FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 17841

FusionGeneSummary for ITGA9_CTDSPL

check button Fusion gene summary
Fusion gene informationFusion gene name: ITGA9_CTDSPL
Fusion gene ID: 17841
HgeneTgene
Gene symbol

ITGA9

CTDSPL

Gene ID

3680

10217

Gene nameintegrin subunit alpha 9CTD small phosphatase like
SynonymsALPHA-RLC|ITGA4L|RLCC3orf8|HYA22|PSR1|RBSP3|SCP3
Cytomap

3p22.2

3p22.2

Type of geneprotein-codingprotein-coding
Descriptionintegrin alpha-9integrin alpha-RLCCTD small phosphatase-like proteinCTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-likeCTDSP-likeNIF-like proteinNLI-interacting factor 1RB protein serine phosphatase from chromosome 3carboxy-terminal domain RNA poly
Modification date2018051920180523
UniProtAcc

Q13797

O15194

Ensembl transtripts involved in fusion geneENST00000264741, ENST00000422441, 
ENST00000443503, ENST00000273179, 
ENST00000310189, 
Fusion gene scores* DoF score6 X 6 X 7=2527 X 6 X 4=168
# samples 78
** MAII scorelog2(7/252*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/168*10)=-1.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ITGA9 [Title/Abstract] AND CTDSPL [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-AC-A2BK-01AITGA9chr3

37523098

+CTDSPLchr3

37988548

+
TCGALDLUSCTCGA-NC-A5HI-01AITGA9chr3

37670827

+CTDSPLchr3

37988548

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000264741ENST00000443503ITGA9chr3

37523098

+CTDSPLchr3

37988548

+
In-frameENST00000264741ENST00000273179ITGA9chr3

37523098

+CTDSPLchr3

37988548

+
5CDS-intronENST00000264741ENST00000310189ITGA9chr3

37523098

+CTDSPLchr3

37988548

+
In-frameENST00000422441ENST00000443503ITGA9chr3

37523098

+CTDSPLchr3

37988548

+
In-frameENST00000422441ENST00000273179ITGA9chr3

37523098

+CTDSPLchr3

37988548

+
5CDS-intronENST00000422441ENST00000310189ITGA9chr3

37523098

+CTDSPLchr3

37988548

+
Frame-shitENST00000264741ENST00000443503ITGA9chr3

37670827

+CTDSPLchr3

37988548

+
Frame-shitENST00000264741ENST00000273179ITGA9chr3

37670827

+CTDSPLchr3

37988548

+
5CDS-intronENST00000264741ENST00000310189ITGA9chr3

37670827

+CTDSPLchr3

37988548

+
Frame-shitENST00000422441ENST00000443503ITGA9chr3

37670827

+CTDSPLchr3

37988548

+
Frame-shitENST00000422441ENST00000273179ITGA9chr3

37670827

+CTDSPLchr3

37988548

+
5CDS-intronENST00000422441ENST00000310189ITGA9chr3

37670827

+CTDSPLchr3

37988548

+

Top

FusionProtFeatures for ITGA9_CTDSPL


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ITGA9

Q13797

CTDSPL

O15194

Integrin alpha-9/beta-1 (ITGA9:ITGB1) is a receptor forVCAM1, cytotactin and osteopontin. It recognizes the sequence A-E-I-D-G-I-E-L in cytotactin. {ECO:0000250}. Recruited by REST to neuronal genes that contain RE-1elements, leading to neuronal gene silencing in non-neuronal cells(By similarity). Preferentially catalyzes the dephosphorylation of'Ser-5' within the tandem 7 residue repeats in the C-terminaldomain (CTD) of the largest RNA polymerase II subunit POLR2A.Negatively regulates RNA polymerase II transcription, possibly bycontrolling the transition from initiation/capping to processivetranscript elongation. {ECO:0000250, ECO:0000269|PubMed:12721286}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneITGA9chr3:37523098chr3:37988548ENST00000264741+428111_1741811036RepeatFG-GAP 2
HgeneITGA9chr3:37523098chr3:37988548ENST00000264741+42835_961811036RepeatFG-GAP 1
TgeneCTDSPLchr3:37523098chr3:37988548ENST00000273179+08102_26026277DomainFCP1 homology
TgeneCTDSPLchr3:37523098chr3:37988548ENST00000443503+07102_26026266DomainFCP1 homology

