
HgeneITGA9chr3:37792060chr3:10347376ENST00000264741+2328351_4088471036RepeatFG-GAP 6
HgeneITGA9chr3:37792060chr3:10347376ENST00000264741+232835_968471036RepeatFG-GAP 1
HgeneITGA9chr3:37792060chr3:10347376ENST00000264741+2328411_4748471036RepeatFG-GAP 7
TgeneSEC13chr3:37792060chr3:10347376ENST00000337354-510210_253153326RepeatNote=WD 5
TgeneSEC13chr3:37792060chr3:10347376ENST00000337354-510260_299153326RepeatNote=WD 6
TgeneSEC13chr3:37792060chr3:10347376ENST00000350697-49148_204150323RepeatNote=WD 4
TgeneSEC13chr3:37792060chr3:10347376ENST00000350697-49210_253150323RepeatNote=WD 5
TgeneSEC13chr3:37792060chr3:10347376ENST00000350697-49260_299150323RepeatNote=WD 6
TgeneSEC13chr3:37792060chr3:10347376ENST00000397109-49148_204136309RepeatNote=WD 4
TgeneSEC13chr3:37792060chr3:10347376ENST00000397109-49210_253136309RepeatNote=WD 5
TgeneSEC13chr3:37792060chr3:10347376ENST00000397109-49260_299136309RepeatNote=WD 6

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneITGA9chr3:37792060chr3:10347376ENST00000264741+23281005_10098471036MotifNote=GFFKR motif
HgeneITGA9chr3:37792060chr3:10347376ENST00000264741+23281003_10358471036Topological domainCytoplasmic
HgeneITGA9chr3:37792060chr3:10347376ENST00000264741+232830_9818471036Topological domainExtracellular
HgeneITGA9chr3:37792060chr3:10347376ENST00000264741+2328982_10028471036TransmembraneHelical
TgeneSEC13chr3:37792060chr3:10347376ENST00000337354-510101_144153326RepeatNote=WD 3
TgeneSEC13chr3:37792060chr3:10347376ENST00000337354-51011_50153326RepeatNote=WD 1
TgeneSEC13chr3:37792060chr3:10347376ENST00000337354-510148_204153326RepeatNote=WD 4
TgeneSEC13chr3:37792060chr3:10347376ENST00000337354-51055_96153326RepeatNote=WD 2
TgeneSEC13chr3:37792060chr3:10347376ENST00000350697-49101_144150323RepeatNote=WD 3
TgeneSEC13chr3:37792060chr3:10347376ENST00000350697-4911_50150323RepeatNote=WD 1
TgeneSEC13chr3:37792060chr3:10347376ENST00000350697-4955_96150323RepeatNote=WD 2
TgeneSEC13chr3:37792060chr3:10347376ENST00000397109-49101_144136309RepeatNote=WD 3
TgeneSEC13chr3:37792060chr3:10347376ENST00000397109-4911_50136309RepeatNote=WD 1
TgeneSEC13chr3:37792060chr3:10347376ENST00000397109-4955_96136309RepeatNote=WD 2


Top

FusionGeneSequence for ITGA9_SEC13


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000397109_chr3_10347376_-_1020aa
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKADSKYSPSVKSPGAVFKCRVH
TNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIYTEADHILPHGFCYIIPSNLQAKGRTLIPCT
EETKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFTWAGTIKVLNLTDNTTLKLNDEVIMNRRYTYLGYAVTAGHFSHPSTIDVVGGAPQ
DKGIGKVTIFRADRRSGTLIKIFQASGKKMGSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
NAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVTITHGDAGGIVPQYSMKLSGQKINPVLRMFGQSISGGIDMDGNGTPDVTVGAFM
SDSVVLLRARPVITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSFHGKHVPGEIGLNTVLMADVAKKEKGQMPRVYFVLLGETMG
QVTEKLQLTYMEETCRHTVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQTVFERNCRSEDCAADLQ
LQGKLLLSSMDEKTLTLALGAVKNISLNISISNLGDDATDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKTE
FSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVDTSITGIMSPTSFVTGESVDAANFIQLDDLECHFQPINITL
QVYNTGPSTLPGSSVSISFPNRLSSGGAEMFHVQEMVIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWK
EEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESV

>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000337354_chr3_10347376_-_1020aa
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKADSKYSPSVKSPGAVFKCRVH
TNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIYTEADHILPHGFCYIIPSNLQAKGRTLIPCT
EETKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFTWAGTIKVLNLTDNTTLKLNDEVIMNRRYTYLGYAVTAGHFSHPSTIDVVGGAPQ
DKGIGKVTIFRADRRSGTLIKIFQASGKKMGSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
NAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVTITHGDAGGIVPQYSMKLSGQKINPVLRMFGQSISGGIDMDGNGTPDVTVGAFM
SDSVVLLRARPVITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSFHGKHVPGEIGLNTVLMADVAKKEKGQMPRVYFVLLGETMG
QVTEKLQLTYMEETCRHTVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQTVFERNCRSEDCAADLQ
LQGKLLLSSMDEKTLTLALGAVKNISLNISISNLGDDATDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKTE
FSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVDTSITGIMSPTSFVTGESVDAANFIQLDDLECHFQPINITL
QVYNTGPSTLPGSSVSISFPNRLSSGGAEMFHVQEMVIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWK
EEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESV

>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000350697_chr3_10347376_-_1020aa
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKADSKYSPSVKSPGAVFKCRVH
TNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIYTEADHILPHGFCYIIPSNLQAKGRTLIPCT
EETKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFTWAGTIKVLNLTDNTTLKLNDEVIMNRRYTYLGYAVTAGHFSHPSTIDVVGGAPQ
DKGIGKVTIFRADRRSGTLIKIFQASGKKMGSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
NAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVTITHGDAGGIVPQYSMKLSGQKINPVLRMFGQSISGGIDMDGNGTPDVTVGAFM
SDSVVLLRARPVITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSFHGKHVPGEIGLNTVLMADVAKKEKGQMPRVYFVLLGETMG
QVTEKLQLTYMEETCRHTVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQTVFERNCRSEDCAADLQ
LQGKLLLSSMDEKTLTLALGAVKNISLNISISNLGDDATDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKTE
FSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVDTSITGIMSPTSFVTGESVDAANFIQLDDLECHFQPINITL
QVYNTGPSTLPGSSVSISFPNRLSSGGAEMFHVQEMVIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWK
EEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESV

>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000397117_chr3_10347376_-_996aa
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKADSKYSPSVKSPGAVFKCRVH
TNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIYTEADHILPHGFCYIIPSNLQAKGRTLIPCT
EETKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFTWAGTIKVLNLTDNTTLKLNDEVIMNRRYTYLGYAVTAGHFSHPSTIDVVGGAPQ
DKGIGKVTIFRADRRSGTLIKIFQASGKKMGSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
NAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVTITHGDAGGIVPQYSMKLSGQKINPVLRMFGQSISGGIDMDGNGTPDVTVGAFM
SDSVVLLRARPVITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSFHGKHVPGEIGLNTVLMADVAKKEKGQMPRVYFVLLGETMG
QVTEKLQLTYMEETCRHTVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQTVFERNCRSEDCAADLQ
LQGKLLLSSMDEKTLTLALGAVKNISLNISISNLGDDATDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKTE
FSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVDTSITGIMSPTSFVTGESVDAANFIQLDDLECHFQPINITL
QVYNTGPSTLPGSSVSISFPNRLSSGGAEMFHVQEMVIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWK
EEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKEELQMQPQ

>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000383801_chr3_10347376_-_1020aa
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKADSKYSPSVKSPGAVFKCRVH
TNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIYTEADHILPHGFCYIIPSNLQAKGRTLIPCT
EETKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFTWAGTIKVLNLTDNTTLKLNDEVIMNRRYTYLGYAVTAGHFSHPSTIDVVGGAPQ
DKGIGKVTIFRADRRSGTLIKIFQASGKKMGSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
NAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVTITHGDAGGIVPQYSMKLSGQKINPVLRMFGQSISGGIDMDGNGTPDVTVGAFM
SDSVVLLRARPVITVDVSIFLPGSINITAPQCHDGQQPVNCLNVTTCFSFHGKHVPGEIGLNTVLMADVAKKEKGQMPRVYFVLLGETMG
QVTEKLQLTYMEETCRHTVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVLRWKKGQKIAQKNQTVFERNCRSEDCAADLQ
LQGKLLLSSMDEKTLTLALGAVKNISLNISISNLGDDATDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKTE
FSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVDTSITGIMSPTSFVTGESVDAANFIQLDDLECHFQPINITL
QVYNTGPSTLPGSSVSISFPNRLSSGGAEMFHVQEMVIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWK
EEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000397109_chr3_10347376_-_3060nt
ATGGGCGGCCCGGCTGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTAC
AACCTCGACCCGCAGCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACG
CGCTGGGTCCTTGTGGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCAC
ACCAACCCTGACCGGAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGC
GATGATGAGTGGATGGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTAC
TATGAAGCCGACCACATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTAT
GAAGAGTATAAGAAGAAGTACGGAGAGGAACACGGCTCCTGCCAGGCTGGGATAGCGGGCTTCTTCACCGAGGAGCTGGTGGTGATGGGT
GCTCCAGGGTCATTTTATTGGGCTGGAACCATCAAAGTGCTGAACCTTACGGACAACACCTATTTAAAACTGAACGACGAAGTGATCATG
AACAGGCGGTACACCTACCTGGGCTACGCAGTGACCGCTGGCCACTTCTCTCACCCGTCCACCATTGATGTGGTAGGAGGTGCCCCACAG
GACAAAGGCATCGGCAAGGTTTATATTTTCAGAGCTGACCGAAGATCAGGCACCTTAATTAAGATCTTTCAAGCATCAGGTAAAAAGATG
GGCTCTTACTTCGGCTCCTCCTTGTGCGCAGTTGACCTGAATGGGGACGGCCTCTCTGACCTGCTGGTGGGGGCCCCCATGTTTTCTGAG
ATCAGGGATGAGGGACAGGTCACTGTCTACATCAACAGAGGAAATGGAGCCCTCGAGGAGCAGCTGGCTCTGACTGGGGATGGTGCCTAC
AATGCGCACTTTGGAGAGAGCATTGCCAGCCTGGACGATCTGGACAATGATGGGTTCCCAGATGTGGCCATTGGTGCACCCAAGGAGGAT
GACTTCGCAGGGGCGGTCTATATCTATCATGGTGATGCCGGTGGGATAGTCCCTCAGTACTCAATGAAACTGTCTGGGCAGAAGATAAAT
CCAGTGCTCCGGATGTTTGGTCAGTCCATATCGGGAGGCATTGATATGGATGGAAATGGCTATCCTGATGTCACTGTTGGAGCCTTCATG
TCCGACAGCGTGGTTCTTCTCAGAGCAAGGCCTGTCATTACGGTGGATGTCTCCATCTTCCTCCCGGGCTCCATCAACATCACAGCGCCT
CAGTGTCACGACGGACAGCAGCCTGTGAACTGCCTGAACGTCACCACCTGCTTCAGCTTCCATGGCAAACACGTTCCAGGAGAGATTGGC
CTGAATTATGTTCTGATGGCTGACGTGGCCAAAAAGGAGAAGGGCCAGATGCCCAGGGTCTACTTTGTGCTGCTGGGAGAGACCATGGGT
CAGGTCACAGAGAAGCTGCAGCTGACTTACATGGAGGAGACGTGTCGTCACTATGTGGCCCATGTGAAGCGGAGGGTGCAGGACGTCATC
AGCCCGATCGTGTTTGAAGCAGCCTACAGCCTCAGTGAGCATGTGACTGGAGAGGAGGAGAGGGAACTGCCGCCTCTGACACCAGTTCTC
CGCTGGAAAAAGGGACAAAAGATTGCCCAAAAGAATCAGACTGTTTTTGAAAGGAATTGCCGTTCAGAGGACTGTGCCGCAGACCTGCAG
CTTCAGGGTAAACTGCTGCTCTCCAGTATGGATGAGAAAACCCTGTATCTAGCTTTGGGGGCTGTGAAGAACATCTCCCTAAACATCTCT
ATCTCCAACCTCGGAGATGATGCCTATGATGCCAACGTGTCCTTCAATGTTTCCCGGGAGCTCTTCTTCATCAACATGTGGCAGAAGGAG
GAGATGGGCATCTCCTGTGAGCTGCTGGAATCGGACTTCCTCAAATGCAGCGTGGGATTTCCTTTCATGAGGTCAAAGTCAAAGTATGAA
TTCAGCGTGATCTTTGATACAAGCCACCTGTCTGGGGAAGAGGAAGTTCTCAGCTTCATTGTTACTGCTCAGAGTGGCAACACGGAGCGC
TCTGAATCCCTGCATGACAACACCCTCGTGCTGATGGTGCCACTGATGCACGAGGTGGACACGTCCATCACCGGAATCATGTCTCCAACC
TCCTTTGTATATGGCGAGTCCGTGGACGCAGCCAACTTCATTCAGCTGGATGACCTGGAGTGTCACTTTCAGCCCATCAATATCACCCTT
CAGGTCTACAACACTGGCCCAAGCACCCTTCCAGGGTCATCTGTCAGCATCTCTTTCCCTAATCGACTCTCATCTGGTGGTGCAGAGATG
TTTCATGTCCAGGAAATGGTGATTGGCTGCAATGCCGTCAGCTGGGCCCCTGCTGTTGTACCTGGAAGCCTCATAGACCACCCATCGGGG
CAGAAACCCAATTACATCAAGAGGTTTGCATCAGGTGGCTGTGACAACCTCATCAAGCTGTGGAAGGAGGAGGAGGACGGCCAGTGGAAG
GAGGAGCAGAAGCTAGAAGCGCACAGTGACTGGGTTCGAGATGTGGCCTGGGCCCCCTCCATCGGCCTGCCCACCAGCACCATCGCCAGC
TGCTCCCAGGATGGTCGTGTGTTCATTTGGACCTGTGATGATGCCTCAAGCAATACGTGGTCCCCTAAATTGTTGCACAAGTTCAACGAT
GTGGTGTGGCATGTGAGCTGGTCCATCACAGCCAACATCCTGGCTGTCTCTGGTGGAGACAATAAGGTGACCCTGTGGAAGGAGTCAGTT
GATGGGCAGTGGGTGTGCATCAGTGATGTCAACAAGGGCCAGGGCTCCGTATCAGCATCAGTGACAGAGGGCCAGCAGAACGAGCAGTGA

>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000337354_chr3_10347376_-_3060nt
ATGGGCGGCCCGGCTGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTAC
AACCTCGACCCGCAGCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACG
CGCTGGGTCCTTGTGGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCAC
ACCAACCCTGACCGGAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGC
GATGATGAGTGGATGGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTAC
TATGAAGCCGACCACATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTAT
GAAGAGTATAAGAAGAAGTACGGAGAGGAACACGGCTCCTGCCAGGCTGGGATAGCGGGCTTCTTCACCGAGGAGCTGGTGGTGATGGGT
GCTCCAGGGTCATTTTATTGGGCTGGAACCATCAAAGTGCTGAACCTTACGGACAACACCTATTTAAAACTGAACGACGAAGTGATCATG
AACAGGCGGTACACCTACCTGGGCTACGCAGTGACCGCTGGCCACTTCTCTCACCCGTCCACCATTGATGTGGTAGGAGGTGCCCCACAG
GACAAAGGCATCGGCAAGGTTTATATTTTCAGAGCTGACCGAAGATCAGGCACCTTAATTAAGATCTTTCAAGCATCAGGTAAAAAGATG
GGCTCTTACTTCGGCTCCTCCTTGTGCGCAGTTGACCTGAATGGGGACGGCCTCTCTGACCTGCTGGTGGGGGCCCCCATGTTTTCTGAG
ATCAGGGATGAGGGACAGGTCACTGTCTACATCAACAGAGGAAATGGAGCCCTCGAGGAGCAGCTGGCTCTGACTGGGGATGGTGCCTAC
AATGCGCACTTTGGAGAGAGCATTGCCAGCCTGGACGATCTGGACAATGATGGGTTCCCAGATGTGGCCATTGGTGCACCCAAGGAGGAT
GACTTCGCAGGGGCGGTCTATATCTATCATGGTGATGCCGGTGGGATAGTCCCTCAGTACTCAATGAAACTGTCTGGGCAGAAGATAAAT
CCAGTGCTCCGGATGTTTGGTCAGTCCATATCGGGAGGCATTGATATGGATGGAAATGGCTATCCTGATGTCACTGTTGGAGCCTTCATG
TCCGACAGCGTGGTTCTTCTCAGAGCAAGGCCTGTCATTACGGTGGATGTCTCCATCTTCCTCCCGGGCTCCATCAACATCACAGCGCCT
CAGTGTCACGACGGACAGCAGCCTGTGAACTGCCTGAACGTCACCACCTGCTTCAGCTTCCATGGCAAACACGTTCCAGGAGAGATTGGC
CTGAATTATGTTCTGATGGCTGACGTGGCCAAAAAGGAGAAGGGCCAGATGCCCAGGGTCTACTTTGTGCTGCTGGGAGAGACCATGGGT
CAGGTCACAGAGAAGCTGCAGCTGACTTACATGGAGGAGACGTGTCGTCACTATGTGGCCCATGTGAAGCGGAGGGTGCAGGACGTCATC
AGCCCGATCGTGTTTGAAGCAGCCTACAGCCTCAGTGAGCATGTGACTGGAGAGGAGGAGAGGGAACTGCCGCCTCTGACACCAGTTCTC
CGCTGGAAAAAGGGACAAAAGATTGCCCAAAAGAATCAGACTGTTTTTGAAAGGAATTGCCGTTCAGAGGACTGTGCCGCAGACCTGCAG
CTTCAGGGTAAACTGCTGCTCTCCAGTATGGATGAGAAAACCCTGTATCTAGCTTTGGGGGCTGTGAAGAACATCTCCCTAAACATCTCT
ATCTCCAACCTCGGAGATGATGCCTATGATGCCAACGTGTCCTTCAATGTTTCCCGGGAGCTCTTCTTCATCAACATGTGGCAGAAGGAG
GAGATGGGCATCTCCTGTGAGCTGCTGGAATCGGACTTCCTCAAATGCAGCGTGGGATTTCCTTTCATGAGGTCAAAGTCAAAGTATGAA
TTCAGCGTGATCTTTGATACAAGCCACCTGTCTGGGGAAGAGGAAGTTCTCAGCTTCATTGTTACTGCTCAGAGTGGCAACACGGAGCGC
TCTGAATCCCTGCATGACAACACCCTCGTGCTGATGGTGCCACTGATGCACGAGGTGGACACGTCCATCACCGGAATCATGTCTCCAACC
TCCTTTGTATATGGCGAGTCCGTGGACGCAGCCAACTTCATTCAGCTGGATGACCTGGAGTGTCACTTTCAGCCCATCAATATCACCCTT
CAGGTCTACAACACTGGCCCAAGCACCCTTCCAGGGTCATCTGTCAGCATCTCTTTCCCTAATCGACTCTCATCTGGTGGTGCAGAGATG
TTTCATGTCCAGGAAATGGTGATTGGCTGCAATGCCGTCAGCTGGGCCCCTGCTGTTGTACCTGGAAGCCTCATAGACCACCCATCGGGG
CAGAAACCCAATTACATCAAGAGGTTTGCATCAGGTGGCTGTGACAACCTCATCAAGCTGTGGAAGGAGGAGGAGGACGGCCAGTGGAAG
GAGGAGCAGAAGCTAGAAGCGCACAGTGACTGGGTTCGAGATGTGGCCTGGGCCCCCTCCATCGGCCTGCCCACCAGCACCATCGCCAGC
TGCTCCCAGGATGGTCGTGTGTTCATTTGGACCTGTGATGATGCCTCAAGCAATACGTGGTCCCCTAAATTGTTGCACAAGTTCAACGAT
GTGGTGTGGCATGTGAGCTGGTCCATCACAGCCAACATCCTGGCTGTCTCTGGTGGAGACAATAAGGTGACCCTGTGGAAGGAGTCAGTT
GATGGGCAGTGGGTGTGCATCAGTGATGTCAACAAGGGCCAGGGCTCCGTATCAGCATCAGTGACAGAGGGCCAGCAGAACGAGCAGTGA