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneITGA9chr3:37523098chr3:37988548ENST00000264741+428312_3201811036Calcium bindingOntology_term=ECO:0000255
HgeneITGA9chr3:37523098chr3:37988548ENST00000264741+428373_3811811036Calcium bindingOntology_term=ECO:0000255
HgeneITGA9chr3:37523098chr3:37988548ENST00000264741+428435_4431811036Calcium bindingOntology_term=ECO:0000255
HgeneITGA9chr3:37523098chr3:37988548ENST00000264741+4281005_10091811036MotifNote=GFFKR motif
HgeneITGA9chr3:37523098chr3:37988548ENST00000264741+428182_2321811036RepeatFG-GAP 3
HgeneITGA9chr3:37523098chr3:37988548ENST00000264741+428233_2891811036RepeatFG-GAP 4
HgeneITGA9chr3:37523098chr3:37988548ENST00000264741+428290_3491811036RepeatFG-GAP 5
HgeneITGA9chr3:37523098chr3:37988548ENST00000264741+428351_4081811036RepeatFG-GAP 6
HgeneITGA9chr3:37523098chr3:37988548ENST00000264741+428411_4741811036RepeatFG-GAP 7
HgeneITGA9chr3:37523098chr3:37988548ENST00000264741+4281003_10351811036Topological domainCytoplasmic
HgeneITGA9chr3:37523098chr3:37988548ENST00000264741+42830_9811811036Topological domainExtracellular
HgeneITGA9chr3:37523098chr3:37988548ENST00000264741+428982_10021811036TransmembraneHelical


Top

FusionGeneSequence for ITGA9_CTDSPL


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ITGA9_ENST00000264741_chr3_37523098_+_CTDSPL_ENST00000443503_chr3_37988548_+_421aa
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKADSKYSPSVKSPGAVFKCRVH
TNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIYTEADHILPHGFCYIIPSNLQAKGRTLIPCT
EASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDTGKKCVVIDLDETLVHSSFKPIS
NADFIVPVEIDGTIHQVTVLKRPHVDEFLQRMGQLFECVLFTASLAKTADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELS

>In-frame_ITGA9_ENST00000264741_chr3_37523098_+_CTDSPL_ENST00000273179_chr3_37988548_+_432aa
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKADSKYSPSVKSPGAVFKCRVH
TNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIYTEADHILPHGFCYIIPSNLQAKGRTLIPCT
EASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQRQVIPIPSPPAKYLLPEVTVLDTGKKCVVIDLDE
TLVHSSFKPISNADFIVPVEIDGTIHQVTVLKRPHVDEFLQRMGQLFECVLFTASLAKTADPVADLLDRWGVFRARLFRESCVFHRGNYV

>In-frame_ITGA9_ENST00000422441_chr3_37523098_+_CTDSPL_ENST00000443503_chr3_37988548_+_421aa
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKADSKYSPSVKSPGAVFKCRVH
TNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIYTEADHILPHGFCYIIPSNLQAKGRTLIPCT
EASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDTGKKCVVIDLDETLVHSSFKPIS
NADFIVPVEIDGTIHQVTVLKRPHVDEFLQRMGQLFECVLFTASLAKTADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELS

>In-frame_ITGA9_ENST00000422441_chr3_37523098_+_CTDSPL_ENST00000273179_chr3_37988548_+_432aa
MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNTRWVLVGAPKADSKYSPSVKSPGAVFKCRVH
TNPDRRCTELDMARGKNRGTSCGKTCREDRDDEWMGVSLARQPKADGRVLACAHRWKNIYTEADHILPHGFCYIIPSNLQAKGRTLIPCT
EASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQRQVIPIPSPPAKYLLPEVTVLDTGKKCVVIDLDE
TLVHSSFKPISNADFIVPVEIDGTIHQVTVLKRPHVDEFLQRMGQLFECVLFTASLAKTADPVADLLDRWGVFRARLFRESCVFHRGNYV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ITGA9_ENST00000264741_chr3_37523098_+_CTDSPL_ENST00000443503_chr3_37988548_+_1263nt
ATGGGCGGCCCGGCTGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTAC
AACCTCGACCCGCAGCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACG
CGCTGGGTCCTTGTGGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCAC
ACCAACCCTGACCGGAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGC
GATGATGAGTGGATGGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTAC
TATGAAGCCGACCACATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTAT
GAAGCCTCCCAGTGCAACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTG
GAGGCCCCTCCACCCAGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGCCACCAGCTAAGTACCTTCTT
CCAGAGGTGACGGTGCTTGACTATGGAAAGAAATGTGTGGTCATTGATTTAGATGAAACATTGGTGCACAGTTCGTTTAAGCCTATTAGT
AATGCTGATTTTATTGTTCCGGTTGAAATCGATGGAACTATACATCAGGTGTATGTGCTGAAGCGGCCACATGTGGACGAGTTCCTCCAG
AGGATGGGGCAGCTTTTTGAATGTGTGCTCTTTACTGCCAGCTTGGCCAAGTATGCAGACCCTGTGGCTGACCTCCTAGACCGCTGGGGT
GTGTTCCGGGCCCGGCTCTTCAGAGAATCATGTGTTTTTCATCGTGGGAACTACGTGAAGGACCTGAGTCGCCTTGGGCGGGAGCTGAGC
AAAGTGATCATTGTTGACAATTCCCCTGCCTCATACATCTTCCATCCTGAGAATGCAGTGCCTGTGCAGTCCTGGTTCGATGACATGACG
GACACGGAGCTGCTGGACCTCATCCCCTTCTTTGAGGGCCTGAGCCGGGAGGACGACGTGTACAGCATGCTGCACAGACTCTGCAATAGG

>In-frame_ITGA9_ENST00000264741_chr3_37523098_+_CTDSPL_ENST00000273179_chr3_37988548_+_1296nt
ATGGGCGGCCCGGCTGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTAC
AACCTCGACCCGCAGCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACG
CGCTGGGTCCTTGTGGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCAC
ACCAACCCTGACCGGAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGC
GATGATGAGTGGATGGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTAC
TATGAAGCCGACCACATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTAT
GAAGCCTCCCAGTGCAACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTG
GAGGCCCCTCCACCCAGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGGGTGACCAGAGGCAGGTCATT
CCCATACCAAGTCCACCAGCTAAGTACCTTCTTCCAGAGGTGACGGTGCTTGACTATGGAAAGAAATGTGTGGTCATTGATTTAGATGAA
ACATTGGTGCACAGTTCGTTTAAGCCTATTAGTAATGCTGATTTTATTGTTCCGGTTGAAATCGATGGAACTATACATCAGGTGTATGTG
CTGAAGCGGCCACATGTGGACGAGTTCCTCCAGAGGATGGGGCAGCTTTTTGAATGTGTGCTCTTTACTGCCAGCTTGGCCAAGTATGCA
GACCCTGTGGCTGACCTCCTAGACCGCTGGGGTGTGTTCCGGGCCCGGCTCTTCAGAGAATCATGTGTTTTTCATCGTGGGAACTACGTG
AAGGACCTGAGTCGCCTTGGGCGGGAGCTGAGCAAAGTGATCATTGTTGACAATTCCCCTGCCTCATACATCTTCCATCCTGAGAATGCA
GTGCCTGTGCAGTCCTGGTTCGATGACATGACGGACACGGAGCTGCTGGACCTCATCCCCTTCTTTGAGGGCCTGAGCCGGGAGGACGAC

>In-frame_ITGA9_ENST00000422441_chr3_37523098_+_CTDSPL_ENST00000443503_chr3_37988548_+_1263nt
ATGGGCGGCCCGGCTGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTAC
AACCTCGACCCGCAGCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACG
CGCTGGGTCCTTGTGGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCAC
ACCAACCCTGACCGGAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGC
GATGATGAGTGGATGGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTAC
TATGAAGCCGACCACATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTAT
GAAGCCTCCCAGTGCAACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTG
GAGGCCCCTCCACCCAGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGCCACCAGCTAAGTACCTTCTT
CCAGAGGTGACGGTGCTTGACTATGGAAAGAAATGTGTGGTCATTGATTTAGATGAAACATTGGTGCACAGTTCGTTTAAGCCTATTAGT
AATGCTGATTTTATTGTTCCGGTTGAAATCGATGGAACTATACATCAGGTGTATGTGCTGAAGCGGCCACATGTGGACGAGTTCCTCCAG
AGGATGGGGCAGCTTTTTGAATGTGTGCTCTTTACTGCCAGCTTGGCCAAGTATGCAGACCCTGTGGCTGACCTCCTAGACCGCTGGGGT
GTGTTCCGGGCCCGGCTCTTCAGAGAATCATGTGTTTTTCATCGTGGGAACTACGTGAAGGACCTGAGTCGCCTTGGGCGGGAGCTGAGC
AAAGTGATCATTGTTGACAATTCCCCTGCCTCATACATCTTCCATCCTGAGAATGCAGTGCCTGTGCAGTCCTGGTTCGATGACATGACG
GACACGGAGCTGCTGGACCTCATCCCCTTCTTTGAGGGCCTGAGCCGGGAGGACGACGTGTACAGCATGCTGCACAGACTCTGCAATAGG