>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000350697_chr3_10347376_-_3060nt
ATGGGCGGCCCGGCTGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTAC
AACCTCGACCCGCAGCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACG
CGCTGGGTCCTTGTGGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCAC
ACCAACCCTGACCGGAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGC
GATGATGAGTGGATGGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTAC
TATGAAGCCGACCACATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTAT
GAAGAGTATAAGAAGAAGTACGGAGAGGAACACGGCTCCTGCCAGGCTGGGATAGCGGGCTTCTTCACCGAGGAGCTGGTGGTGATGGGT
GCTCCAGGGTCATTTTATTGGGCTGGAACCATCAAAGTGCTGAACCTTACGGACAACACCTATTTAAAACTGAACGACGAAGTGATCATG
AACAGGCGGTACACCTACCTGGGCTACGCAGTGACCGCTGGCCACTTCTCTCACCCGTCCACCATTGATGTGGTAGGAGGTGCCCCACAG
GACAAAGGCATCGGCAAGGTTTATATTTTCAGAGCTGACCGAAGATCAGGCACCTTAATTAAGATCTTTCAAGCATCAGGTAAAAAGATG
GGCTCTTACTTCGGCTCCTCCTTGTGCGCAGTTGACCTGAATGGGGACGGCCTCTCTGACCTGCTGGTGGGGGCCCCCATGTTTTCTGAG
ATCAGGGATGAGGGACAGGTCACTGTCTACATCAACAGAGGAAATGGAGCCCTCGAGGAGCAGCTGGCTCTGACTGGGGATGGTGCCTAC
AATGCGCACTTTGGAGAGAGCATTGCCAGCCTGGACGATCTGGACAATGATGGGTTCCCAGATGTGGCCATTGGTGCACCCAAGGAGGAT
GACTTCGCAGGGGCGGTCTATATCTATCATGGTGATGCCGGTGGGATAGTCCCTCAGTACTCAATGAAACTGTCTGGGCAGAAGATAAAT
CCAGTGCTCCGGATGTTTGGTCAGTCCATATCGGGAGGCATTGATATGGATGGAAATGGCTATCCTGATGTCACTGTTGGAGCCTTCATG
TCCGACAGCGTGGTTCTTCTCAGAGCAAGGCCTGTCATTACGGTGGATGTCTCCATCTTCCTCCCGGGCTCCATCAACATCACAGCGCCT
CAGTGTCACGACGGACAGCAGCCTGTGAACTGCCTGAACGTCACCACCTGCTTCAGCTTCCATGGCAAACACGTTCCAGGAGAGATTGGC
CTGAATTATGTTCTGATGGCTGACGTGGCCAAAAAGGAGAAGGGCCAGATGCCCAGGGTCTACTTTGTGCTGCTGGGAGAGACCATGGGT
CAGGTCACAGAGAAGCTGCAGCTGACTTACATGGAGGAGACGTGTCGTCACTATGTGGCCCATGTGAAGCGGAGGGTGCAGGACGTCATC
AGCCCGATCGTGTTTGAAGCAGCCTACAGCCTCAGTGAGCATGTGACTGGAGAGGAGGAGAGGGAACTGCCGCCTCTGACACCAGTTCTC
CGCTGGAAAAAGGGACAAAAGATTGCCCAAAAGAATCAGACTGTTTTTGAAAGGAATTGCCGTTCAGAGGACTGTGCCGCAGACCTGCAG
CTTCAGGGTAAACTGCTGCTCTCCAGTATGGATGAGAAAACCCTGTATCTAGCTTTGGGGGCTGTGAAGAACATCTCCCTAAACATCTCT
ATCTCCAACCTCGGAGATGATGCCTATGATGCCAACGTGTCCTTCAATGTTTCCCGGGAGCTCTTCTTCATCAACATGTGGCAGAAGGAG
GAGATGGGCATCTCCTGTGAGCTGCTGGAATCGGACTTCCTCAAATGCAGCGTGGGATTTCCTTTCATGAGGTCAAAGTCAAAGTATGAA
TTCAGCGTGATCTTTGATACAAGCCACCTGTCTGGGGAAGAGGAAGTTCTCAGCTTCATTGTTACTGCTCAGAGTGGCAACACGGAGCGC
TCTGAATCCCTGCATGACAACACCCTCGTGCTGATGGTGCCACTGATGCACGAGGTGGACACGTCCATCACCGGAATCATGTCTCCAACC
TCCTTTGTATATGGCGAGTCCGTGGACGCAGCCAACTTCATTCAGCTGGATGACCTGGAGTGTCACTTTCAGCCCATCAATATCACCCTT
CAGGTCTACAACACTGGCCCAAGCACCCTTCCAGGGTCATCTGTCAGCATCTCTTTCCCTAATCGACTCTCATCTGGTGGTGCAGAGATG
TTTCATGTCCAGGAAATGGTGATTGGCTGCAATGCCGTCAGCTGGGCCCCTGCTGTTGTACCTGGAAGCCTCATAGACCACCCATCGGGG
CAGAAACCCAATTACATCAAGAGGTTTGCATCAGGTGGCTGTGACAACCTCATCAAGCTGTGGAAGGAGGAGGAGGACGGCCAGTGGAAG
GAGGAGCAGAAGCTAGAAGCGCACAGTGACTGGGTTCGAGATGTGGCCTGGGCCCCCTCCATCGGCCTGCCCACCAGCACCATCGCCAGC
TGCTCCCAGGATGGTCGTGTGTTCATTTGGACCTGTGATGATGCCTCAAGCAATACGTGGTCCCCTAAATTGTTGCACAAGTTCAACGAT
GTGGTGTGGCATGTGAGCTGGTCCATCACAGCCAACATCCTGGCTGTCTCTGGTGGAGACAATAAGGTGACCCTGTGGAAGGAGTCAGTT
GATGGGCAGTGGGTGTGCATCAGTGATGTCAACAAGGGCCAGGGCTCCGTATCAGCATCAGTGACAGAGGGCCAGCAGAACGAGCAGTGA

>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000397117_chr3_10347376_-_2988nt
ATGGGCGGCCCGGCTGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTAC
AACCTCGACCCGCAGCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACG
CGCTGGGTCCTTGTGGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCAC
ACCAACCCTGACCGGAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGC
GATGATGAGTGGATGGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTAC
TATGAAGCCGACCACATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTAT
GAAGAGTATAAGAAGAAGTACGGAGAGGAACACGGCTCCTGCCAGGCTGGGATAGCGGGCTTCTTCACCGAGGAGCTGGTGGTGATGGGT
GCTCCAGGGTCATTTTATTGGGCTGGAACCATCAAAGTGCTGAACCTTACGGACAACACCTATTTAAAACTGAACGACGAAGTGATCATG
AACAGGCGGTACACCTACCTGGGCTACGCAGTGACCGCTGGCCACTTCTCTCACCCGTCCACCATTGATGTGGTAGGAGGTGCCCCACAG
GACAAAGGCATCGGCAAGGTTTATATTTTCAGAGCTGACCGAAGATCAGGCACCTTAATTAAGATCTTTCAAGCATCAGGTAAAAAGATG
GGCTCTTACTTCGGCTCCTCCTTGTGCGCAGTTGACCTGAATGGGGACGGCCTCTCTGACCTGCTGGTGGGGGCCCCCATGTTTTCTGAG
ATCAGGGATGAGGGACAGGTCACTGTCTACATCAACAGAGGAAATGGAGCCCTCGAGGAGCAGCTGGCTCTGACTGGGGATGGTGCCTAC
AATGCGCACTTTGGAGAGAGCATTGCCAGCCTGGACGATCTGGACAATGATGGGTTCCCAGATGTGGCCATTGGTGCACCCAAGGAGGAT
GACTTCGCAGGGGCGGTCTATATCTATCATGGTGATGCCGGTGGGATAGTCCCTCAGTACTCAATGAAACTGTCTGGGCAGAAGATAAAT
CCAGTGCTCCGGATGTTTGGTCAGTCCATATCGGGAGGCATTGATATGGATGGAAATGGCTATCCTGATGTCACTGTTGGAGCCTTCATG
TCCGACAGCGTGGTTCTTCTCAGAGCAAGGCCTGTCATTACGGTGGATGTCTCCATCTTCCTCCCGGGCTCCATCAACATCACAGCGCCT
CAGTGTCACGACGGACAGCAGCCTGTGAACTGCCTGAACGTCACCACCTGCTTCAGCTTCCATGGCAAACACGTTCCAGGAGAGATTGGC
CTGAATTATGTTCTGATGGCTGACGTGGCCAAAAAGGAGAAGGGCCAGATGCCCAGGGTCTACTTTGTGCTGCTGGGAGAGACCATGGGT
CAGGTCACAGAGAAGCTGCAGCTGACTTACATGGAGGAGACGTGTCGTCACTATGTGGCCCATGTGAAGCGGAGGGTGCAGGACGTCATC
AGCCCGATCGTGTTTGAAGCAGCCTACAGCCTCAGTGAGCATGTGACTGGAGAGGAGGAGAGGGAACTGCCGCCTCTGACACCAGTTCTC
CGCTGGAAAAAGGGACAAAAGATTGCCCAAAAGAATCAGACTGTTTTTGAAAGGAATTGCCGTTCAGAGGACTGTGCCGCAGACCTGCAG
CTTCAGGGTAAACTGCTGCTCTCCAGTATGGATGAGAAAACCCTGTATCTAGCTTTGGGGGCTGTGAAGAACATCTCCCTAAACATCTCT
ATCTCCAACCTCGGAGATGATGCCTATGATGCCAACGTGTCCTTCAATGTTTCCCGGGAGCTCTTCTTCATCAACATGTGGCAGAAGGAG
GAGATGGGCATCTCCTGTGAGCTGCTGGAATCGGACTTCCTCAAATGCAGCGTGGGATTTCCTTTCATGAGGTCAAAGTCAAAGTATGAA
TTCAGCGTGATCTTTGATACAAGCCACCTGTCTGGGGAAGAGGAAGTTCTCAGCTTCATTGTTACTGCTCAGAGTGGCAACACGGAGCGC
TCTGAATCCCTGCATGACAACACCCTCGTGCTGATGGTGCCACTGATGCACGAGGTGGACACGTCCATCACCGGAATCATGTCTCCAACC
TCCTTTGTATATGGCGAGTCCGTGGACGCAGCCAACTTCATTCAGCTGGATGACCTGGAGTGTCACTTTCAGCCCATCAATATCACCCTT
CAGGTCTACAACACTGGCCCAAGCACCCTTCCAGGGTCATCTGTCAGCATCTCTTTCCCTAATCGACTCTCATCTGGTGGTGCAGAGATG
TTTCATGTCCAGGAAATGGTGATTGGCTGCAATGCCGTCAGCTGGGCCCCTGCTGTTGTACCTGGAAGCCTCATAGACCACCCATCGGGG
CAGAAACCCAATTACATCAAGAGGTTTGCATCAGGTGGCTGTGACAACCTCATCAAGCTGTGGAAGGAGGAGGAGGACGGCCAGTGGAAG
GAGGAGCAGAAGCTAGAAGCGCACAGTGACTGGGTTCGAGATGTGGCCTGGGCCCCCTCCATCGGCCTGCCCACCAGCACCATCGCCAGC
TGCTCCCAGGATGGTCGTGTGTTCATTTGGACCTGTGATGATGCCTCAAGCAATACGTGGTCCCCTAAATTGTTGCACAAGTTCAACGAT
GTGGTGTGGCATGTGAGCTGGTCCATCACAGCCAACATCCTGGCTGTCTCTGGTGGAGACAATAAGGAGGAGTTACAGATGCAGCCACAG