>In-frame_ITGA9_ENST00000422441_chr3_37523098_+_CTDSPL_ENST00000273179_chr3_37988548_+_1296nt
ATGGGCGGCCCGGCTGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTAC
AACCTCGACCCGCAGCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACG
CGCTGGGTCCTTGTGGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCAC
ACCAACCCTGACCGGAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGC
GATGATGAGTGGATGGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTAC
TATGAAGCCGACCACATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTAT
GAAGCCTCCCAGTGCAACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTG
GAGGCCCCTCCACCCAGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGGGTGACCAGAGGCAGGTCATT
CCCATACCAAGTCCACCAGCTAAGTACCTTCTTCCAGAGGTGACGGTGCTTGACTATGGAAAGAAATGTGTGGTCATTGATTTAGATGAA
ACATTGGTGCACAGTTCGTTTAAGCCTATTAGTAATGCTGATTTTATTGTTCCGGTTGAAATCGATGGAACTATACATCAGGTGTATGTG
CTGAAGCGGCCACATGTGGACGAGTTCCTCCAGAGGATGGGGCAGCTTTTTGAATGTGTGCTCTTTACTGCCAGCTTGGCCAAGTATGCA
GACCCTGTGGCTGACCTCCTAGACCGCTGGGGTGTGTTCCGGGCCCGGCTCTTCAGAGAATCATGTGTTTTTCATCGTGGGAACTACGTG
AAGGACCTGAGTCGCCTTGGGCGGGAGCTGAGCAAAGTGATCATTGTTGACAATTCCCCTGCCTCATACATCTTCCATCCTGAGAATGCA
GTGCCTGTGCAGTCCTGGTTCGATGACATGACGGACACGGAGCTGCTGGACCTCATCCCCTTCTTTGAGGGCCTGAGCCGGGAGGACGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ITGA9_ENST00000264741_chr3_37523098_+_CTDSPL_ENST00000443503_chr3_37988548_+_5121nt
CCGGCCCGGGACCCGCTCGCGCAGACTTCTCGGGCGGACTGAGGACGCCGCCGCTCGGGGCCGCCCCTGTGCTCGCCTTCAGCGCCCGCT
CAGCCCGCCGTCCGCGCCCCGGTGGCGGGCCCGACGCCCGCATTCCGCCCGTGTCCAGGCGCAGAGCTCCCGCCCCGGGGAGCTTCCTGG
CCGTCGGCGGGCCCCGCGGCCCGCGCGCTCGGCGCCCTGCTCGCCGGGCAGAGGGGAAGGCGGCGGCCGGCTGGGGATGGGCGGCCCGGC
TGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTACAACCTCGACCCGCA
GCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACGCGCTGGGTCCTTGT
GGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCACACCAACCCTGACCG
GAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGCGATGATGAGTGGAT
GGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTACTATGAAGCCGACCA
CATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTATGAAGCCTCCCAGTG
CAACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTCCACC
CAGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGCCACCAGCTAAGTACCTTCTTCCAGAGGTGACGGT
GCTTGACTATGGAAAGAAATGTGTGGTCATTGATTTAGATGAAACATTGGTGCACAGTTCGTTTAAGCCTATTAGTAATGCTGATTTTAT
TGTTCCGGTTGAAATCGATGGAACTATACATCAGGTGTATGTGCTGAAGCGGCCACATGTGGACGAGTTCCTCCAGAGGATGGGGCAGCT
TTTTGAATGTGTGCTCTTTACTGCCAGCTTGGCCAAGTATGCAGACCCTGTGGCTGACCTCCTAGACCGCTGGGGTGTGTTCCGGGCCCG
GCTCTTCAGAGAATCATGTGTTTTTCATCGTGGGAACTACGTGAAGGACCTGAGTCGCCTTGGGCGGGAGCTGAGCAAAGTGATCATTGT
TGACAATTCCCCTGCCTCATACATCTTCCATCCTGAGAATGCAGTGCCTGTGCAGTCCTGGTTCGATGACATGACGGACACGGAGCTGCT
GGACCTCATCCCCTTCTTTGAGGGCCTGAGCCGGGAGGACGACGTGTACAGCATGCTGCACAGACTCTGCAATAGGTAGCCCTGGCCTCT
GCCTGCCTCCCGCCTGTGCACTCTGGAACCTCTGGCCTCAGGGGACCTGCCTGTCCTCAGCTCCCTGGGAGCTGAAAGTGAGGATACTCC
GTGCTCCAGGCCACAGGGTGAATGTGGCCATGCCTACCTGTTTTGTTTTTTTAAGAACAGAAACAACTATTTTAAAAGAACTCTTTTAAG
AAATTTCATAAAGGGACATGCATTTTACTGGGTTTGCTTTTCTTAAAACATACCAAAAAAGAAAAAAATAGAAAAAAAAAAAAAAAAAGC
TTGATCTCTATCAGACTTCCTTTCAACTGTCCTCCCCTCCAAGCAGACCACCTGTCCCCTTCTATCCCAGCTCAGAGCAGCTGACCCAAC
TCAGAATCTCTTTCCTACAGGATGAAGTGCCTTTTGAATGTTATTTTAAGCCGAGAGTTAATTTTTCTACACAACATATTTCCAGACATC
TTTTAGTCTTTTATTGTCTTAGATACTATAAGAAGATGAACATGACAATTTTCTAGAACCTGGTAGCGTGTGTGTGTGTGGCGGGGGGTG
CTGAGGGAGGGGAGTGAGTCACAGGAGCCTGTCCCCCAACAGGTGTGACTGCTCTGACAACCTGTGGCATGCTGCAGGGTCAGGCTCCTG
ATAGGAGGATTTCATGACTATGTCATTGTCTCCACTCATTTTTGACCCAGTTTGGAATGTATCTGCAATTGTGTGGCTCAACACTTTAGG
AAACAATAGATTATTTTATATTATTATTTCTGATGGTGACAAGTTTGTCTTGAGGTCACATTTTCTCCTTGAAAAGTGACATCCTGTCAC
TTCTGCTCTCACACTACTGCCATACATTTGTGTTTTTTGTTGTTATTGTTTGGGTAGAGCAGTTACAAGAAACCCTAAAACCCTTGGATA
TAAAAGAAATCTGTTTATTGATTTTTAAATCTTTCCTTTCCAAAAGCTGGATACACATGGAGCTGTTTGGGAATTTTCCTTGCTGCTACC
GCGCTGCCACCAAATGGAATTGACCAGCGGCTGTTACACTGTTCTTTGCCACTGTGCCTATGCTCAGAATATGCTCACTGCTAAGCTACA
AACTCGGACAGGGTCAGAAACAGAGGTGTCCCATCCCATTGCAGCCTCCACCACCTGTAACCCCTTCCTGGCATTGGCCACTGAAGGGTA
CAAAGGCAAAAGGACCACAGCACCACTTAGGTGTAGCATGGATTTTAAACTGCAGTCAGTATCAGATCCTGTTTGATAAATAAGCTGACT
GTTCTCTCTTGAGAACCTGTGGCCTCAACCAGCCACCAAGCTGATGTGGCCCAAGTCCATCTCTTGGTCTTCTCCTTTGAAGCACAGCCT
ATTTCTGAGCCAAGGGTTGGGGAAGCCTGTCTAGATGTGGGACTCATTGCCCCAAACCAGGGAGAGGAAGAGCTCCCACAGGGAGAGCCC