>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000383801_chr3_10347376_-_3060nt
ATGGGCGGCCCGGCTGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTAC
AACCTCGACCCGCAGCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACG
CGCTGGGTCCTTGTGGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCAC
ACCAACCCTGACCGGAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGC
GATGATGAGTGGATGGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTAC
TATGAAGCCGACCACATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTAT
GAAGAGTATAAGAAGAAGTACGGAGAGGAACACGGCTCCTGCCAGGCTGGGATAGCGGGCTTCTTCACCGAGGAGCTGGTGGTGATGGGT
GCTCCAGGGTCATTTTATTGGGCTGGAACCATCAAAGTGCTGAACCTTACGGACAACACCTATTTAAAACTGAACGACGAAGTGATCATG
AACAGGCGGTACACCTACCTGGGCTACGCAGTGACCGCTGGCCACTTCTCTCACCCGTCCACCATTGATGTGGTAGGAGGTGCCCCACAG
GACAAAGGCATCGGCAAGGTTTATATTTTCAGAGCTGACCGAAGATCAGGCACCTTAATTAAGATCTTTCAAGCATCAGGTAAAAAGATG
GGCTCTTACTTCGGCTCCTCCTTGTGCGCAGTTGACCTGAATGGGGACGGCCTCTCTGACCTGCTGGTGGGGGCCCCCATGTTTTCTGAG
ATCAGGGATGAGGGACAGGTCACTGTCTACATCAACAGAGGAAATGGAGCCCTCGAGGAGCAGCTGGCTCTGACTGGGGATGGTGCCTAC
AATGCGCACTTTGGAGAGAGCATTGCCAGCCTGGACGATCTGGACAATGATGGGTTCCCAGATGTGGCCATTGGTGCACCCAAGGAGGAT
GACTTCGCAGGGGCGGTCTATATCTATCATGGTGATGCCGGTGGGATAGTCCCTCAGTACTCAATGAAACTGTCTGGGCAGAAGATAAAT
CCAGTGCTCCGGATGTTTGGTCAGTCCATATCGGGAGGCATTGATATGGATGGAAATGGCTATCCTGATGTCACTGTTGGAGCCTTCATG
TCCGACAGCGTGGTTCTTCTCAGAGCAAGGCCTGTCATTACGGTGGATGTCTCCATCTTCCTCCCGGGCTCCATCAACATCACAGCGCCT
CAGTGTCACGACGGACAGCAGCCTGTGAACTGCCTGAACGTCACCACCTGCTTCAGCTTCCATGGCAAACACGTTCCAGGAGAGATTGGC
CTGAATTATGTTCTGATGGCTGACGTGGCCAAAAAGGAGAAGGGCCAGATGCCCAGGGTCTACTTTGTGCTGCTGGGAGAGACCATGGGT
CAGGTCACAGAGAAGCTGCAGCTGACTTACATGGAGGAGACGTGTCGTCACTATGTGGCCCATGTGAAGCGGAGGGTGCAGGACGTCATC
AGCCCGATCGTGTTTGAAGCAGCCTACAGCCTCAGTGAGCATGTGACTGGAGAGGAGGAGAGGGAACTGCCGCCTCTGACACCAGTTCTC
CGCTGGAAAAAGGGACAAAAGATTGCCCAAAAGAATCAGACTGTTTTTGAAAGGAATTGCCGTTCAGAGGACTGTGCCGCAGACCTGCAG
CTTCAGGGTAAACTGCTGCTCTCCAGTATGGATGAGAAAACCCTGTATCTAGCTTTGGGGGCTGTGAAGAACATCTCCCTAAACATCTCT
ATCTCCAACCTCGGAGATGATGCCTATGATGCCAACGTGTCCTTCAATGTTTCCCGGGAGCTCTTCTTCATCAACATGTGGCAGAAGGAG
GAGATGGGCATCTCCTGTGAGCTGCTGGAATCGGACTTCCTCAAATGCAGCGTGGGATTTCCTTTCATGAGGTCAAAGTCAAAGTATGAA
TTCAGCGTGATCTTTGATACAAGCCACCTGTCTGGGGAAGAGGAAGTTCTCAGCTTCATTGTTACTGCTCAGAGTGGCAACACGGAGCGC
TCTGAATCCCTGCATGACAACACCCTCGTGCTGATGGTGCCACTGATGCACGAGGTGGACACGTCCATCACCGGAATCATGTCTCCAACC
TCCTTTGTATATGGCGAGTCCGTGGACGCAGCCAACTTCATTCAGCTGGATGACCTGGAGTGTCACTTTCAGCCCATCAATATCACCCTT
CAGGTCTACAACACTGGCCCAAGCACCCTTCCAGGGTCATCTGTCAGCATCTCTTTCCCTAATCGACTCTCATCTGGTGGTGCAGAGATG
TTTCATGTCCAGGAAATGGTGATTGGCTGCAATGCCGTCAGCTGGGCCCCTGCTGTTGTACCTGGAAGCCTCATAGACCACCCATCGGGG
CAGAAACCCAATTACATCAAGAGGTTTGCATCAGGTGGCTGTGACAACCTCATCAAGCTGTGGAAGGAGGAGGAGGACGGCCAGTGGAAG
GAGGAGCAGAAGCTAGAAGCGCACAGTGACTGGGTTCGAGATGTGGCCTGGGCCCCCTCCATCGGCCTGCCCACCAGCACCATCGCCAGC
TGCTCCCAGGATGGTCGTGTGTTCATTTGGACCTGTGATGATGCCTCAAGCAATACGTGGTCCCCTAAATTGTTGCACAAGTTCAACGAT
GTGGTGTGGCATGTGAGCTGGTCCATCACAGCCAACATCCTGGCTGTCTCTGGTGGAGACAATAAGGTGACCCTGTGGAAGGAGTCAGTT
GATGGGCAGTGGGTGTGCATCAGTGATGTCAACAAGGGCCAGGGCTCCGTATCAGCATCAGTGACAGAGGGCCAGCAGAACGAGCAGTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000397109_chr3_10347376_-_3646nt
CCGGCCCGGGACCCGCTCGCGCAGACTTCTCGGGCGGACTGAGGACGCCGCCGCTCGGGGCCGCCCCTGTGCTCGCCTTCAGCGCCCGCT
CAGCCCGCCGTCCGCGCCCCGGTGGCGGGCCCGACGCCCGCATTCCGCCCGTGTCCAGGCGCAGAGCTCCCGCCCCGGGGAGCTTCCTGG
CCGTCGGCGGGCCCCGCGGCCCGCGCGCTCGGCGCCCTGCTCGCCGGGCAGAGGGGAAGGCGGCGGCCGGCTGGGGATGGGCGGCCCGGC
TGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTACAACCTCGACCCGCA
GCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACGCGCTGGGTCCTTGT
GGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCACACCAACCCTGACCG
GAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGCGATGATGAGTGGAT
GGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTACTATGAAGCCGACCA
CATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTATGAAGAGTATAAGAA
GAAGTACGGAGAGGAACACGGCTCCTGCCAGGCTGGGATAGCGGGCTTCTTCACCGAGGAGCTGGTGGTGATGGGTGCTCCAGGGTCATT
TTATTGGGCTGGAACCATCAAAGTGCTGAACCTTACGGACAACACCTATTTAAAACTGAACGACGAAGTGATCATGAACAGGCGGTACAC
CTACCTGGGCTACGCAGTGACCGCTGGCCACTTCTCTCACCCGTCCACCATTGATGTGGTAGGAGGTGCCCCACAGGACAAAGGCATCGG
CAAGGTTTATATTTTCAGAGCTGACCGAAGATCAGGCACCTTAATTAAGATCTTTCAAGCATCAGGTAAAAAGATGGGCTCTTACTTCGG
CTCCTCCTTGTGCGCAGTTGACCTGAATGGGGACGGCCTCTCTGACCTGCTGGTGGGGGCCCCCATGTTTTCTGAGATCAGGGATGAGGG
ACAGGTCACTGTCTACATCAACAGAGGAAATGGAGCCCTCGAGGAGCAGCTGGCTCTGACTGGGGATGGTGCCTACAATGCGCACTTTGG
AGAGAGCATTGCCAGCCTGGACGATCTGGACAATGATGGGTTCCCAGATGTGGCCATTGGTGCACCCAAGGAGGATGACTTCGCAGGGGC
GGTCTATATCTATCATGGTGATGCCGGTGGGATAGTCCCTCAGTACTCAATGAAACTGTCTGGGCAGAAGATAAATCCAGTGCTCCGGAT
GTTTGGTCAGTCCATATCGGGAGGCATTGATATGGATGGAAATGGCTATCCTGATGTCACTGTTGGAGCCTTCATGTCCGACAGCGTGGT
TCTTCTCAGAGCAAGGCCTGTCATTACGGTGGATGTCTCCATCTTCCTCCCGGGCTCCATCAACATCACAGCGCCTCAGTGTCACGACGG
ACAGCAGCCTGTGAACTGCCTGAACGTCACCACCTGCTTCAGCTTCCATGGCAAACACGTTCCAGGAGAGATTGGCCTGAATTATGTTCT
GATGGCTGACGTGGCCAAAAAGGAGAAGGGCCAGATGCCCAGGGTCTACTTTGTGCTGCTGGGAGAGACCATGGGTCAGGTCACAGAGAA
GCTGCAGCTGACTTACATGGAGGAGACGTGTCGTCACTATGTGGCCCATGTGAAGCGGAGGGTGCAGGACGTCATCAGCCCGATCGTGTT
TGAAGCAGCCTACAGCCTCAGTGAGCATGTGACTGGAGAGGAGGAGAGGGAACTGCCGCCTCTGACACCAGTTCTCCGCTGGAAAAAGGG
ACAAAAGATTGCCCAAAAGAATCAGACTGTTTTTGAAAGGAATTGCCGTTCAGAGGACTGTGCCGCAGACCTGCAGCTTCAGGGTAAACT
GCTGCTCTCCAGTATGGATGAGAAAACCCTGTATCTAGCTTTGGGGGCTGTGAAGAACATCTCCCTAAACATCTCTATCTCCAACCTCGG
AGATGATGCCTATGATGCCAACGTGTCCTTCAATGTTTCCCGGGAGCTCTTCTTCATCAACATGTGGCAGAAGGAGGAGATGGGCATCTC
CTGTGAGCTGCTGGAATCGGACTTCCTCAAATGCAGCGTGGGATTTCCTTTCATGAGGTCAAAGTCAAAGTATGAATTCAGCGTGATCTT
TGATACAAGCCACCTGTCTGGGGAAGAGGAAGTTCTCAGCTTCATTGTTACTGCTCAGAGTGGCAACACGGAGCGCTCTGAATCCCTGCA
TGACAACACCCTCGTGCTGATGGTGCCACTGATGCACGAGGTGGACACGTCCATCACCGGAATCATGTCTCCAACCTCCTTTGTATATGG
CGAGTCCGTGGACGCAGCCAACTTCATTCAGCTGGATGACCTGGAGTGTCACTTTCAGCCCATCAATATCACCCTTCAGGTCTACAACAC
TGGCCCAAGCACCCTTCCAGGGTCATCTGTCAGCATCTCTTTCCCTAATCGACTCTCATCTGGTGGTGCAGAGATGTTTCATGTCCAGGA
AATGGTGATTGGCTGCAATGCCGTCAGCTGGGCCCCTGCTGTTGTACCTGGAAGCCTCATAGACCACCCATCGGGGCAGAAACCCAATTA
CATCAAGAGGTTTGCATCAGGTGGCTGTGACAACCTCATCAAGCTGTGGAAGGAGGAGGAGGACGGCCAGTGGAAGGAGGAGCAGAAGCT
AGAAGCGCACAGTGACTGGGTTCGAGATGTGGCCTGGGCCCCCTCCATCGGCCTGCCCACCAGCACCATCGCCAGCTGCTCCCAGGATGG
TCGTGTGTTCATTTGGACCTGTGATGATGCCTCAAGCAATACGTGGTCCCCTAAATTGTTGCACAAGTTCAACGATGTGGTGTGGCATGT
GAGCTGGTCCATCACAGCCAACATCCTGGCTGTCTCTGGTGGAGACAATAAGGTGACCCTGTGGAAGGAGTCAGTTGATGGGCAGTGGGT
GTGCATCAGTGATGTCAACAAGGGCCAGGGCTCCGTATCAGCATCAGTGACAGAGGGCCAGCAGAACGAGCAGTGACAAGACAGGTGGGG
CCTGGCTCCCCACCCGCCAGCTCCAGGACTGCCCCTTCCTGGGCCAACTAACCAGACAACTGGGAAGAGCCCCCAACTCCAACAGGATTA
TTTTCCCAGGAGGAGTTACAGATGCAGCCACAGATTGATCATCTGCCTTAACGTGATCGGAGATGCTTTGTAATCTACTGTCCAGCTGAA
AGCACTCATGTTACGAGGAAGAAACTACAAGTGATGTTCAAATCTATTTTGGGTCATTTTTATGTACCTTTGGGTTCAGGCATTATTTGG

>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000337354_chr3_10347376_-_3646nt
CCGGCCCGGGACCCGCTCGCGCAGACTTCTCGGGCGGACTGAGGACGCCGCCGCTCGGGGCCGCCCCTGTGCTCGCCTTCAGCGCCCGCT
CAGCCCGCCGTCCGCGCCCCGGTGGCGGGCCCGACGCCCGCATTCCGCCCGTGTCCAGGCGCAGAGCTCCCGCCCCGGGGAGCTTCCTGG
CCGTCGGCGGGCCCCGCGGCCCGCGCGCTCGGCGCCCTGCTCGCCGGGCAGAGGGGAAGGCGGCGGCCGGCTGGGGATGGGCGGCCCGGC
TGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTACAACCTCGACCCGCA
GCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACGCGCTGGGTCCTTGT
GGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCACACCAACCCTGACCG
GAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGCGATGATGAGTGGAT
GGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTACTATGAAGCCGACCA
CATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTATGAAGAGTATAAGAA
GAAGTACGGAGAGGAACACGGCTCCTGCCAGGCTGGGATAGCGGGCTTCTTCACCGAGGAGCTGGTGGTGATGGGTGCTCCAGGGTCATT
TTATTGGGCTGGAACCATCAAAGTGCTGAACCTTACGGACAACACCTATTTAAAACTGAACGACGAAGTGATCATGAACAGGCGGTACAC
CTACCTGGGCTACGCAGTGACCGCTGGCCACTTCTCTCACCCGTCCACCATTGATGTGGTAGGAGGTGCCCCACAGGACAAAGGCATCGG
CAAGGTTTATATTTTCAGAGCTGACCGAAGATCAGGCACCTTAATTAAGATCTTTCAAGCATCAGGTAAAAAGATGGGCTCTTACTTCGG
CTCCTCCTTGTGCGCAGTTGACCTGAATGGGGACGGCCTCTCTGACCTGCTGGTGGGGGCCCCCATGTTTTCTGAGATCAGGGATGAGGG
ACAGGTCACTGTCTACATCAACAGAGGAAATGGAGCCCTCGAGGAGCAGCTGGCTCTGACTGGGGATGGTGCCTACAATGCGCACTTTGG
AGAGAGCATTGCCAGCCTGGACGATCTGGACAATGATGGGTTCCCAGATGTGGCCATTGGTGCACCCAAGGAGGATGACTTCGCAGGGGC
GGTCTATATCTATCATGGTGATGCCGGTGGGATAGTCCCTCAGTACTCAATGAAACTGTCTGGGCAGAAGATAAATCCAGTGCTCCGGAT
GTTTGGTCAGTCCATATCGGGAGGCATTGATATGGATGGAAATGGCTATCCTGATGTCACTGTTGGAGCCTTCATGTCCGACAGCGTGGT
TCTTCTCAGAGCAAGGCCTGTCATTACGGTGGATGTCTCCATCTTCCTCCCGGGCTCCATCAACATCACAGCGCCTCAGTGTCACGACGG
ACAGCAGCCTGTGAACTGCCTGAACGTCACCACCTGCTTCAGCTTCCATGGCAAACACGTTCCAGGAGAGATTGGCCTGAATTATGTTCT
GATGGCTGACGTGGCCAAAAAGGAGAAGGGCCAGATGCCCAGGGTCTACTTTGTGCTGCTGGGAGAGACCATGGGTCAGGTCACAGAGAA
GCTGCAGCTGACTTACATGGAGGAGACGTGTCGTCACTATGTGGCCCATGTGAAGCGGAGGGTGCAGGACGTCATCAGCCCGATCGTGTT
TGAAGCAGCCTACAGCCTCAGTGAGCATGTGACTGGAGAGGAGGAGAGGGAACTGCCGCCTCTGACACCAGTTCTCCGCTGGAAAAAGGG
ACAAAAGATTGCCCAAAAGAATCAGACTGTTTTTGAAAGGAATTGCCGTTCAGAGGACTGTGCCGCAGACCTGCAGCTTCAGGGTAAACT
GCTGCTCTCCAGTATGGATGAGAAAACCCTGTATCTAGCTTTGGGGGCTGTGAAGAACATCTCCCTAAACATCTCTATCTCCAACCTCGG
AGATGATGCCTATGATGCCAACGTGTCCTTCAATGTTTCCCGGGAGCTCTTCTTCATCAACATGTGGCAGAAGGAGGAGATGGGCATCTC
CTGTGAGCTGCTGGAATCGGACTTCCTCAAATGCAGCGTGGGATTTCCTTTCATGAGGTCAAAGTCAAAGTATGAATTCAGCGTGATCTT
TGATACAAGCCACCTGTCTGGGGAAGAGGAAGTTCTCAGCTTCATTGTTACTGCTCAGAGTGGCAACACGGAGCGCTCTGAATCCCTGCA
TGACAACACCCTCGTGCTGATGGTGCCACTGATGCACGAGGTGGACACGTCCATCACCGGAATCATGTCTCCAACCTCCTTTGTATATGG
CGAGTCCGTGGACGCAGCCAACTTCATTCAGCTGGATGACCTGGAGTGTCACTTTCAGCCCATCAATATCACCCTTCAGGTCTACAACAC
TGGCCCAAGCACCCTTCCAGGGTCATCTGTCAGCATCTCTTTCCCTAATCGACTCTCATCTGGTGGTGCAGAGATGTTTCATGTCCAGGA
AATGGTGATTGGCTGCAATGCCGTCAGCTGGGCCCCTGCTGTTGTACCTGGAAGCCTCATAGACCACCCATCGGGGCAGAAACCCAATTA
CATCAAGAGGTTTGCATCAGGTGGCTGTGACAACCTCATCAAGCTGTGGAAGGAGGAGGAGGACGGCCAGTGGAAGGAGGAGCAGAAGCT
AGAAGCGCACAGTGACTGGGTTCGAGATGTGGCCTGGGCCCCCTCCATCGGCCTGCCCACCAGCACCATCGCCAGCTGCTCCCAGGATGG
TCGTGTGTTCATTTGGACCTGTGATGATGCCTCAAGCAATACGTGGTCCCCTAAATTGTTGCACAAGTTCAACGATGTGGTGTGGCATGT
GAGCTGGTCCATCACAGCCAACATCCTGGCTGTCTCTGGTGGAGACAATAAGGTGACCCTGTGGAAGGAGTCAGTTGATGGGCAGTGGGT
GTGCATCAGTGATGTCAACAAGGGCCAGGGCTCCGTATCAGCATCAGTGACAGAGGGCCAGCAGAACGAGCAGTGACAAGACAGGTGGGG
CCTGGCTCCCCACCCGCCAGCTCCAGGACTGCCCCTTCCTGGGCCAACTAACCAGACAACTGGGAAGAGCCCCCAACTCCAACAGGATTA
TTTTCCCAGGAGGAGTTACAGATGCAGCCACAGATTGATCATCTGCCTTAACGTGATCGGAGATGCTTTGTAATCTACTGTCCAGCTGAA
AGCACTCATGTTACGAGGAAGAAACTACAAGTGATGTTCAAATCTATTTTGGGTCATTTTTATGTACCTTTGGGTTCAGGCATTATTTGG

>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000350697_chr3_10347376_-_3646nt
CCGGCCCGGGACCCGCTCGCGCAGACTTCTCGGGCGGACTGAGGACGCCGCCGCTCGGGGCCGCCCCTGTGCTCGCCTTCAGCGCCCGCT
CAGCCCGCCGTCCGCGCCCCGGTGGCGGGCCCGACGCCCGCATTCCGCCCGTGTCCAGGCGCAGAGCTCCCGCCCCGGGGAGCTTCCTGG
CCGTCGGCGGGCCCCGCGGCCCGCGCGCTCGGCGCCCTGCTCGCCGGGCAGAGGGGAAGGCGGCGGCCGGCTGGGGATGGGCGGCCCGGC
TGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTACAACCTCGACCCGCA
GCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACGCGCTGGGTCCTTGT
GGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCACACCAACCCTGACCG
GAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGCGATGATGAGTGGAT
GGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTACTATGAAGCCGACCA
CATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTATGAAGAGTATAAGAA
GAAGTACGGAGAGGAACACGGCTCCTGCCAGGCTGGGATAGCGGGCTTCTTCACCGAGGAGCTGGTGGTGATGGGTGCTCCAGGGTCATT
TTATTGGGCTGGAACCATCAAAGTGCTGAACCTTACGGACAACACCTATTTAAAACTGAACGACGAAGTGATCATGAACAGGCGGTACAC
CTACCTGGGCTACGCAGTGACCGCTGGCCACTTCTCTCACCCGTCCACCATTGATGTGGTAGGAGGTGCCCCACAGGACAAAGGCATCGG
CAAGGTTTATATTTTCAGAGCTGACCGAAGATCAGGCACCTTAATTAAGATCTTTCAAGCATCAGGTAAAAAGATGGGCTCTTACTTCGG
CTCCTCCTTGTGCGCAGTTGACCTGAATGGGGACGGCCTCTCTGACCTGCTGGTGGGGGCCCCCATGTTTTCTGAGATCAGGGATGAGGG
ACAGGTCACTGTCTACATCAACAGAGGAAATGGAGCCCTCGAGGAGCAGCTGGCTCTGACTGGGGATGGTGCCTACAATGCGCACTTTGG
AGAGAGCATTGCCAGCCTGGACGATCTGGACAATGATGGGTTCCCAGATGTGGCCATTGGTGCACCCAAGGAGGATGACTTCGCAGGGGC
GGTCTATATCTATCATGGTGATGCCGGTGGGATAGTCCCTCAGTACTCAATGAAACTGTCTGGGCAGAAGATAAATCCAGTGCTCCGGAT
GTTTGGTCAGTCCATATCGGGAGGCATTGATATGGATGGAAATGGCTATCCTGATGTCACTGTTGGAGCCTTCATGTCCGACAGCGTGGT
TCTTCTCAGAGCAAGGCCTGTCATTACGGTGGATGTCTCCATCTTCCTCCCGGGCTCCATCAACATCACAGCGCCTCAGTGTCACGACGG
ACAGCAGCCTGTGAACTGCCTGAACGTCACCACCTGCTTCAGCTTCCATGGCAAACACGTTCCAGGAGAGATTGGCCTGAATTATGTTCT
GATGGCTGACGTGGCCAAAAAGGAGAAGGGCCAGATGCCCAGGGTCTACTTTGTGCTGCTGGGAGAGACCATGGGTCAGGTCACAGAGAA
GCTGCAGCTGACTTACATGGAGGAGACGTGTCGTCACTATGTGGCCCATGTGAAGCGGAGGGTGCAGGACGTCATCAGCCCGATCGTGTT
TGAAGCAGCCTACAGCCTCAGTGAGCATGTGACTGGAGAGGAGGAGAGGGAACTGCCGCCTCTGACACCAGTTCTCCGCTGGAAAAAGGG
ACAAAAGATTGCCCAAAAGAATCAGACTGTTTTTGAAAGGAATTGCCGTTCAGAGGACTGTGCCGCAGACCTGCAGCTTCAGGGTAAACT
GCTGCTCTCCAGTATGGATGAGAAAACCCTGTATCTAGCTTTGGGGGCTGTGAAGAACATCTCCCTAAACATCTCTATCTCCAACCTCGG
AGATGATGCCTATGATGCCAACGTGTCCTTCAATGTTTCCCGGGAGCTCTTCTTCATCAACATGTGGCAGAAGGAGGAGATGGGCATCTC
CTGTGAGCTGCTGGAATCGGACTTCCTCAAATGCAGCGTGGGATTTCCTTTCATGAGGTCAAAGTCAAAGTATGAATTCAGCGTGATCTT
TGATACAAGCCACCTGTCTGGGGAAGAGGAAGTTCTCAGCTTCATTGTTACTGCTCAGAGTGGCAACACGGAGCGCTCTGAATCCCTGCA
TGACAACACCCTCGTGCTGATGGTGCCACTGATGCACGAGGTGGACACGTCCATCACCGGAATCATGTCTCCAACCTCCTTTGTATATGG
CGAGTCCGTGGACGCAGCCAACTTCATTCAGCTGGATGACCTGGAGTGTCACTTTCAGCCCATCAATATCACCCTTCAGGTCTACAACAC
TGGCCCAAGCACCCTTCCAGGGTCATCTGTCAGCATCTCTTTCCCTAATCGACTCTCATCTGGTGGTGCAGAGATGTTTCATGTCCAGGA
AATGGTGATTGGCTGCAATGCCGTCAGCTGGGCCCCTGCTGTTGTACCTGGAAGCCTCATAGACCACCCATCGGGGCAGAAACCCAATTA
CATCAAGAGGTTTGCATCAGGTGGCTGTGACAACCTCATCAAGCTGTGGAAGGAGGAGGAGGACGGCCAGTGGAAGGAGGAGCAGAAGCT
AGAAGCGCACAGTGACTGGGTTCGAGATGTGGCCTGGGCCCCCTCCATCGGCCTGCCCACCAGCACCATCGCCAGCTGCTCCCAGGATGG
TCGTGTGTTCATTTGGACCTGTGATGATGCCTCAAGCAATACGTGGTCCCCTAAATTGTTGCACAAGTTCAACGATGTGGTGTGGCATGT
GAGCTGGTCCATCACAGCCAACATCCTGGCTGTCTCTGGTGGAGACAATAAGGTGACCCTGTGGAAGGAGTCAGTTGATGGGCAGTGGGT
GTGCATCAGTGATGTCAACAAGGGCCAGGGCTCCGTATCAGCATCAGTGACAGAGGGCCAGCAGAACGAGCAGTGACAAGACAGGTGGGG
CCTGGCTCCCCACCCGCCAGCTCCAGGACTGCCCCTTCCTGGGCCAACTAACCAGACAACTGGGAAGAGCCCCCAACTCCAACAGGATTA
TTTTCCCAGGAGGAGTTACAGATGCAGCCACAGATTGATCATCTGCCTTAACGTGATCGGAGATGCTTTGTAATCTACTGTCCAGCTGAA
AGCACTCATGTTACGAGGAAGAAACTACAAGTGATGTTCAAATCTATTTTGGGTCATTTTTATGTACCTTTGGGTTCAGGCATTATTTGG