AGGCTCTCTTTGCAGCCTTTCCCAGTTTGGTGTTTAAGCAGTGCCATGTTCCTTGTTTGACAACAAGACAGTCTGTAAAGTATTGCTCTT
AAAAACAATTAAAAAGAACCCTTTCATATTGGCACCATTGCCTTAGTCCTCTGTGGGTTGGTCTTCAGCCAGCATTCTGGTGGGAGTGAC
TGGCATTAACAAGACTGGAAATCGGGGGTCAAAGTAAAATATCTTTGTTTTGCTTTCATTCACAAAGTAATGAAGCCAGCTGCCAATTAC
ATCCTCCCAACAGCACTTTGGTCTGTGGACTGCTGTGTGAATATTCAGAAGGGAAGTAAGTATTCAGGGGGTAAACAGGTCTCCCAGCAT
TCTGAGTGTTCCAAACCAGTAATCCACATGCCAATTCAAATAGAACAGCCCCTTGCTAGATATTACCACAGATAATGACAGTTACATGGT
AGAACTGCCCATGCCACAAATATTTATTTGGAAAAGTAGTCATTAAATGAACCCACTGCCTTAAATGTCTTGAATGTTGCAGTCAAGTGT
CTGTCATGTGTTGATATCCACACAGAATTAGGCCCTAATGAGAGCCTTAGACCCTCAACCATGCCCCCTTCGTTGGCATCACAGGGCCTT
ATTTGGAAGAGCGGGCAAAGAGGATGGAAATCATAAAATATTTCATGGGAATCGAACCTAGGGATAGTGCTCCACTTCTGACGATGGAGT
GAAGACACTTGGCAGACTTGAGCCAGACACTTCACCTAGTAGTTCCTGAAACTGTGAGCACCACTGCACTAAGCCAGTGCGGAGCTGTTA
GGGACGGGCCCAGCTCCTGCACCACGGACACAGAATGTCTGGAGAGGGCCAGCAGGCCCTCTGAGGGTTCTGGAATCTGTGCACCTTATT
TGACCACACTCCAAAATTCTGTTTTTATTTTAACCCTTGAATCTGCTTTATGTACATAATCAAAATATCTATATCTATATCTATATCTAT
ATCTATATATTTTTAATCATCTACATGTAAATGAAGCAATAGAATTCTAACATAAGGCCAAGAAATGAGACGAATGTTTGGGGTTTATGT
TTTTTAAGGTAAATACGGGTATTGTTTTTAATTATTACCATGTATTAAATTGTGGGCTTTGAAACCTAATGAAACCTGTTAGCCACTTCT
CTGTGCCATATACTTCCCATGTTACCAAAATACCCCCAACTCTTTAGCCAAAAGAGAACCCTGACCTCCTGAGTTTCCATGCTCCTTTCT
GTACCAGGTTTAAATGTAGTCTTCTGGAGAAGTATTTTTGACATTGAGCTCTGGGACAGGACACCTTGGGTTTGTGGACTGCAGCCCACT
ATGATGTTATTACTTCTCTGGCCAGGCCTCCAGTGGAAGTGCACAGGCACTCCCAATGTTGTTAATGCTCTGTCTTCCATTTGTTCTGGA
ATCCTACGTGTTGGTCTGTGGTTCCATGCATTAGCTGTTTGTAAATAATGCATTTGCATACTGAAAAAGGAATGCCACCTGCCACAGTTG
ATGGTGAGGAAGCTCCTTTGACGTGGTGCAATTTTGATGAGATGTCTCTGGGGACACGAGGATGCCCTAATGATGCTGACTTGTCATGGT
TGCAGCATTTGAACTTTTGGTGTTAAAAAAAAAAACCTGTAAGTCTGTAACCTGGCAACATTTTACAACCCTGTATTTTTAAAGATGGCT
TTCTAATAAAAAATCCAGAACCACACAGCCCTATGGTCAAACAATCCTACGTTTGTGCCTCTGCTTTTAAAGGTGCTGTGCTGGACAGTT
GGCATGCCAGGGTTCGAGAAGAGTGAATGGCTTGACGTACTTGCAGTTAACTGTGCAAAATTGGCTGGCTGCCTCTGTTCCTACTGTACT
GTAACTTTGATCATGTCTGTTCCTGTTCCATTCTCCCAGGAGCTTCTCTGCAGACTGACACACCCTCCCCCACCCCGGGTAGTGGAGATG
CTGGTGTCTGGGTAGTCATGGATTTCTGCTGGACATTTGAATGTGATAAACAATCCAGCATTACTTAGGAAATGCTACATGCGGAATGTG