>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000397117_chr3_10347376_-_3400nt
CCGGCCCGGGACCCGCTCGCGCAGACTTCTCGGGCGGACTGAGGACGCCGCCGCTCGGGGCCGCCCCTGTGCTCGCCTTCAGCGCCCGCT
CAGCCCGCCGTCCGCGCCCCGGTGGCGGGCCCGACGCCCGCATTCCGCCCGTGTCCAGGCGCAGAGCTCCCGCCCCGGGGAGCTTCCTGG
CCGTCGGCGGGCCCCGCGGCCCGCGCGCTCGGCGCCCTGCTCGCCGGGCAGAGGGGAAGGCGGCGGCCGGCTGGGGATGGGCGGCCCGGC
TGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTACAACCTCGACCCGCA
GCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACGCGCTGGGTCCTTGT
GGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCACACCAACCCTGACCG
GAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGCGATGATGAGTGGAT
GGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTACTATGAAGCCGACCA
CATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTATGAAGAGTATAAGAA
GAAGTACGGAGAGGAACACGGCTCCTGCCAGGCTGGGATAGCGGGCTTCTTCACCGAGGAGCTGGTGGTGATGGGTGCTCCAGGGTCATT
TTATTGGGCTGGAACCATCAAAGTGCTGAACCTTACGGACAACACCTATTTAAAACTGAACGACGAAGTGATCATGAACAGGCGGTACAC
CTACCTGGGCTACGCAGTGACCGCTGGCCACTTCTCTCACCCGTCCACCATTGATGTGGTAGGAGGTGCCCCACAGGACAAAGGCATCGG
CAAGGTTTATATTTTCAGAGCTGACCGAAGATCAGGCACCTTAATTAAGATCTTTCAAGCATCAGGTAAAAAGATGGGCTCTTACTTCGG
CTCCTCCTTGTGCGCAGTTGACCTGAATGGGGACGGCCTCTCTGACCTGCTGGTGGGGGCCCCCATGTTTTCTGAGATCAGGGATGAGGG
ACAGGTCACTGTCTACATCAACAGAGGAAATGGAGCCCTCGAGGAGCAGCTGGCTCTGACTGGGGATGGTGCCTACAATGCGCACTTTGG
AGAGAGCATTGCCAGCCTGGACGATCTGGACAATGATGGGTTCCCAGATGTGGCCATTGGTGCACCCAAGGAGGATGACTTCGCAGGGGC
GGTCTATATCTATCATGGTGATGCCGGTGGGATAGTCCCTCAGTACTCAATGAAACTGTCTGGGCAGAAGATAAATCCAGTGCTCCGGAT
GTTTGGTCAGTCCATATCGGGAGGCATTGATATGGATGGAAATGGCTATCCTGATGTCACTGTTGGAGCCTTCATGTCCGACAGCGTGGT
TCTTCTCAGAGCAAGGCCTGTCATTACGGTGGATGTCTCCATCTTCCTCCCGGGCTCCATCAACATCACAGCGCCTCAGTGTCACGACGG
ACAGCAGCCTGTGAACTGCCTGAACGTCACCACCTGCTTCAGCTTCCATGGCAAACACGTTCCAGGAGAGATTGGCCTGAATTATGTTCT
GATGGCTGACGTGGCCAAAAAGGAGAAGGGCCAGATGCCCAGGGTCTACTTTGTGCTGCTGGGAGAGACCATGGGTCAGGTCACAGAGAA
GCTGCAGCTGACTTACATGGAGGAGACGTGTCGTCACTATGTGGCCCATGTGAAGCGGAGGGTGCAGGACGTCATCAGCCCGATCGTGTT
TGAAGCAGCCTACAGCCTCAGTGAGCATGTGACTGGAGAGGAGGAGAGGGAACTGCCGCCTCTGACACCAGTTCTCCGCTGGAAAAAGGG
ACAAAAGATTGCCCAAAAGAATCAGACTGTTTTTGAAAGGAATTGCCGTTCAGAGGACTGTGCCGCAGACCTGCAGCTTCAGGGTAAACT
GCTGCTCTCCAGTATGGATGAGAAAACCCTGTATCTAGCTTTGGGGGCTGTGAAGAACATCTCCCTAAACATCTCTATCTCCAACCTCGG
AGATGATGCCTATGATGCCAACGTGTCCTTCAATGTTTCCCGGGAGCTCTTCTTCATCAACATGTGGCAGAAGGAGGAGATGGGCATCTC
CTGTGAGCTGCTGGAATCGGACTTCCTCAAATGCAGCGTGGGATTTCCTTTCATGAGGTCAAAGTCAAAGTATGAATTCAGCGTGATCTT
TGATACAAGCCACCTGTCTGGGGAAGAGGAAGTTCTCAGCTTCATTGTTACTGCTCAGAGTGGCAACACGGAGCGCTCTGAATCCCTGCA
TGACAACACCCTCGTGCTGATGGTGCCACTGATGCACGAGGTGGACACGTCCATCACCGGAATCATGTCTCCAACCTCCTTTGTATATGG
CGAGTCCGTGGACGCAGCCAACTTCATTCAGCTGGATGACCTGGAGTGTCACTTTCAGCCCATCAATATCACCCTTCAGGTCTACAACAC
TGGCCCAAGCACCCTTCCAGGGTCATCTGTCAGCATCTCTTTCCCTAATCGACTCTCATCTGGTGGTGCAGAGATGTTTCATGTCCAGGA
AATGGTGATTGGCTGCAATGCCGTCAGCTGGGCCCCTGCTGTTGTACCTGGAAGCCTCATAGACCACCCATCGGGGCAGAAACCCAATTA
CATCAAGAGGTTTGCATCAGGTGGCTGTGACAACCTCATCAAGCTGTGGAAGGAGGAGGAGGACGGCCAGTGGAAGGAGGAGCAGAAGCT
AGAAGCGCACAGTGACTGGGTTCGAGATGTGGCCTGGGCCCCCTCCATCGGCCTGCCCACCAGCACCATCGCCAGCTGCTCCCAGGATGG
TCGTGTGTTCATTTGGACCTGTGATGATGCCTCAAGCAATACGTGGTCCCCTAAATTGTTGCACAAGTTCAACGATGTGGTGTGGCATGT
GAGCTGGTCCATCACAGCCAACATCCTGGCTGTCTCTGGTGGAGACAATAAGGAGGAGTTACAGATGCAGCCACAGATTGATCATCTGCC
TTAACGTGATCGGAGATGCTTTGTAATCTACTGTCCAGCTGAAAGCACTCATGTTACGAGGAAGAAACTACAAGTGATGTTCAAATCTAT