>In-frame_ITGA9_ENST00000264741_chr3_37523098_+_CTDSPL_ENST00000273179_chr3_37988548_+_5154nt
CCGGCCCGGGACCCGCTCGCGCAGACTTCTCGGGCGGACTGAGGACGCCGCCGCTCGGGGCCGCCCCTGTGCTCGCCTTCAGCGCCCGCT
CAGCCCGCCGTCCGCGCCCCGGTGGCGGGCCCGACGCCCGCATTCCGCCCGTGTCCAGGCGCAGAGCTCCCGCCCCGGGGAGCTTCCTGG
CCGTCGGCGGGCCCCGCGGCCCGCGCGCTCGGCGCCCTGCTCGCCGGGCAGAGGGGAAGGCGGCGGCCGGCTGGGGATGGGCGGCCCGGC
TGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTACAACCTCGACCCGCA
GCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACGCGCTGGGTCCTTGT
GGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCACACCAACCCTGACCG
GAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGCGATGATGAGTGGAT
GGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTACTATGAAGCCGACCA
CATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTATGAAGCCTCCCAGTG
CAACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTCCACC
CAGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGGGTGACCAGAGGCAGGTCATTCCCATACCAAGTCC
ACCAGCTAAGTACCTTCTTCCAGAGGTGACGGTGCTTGACTATGGAAAGAAATGTGTGGTCATTGATTTAGATGAAACATTGGTGCACAG
TTCGTTTAAGCCTATTAGTAATGCTGATTTTATTGTTCCGGTTGAAATCGATGGAACTATACATCAGGTGTATGTGCTGAAGCGGCCACA
TGTGGACGAGTTCCTCCAGAGGATGGGGCAGCTTTTTGAATGTGTGCTCTTTACTGCCAGCTTGGCCAAGTATGCAGACCCTGTGGCTGA
CCTCCTAGACCGCTGGGGTGTGTTCCGGGCCCGGCTCTTCAGAGAATCATGTGTTTTTCATCGTGGGAACTACGTGAAGGACCTGAGTCG
CCTTGGGCGGGAGCTGAGCAAAGTGATCATTGTTGACAATTCCCCTGCCTCATACATCTTCCATCCTGAGAATGCAGTGCCTGTGCAGTC
CTGGTTCGATGACATGACGGACACGGAGCTGCTGGACCTCATCCCCTTCTTTGAGGGCCTGAGCCGGGAGGACGACGTGTACAGCATGCT
GCACAGACTCTGCAATAGGTAGCCCTGGCCTCTGCCTGCCTCCCGCCTGTGCACTCTGGAACCTCTGGCCTCAGGGGACCTGCCTGTCCT
CAGCTCCCTGGGAGCTGAAAGTGAGGATACTCCGTGCTCCAGGCCACAGGGTGAATGTGGCCATGCCTACCTGTTTTGTTTTTTTAAGAA
CAGAAACAACTATTTTAAAAGAACTCTTTTAAGAAATTTCATAAAGGGACATGCATTTTACTGGGTTTGCTTTTCTTAAAACATACCAAA
AAAGAAAAAAATAGAAAAAAAAAAAAAAAAAGCTTGATCTCTATCAGACTTCCTTTCAACTGTCCTCCCCTCCAAGCAGACCACCTGTCC
CCTTCTATCCCAGCTCAGAGCAGCTGACCCAACTCAGAATCTCTTTCCTACAGGATGAAGTGCCTTTTGAATGTTATTTTAAGCCGAGAG
TTAATTTTTCTACACAACATATTTCCAGACATCTTTTAGTCTTTTATTGTCTTAGATACTATAAGAAGATGAACATGACAATTTTCTAGA
ACCTGGTAGCGTGTGTGTGTGTGGCGGGGGGTGCTGAGGGAGGGGAGTGAGTCACAGGAGCCTGTCCCCCAACAGGTGTGACTGCTCTGA
CAACCTGTGGCATGCTGCAGGGTCAGGCTCCTGATAGGAGGATTTCATGACTATGTCATTGTCTCCACTCATTTTTGACCCAGTTTGGAA
TGTATCTGCAATTGTGTGGCTCAACACTTTAGGAAACAATAGATTATTTTATATTATTATTTCTGATGGTGACAAGTTTGTCTTGAGGTC