>In-frame_ITGA9_ENST00000264741_chr3_37792060_+_SEC13_ENST00000383801_chr3_10347376_-_3616nt
CCGGCCCGGGACCCGCTCGCGCAGACTTCTCGGGCGGACTGAGGACGCCGCCGCTCGGGGCCGCCCCTGTGCTCGCCTTCAGCGCCCGCT
CAGCCCGCCGTCCGCGCCCCGGTGGCGGGCCCGACGCCCGCATTCCGCCCGTGTCCAGGCGCAGAGCTCCCGCCCCGGGGAGCTTCCTGG
CCGTCGGCGGGCCCCGCGGCCCGCGCGCTCGGCGCCCTGCTCGCCGGGCAGAGGGGAAGGCGGCGGCCGGCTGGGGATGGGCGGCCCGGC
TGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTACAACCTCGACCCGCA
GCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACGCGCTGGGTCCTTGT
GGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCACACCAACCCTGACCG
GAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGCGATGATGAGTGGAT
GGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTACTATGAAGCCGACCA
CATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTATGAAGAGTATAAGAA
GAAGTACGGAGAGGAACACGGCTCCTGCCAGGCTGGGATAGCGGGCTTCTTCACCGAGGAGCTGGTGGTGATGGGTGCTCCAGGGTCATT
TTATTGGGCTGGAACCATCAAAGTGCTGAACCTTACGGACAACACCTATTTAAAACTGAACGACGAAGTGATCATGAACAGGCGGTACAC
CTACCTGGGCTACGCAGTGACCGCTGGCCACTTCTCTCACCCGTCCACCATTGATGTGGTAGGAGGTGCCCCACAGGACAAAGGCATCGG
CAAGGTTTATATTTTCAGAGCTGACCGAAGATCAGGCACCTTAATTAAGATCTTTCAAGCATCAGGTAAAAAGATGGGCTCTTACTTCGG
CTCCTCCTTGTGCGCAGTTGACCTGAATGGGGACGGCCTCTCTGACCTGCTGGTGGGGGCCCCCATGTTTTCTGAGATCAGGGATGAGGG
ACAGGTCACTGTCTACATCAACAGAGGAAATGGAGCCCTCGAGGAGCAGCTGGCTCTGACTGGGGATGGTGCCTACAATGCGCACTTTGG
AGAGAGCATTGCCAGCCTGGACGATCTGGACAATGATGGGTTCCCAGATGTGGCCATTGGTGCACCCAAGGAGGATGACTTCGCAGGGGC
GGTCTATATCTATCATGGTGATGCCGGTGGGATAGTCCCTCAGTACTCAATGAAACTGTCTGGGCAGAAGATAAATCCAGTGCTCCGGAT
GTTTGGTCAGTCCATATCGGGAGGCATTGATATGGATGGAAATGGCTATCCTGATGTCACTGTTGGAGCCTTCATGTCCGACAGCGTGGT
TCTTCTCAGAGCAAGGCCTGTCATTACGGTGGATGTCTCCATCTTCCTCCCGGGCTCCATCAACATCACAGCGCCTCAGTGTCACGACGG
ACAGCAGCCTGTGAACTGCCTGAACGTCACCACCTGCTTCAGCTTCCATGGCAAACACGTTCCAGGAGAGATTGGCCTGAATTATGTTCT
GATGGCTGACGTGGCCAAAAAGGAGAAGGGCCAGATGCCCAGGGTCTACTTTGTGCTGCTGGGAGAGACCATGGGTCAGGTCACAGAGAA
GCTGCAGCTGACTTACATGGAGGAGACGTGTCGTCACTATGTGGCCCATGTGAAGCGGAGGGTGCAGGACGTCATCAGCCCGATCGTGTT
TGAAGCAGCCTACAGCCTCAGTGAGCATGTGACTGGAGAGGAGGAGAGGGAACTGCCGCCTCTGACACCAGTTCTCCGCTGGAAAAAGGG
ACAAAAGATTGCCCAAAAGAATCAGACTGTTTTTGAAAGGAATTGCCGTTCAGAGGACTGTGCCGCAGACCTGCAGCTTCAGGGTAAACT
GCTGCTCTCCAGTATGGATGAGAAAACCCTGTATCTAGCTTTGGGGGCTGTGAAGAACATCTCCCTAAACATCTCTATCTCCAACCTCGG
AGATGATGCCTATGATGCCAACGTGTCCTTCAATGTTTCCCGGGAGCTCTTCTTCATCAACATGTGGCAGAAGGAGGAGATGGGCATCTC
CTGTGAGCTGCTGGAATCGGACTTCCTCAAATGCAGCGTGGGATTTCCTTTCATGAGGTCAAAGTCAAAGTATGAATTCAGCGTGATCTT
TGATACAAGCCACCTGTCTGGGGAAGAGGAAGTTCTCAGCTTCATTGTTACTGCTCAGAGTGGCAACACGGAGCGCTCTGAATCCCTGCA
TGACAACACCCTCGTGCTGATGGTGCCACTGATGCACGAGGTGGACACGTCCATCACCGGAATCATGTCTCCAACCTCCTTTGTATATGG
CGAGTCCGTGGACGCAGCCAACTTCATTCAGCTGGATGACCTGGAGTGTCACTTTCAGCCCATCAATATCACCCTTCAGGTCTACAACAC
TGGCCCAAGCACCCTTCCAGGGTCATCTGTCAGCATCTCTTTCCCTAATCGACTCTCATCTGGTGGTGCAGAGATGTTTCATGTCCAGGA
AATGGTGATTGGCTGCAATGCCGTCAGCTGGGCCCCTGCTGTTGTACCTGGAAGCCTCATAGACCACCCATCGGGGCAGAAACCCAATTA
CATCAAGAGGTTTGCATCAGGTGGCTGTGACAACCTCATCAAGCTGTGGAAGGAGGAGGAGGACGGCCAGTGGAAGGAGGAGCAGAAGCT
AGAAGCGCACAGTGACTGGGTTCGAGATGTGGCCTGGGCCCCCTCCATCGGCCTGCCCACCAGCACCATCGCCAGCTGCTCCCAGGATGG
TCGTGTGTTCATTTGGACCTGTGATGATGCCTCAAGCAATACGTGGTCCCCTAAATTGTTGCACAAGTTCAACGATGTGGTGTGGCATGT
GAGCTGGTCCATCACAGCCAACATCCTGGCTGTCTCTGGTGGAGACAATAAGGTGACCCTGTGGAAGGAGTCAGTTGATGGGCAGTGGGT
GTGCATCAGTGATGTCAACAAGGGCCAGGGCTCCGTATCAGCATCAGTGACAGAGGGCCAGCAGAACGAGCAGTGACAAGACAGGTGGGG
CCTGGCTCCCCACCCGCCAGCTCCAGGACTGCCCCTTCCTGGGCCAACTAACCAGACAACTGGGAAGAGCCCCCAACTCCAACAGGATTA
TTTTCCCAGGAGGAGTTACAGATGCAGCCACAGATTGATCATCTGCCTTAACGTGATCGGAGATGCTTTGTAATCTACTGTCCAGCTGAA
AGCACTCATGTTACGAGGAAGAAACTACAAGTGATGTTCAAATCTATTTTGGGTCATTTTTATGTACCTTTGGGTTCAGGCATTATTTGG


Top

FusionGenePPI for ITGA9_SEC13


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ITGA9ITGB1, ALDH1A3, LCN2, SERPINB4, SPRR1B, PCYOX1L, SMOC1, IGLL5, KLK10, IVL, HSPA5, CALML5, EVPL, IGKC, TUBA4ASEC13SEC16B, NUP37, NUP160, NUP133, NUP107, NUP85, SEC31A, RAB11A, SEC13, SIRT7, STAM2, CUL3, SEC23A, SLC12A2, RAD52, BAG3, CLDN12, MAPK9, EGFR, POLR2E, PRPF19, PSMB1, CSNK1A1, CSNK1E, FUS, TRAF5, RNF2, BCR, SPDL1, NUP98, SEH1L, MIOS, PRPF38A, WDR59, WDR24, STX7, ACY1, NUP43, MED4, TFG, QRICH1, SESN2, HSPB1, AHSA1, FLNB, NAPRT, SARS, SEC23B, SEPHS1, SEC24B, IFI16, EWSR1, B9D2, XPO1, CLTB, CLTC, FLNA, GAK, PICALM, AP1S2, SEC16A, GTSE1, MCM2, PPWD1, ZBTB5, CCDC94, FLYWCH2, WDR92, EDEM3, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ITGA9_SEC13


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ITGA9_SEC13


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneITGA9C0005586Bipolar Disorder1PSYGENET
HgeneITGA9C1839839MAJOR AFFECTIVE DISORDER 21PSYGENET