ACATTTTCTCCTTGAAAAGTGACATCCTGTCACTTCTGCTCTCACACTACTGCCATACATTTGTGTTTTTTGTTGTTATTGTTTGGGTAG
AGCAGTTACAAGAAACCCTAAAACCCTTGGATATAAAAGAAATCTGTTTATTGATTTTTAAATCTTTCCTTTCCAAAAGCTGGATACACA
TGGAGCTGTTTGGGAATTTTCCTTGCTGCTACCGCGCTGCCACCAAATGGAATTGACCAGCGGCTGTTACACTGTTCTTTGCCACTGTGC
CTATGCTCAGAATATGCTCACTGCTAAGCTACAAACTCGGACAGGGTCAGAAACAGAGGTGTCCCATCCCATTGCAGCCTCCACCACCTG
TAACCCCTTCCTGGCATTGGCCACTGAAGGGTACAAAGGCAAAAGGACCACAGCACCACTTAGGTGTAGCATGGATTTTAAACTGCAGTC
AGTATCAGATCCTGTTTGATAAATAAGCTGACTGTTCTCTCTTGAGAACCTGTGGCCTCAACCAGCCACCAAGCTGATGTGGCCCAAGTC
CATCTCTTGGTCTTCTCCTTTGAAGCACAGCCTATTTCTGAGCCAAGGGTTGGGGAAGCCTGTCTAGATGTGGGACTCATTGCCCCAAAC
CAGGGAGAGGAAGAGCTCCCACAGGGAGAGCCCAGGCTCTCTTTGCAGCCTTTCCCAGTTTGGTGTTTAAGCAGTGCCATGTTCCTTGTT
TGACAACAAGACAGTCTGTAAAGTATTGCTCTTAAAAACAATTAAAAAGAACCCTTTCATATTGGCACCATTGCCTTAGTCCTCTGTGGG
TTGGTCTTCAGCCAGCATTCTGGTGGGAGTGACTGGCATTAACAAGACTGGAAATCGGGGGTCAAAGTAAAATATCTTTGTTTTGCTTTC
ATTCACAAAGTAATGAAGCCAGCTGCCAATTACATCCTCCCAACAGCACTTTGGTCTGTGGACTGCTGTGTGAATATTCAGAAGGGAAGT
AAGTATTCAGGGGGTAAACAGGTCTCCCAGCATTCTGAGTGTTCCAAACCAGTAATCCACATGCCAATTCAAATAGAACAGCCCCTTGCT
AGATATTACCACAGATAATGACAGTTACATGGTAGAACTGCCCATGCCACAAATATTTATTTGGAAAAGTAGTCATTAAATGAACCCACT
GCCTTAAATGTCTTGAATGTTGCAGTCAAGTGTCTGTCATGTGTTGATATCCACACAGAATTAGGCCCTAATGAGAGCCTTAGACCCTCA
ACCATGCCCCCTTCGTTGGCATCACAGGGCCTTATTTGGAAGAGCGGGCAAAGAGGATGGAAATCATAAAATATTTCATGGGAATCGAAC
CTAGGGATAGTGCTCCACTTCTGACGATGGAGTGAAGACACTTGGCAGACTTGAGCCAGACACTTCACCTAGTAGTTCCTGAAACTGTGA
GCACCACTGCACTAAGCCAGTGCGGAGCTGTTAGGGACGGGCCCAGCTCCTGCACCACGGACACAGAATGTCTGGAGAGGGCCAGCAGGC
CCTCTGAGGGTTCTGGAATCTGTGCACCTTATTTGACCACACTCCAAAATTCTGTTTTTATTTTAACCCTTGAATCTGCTTTATGTACAT
AATCAAAATATCTATATCTATATCTATATCTATATCTATATATTTTTAATCATCTACATGTAAATGAAGCAATAGAATTCTAACATAAGG
CCAAGAAATGAGACGAATGTTTGGGGTTTATGTTTTTTAAGGTAAATACGGGTATTGTTTTTAATTATTACCATGTATTAAATTGTGGGC
TTTGAAACCTAATGAAACCTGTTAGCCACTTCTCTGTGCCATATACTTCCCATGTTACCAAAATACCCCCAACTCTTTAGCCAAAAGAGA
ACCCTGACCTCCTGAGTTTCCATGCTCCTTTCTGTACCAGGTTTAAATGTAGTCTTCTGGAGAAGTATTTTTGACATTGAGCTCTGGGAC
AGGACACCTTGGGTTTGTGGACTGCAGCCCACTATGATGTTATTACTTCTCTGGCCAGGCCTCCAGTGGAAGTGCACAGGCACTCCCAAT
GTTGTTAATGCTCTGTCTTCCATTTGTTCTGGAATCCTACGTGTTGGTCTGTGGTTCCATGCATTAGCTGTTTGTAAATAATGCATTTGC
ATACTGAAAAAGGAATGCCACCTGCCACAGTTGATGGTGAGGAAGCTCCTTTGACGTGGTGCAATTTTGATGAGATGTCTCTGGGGACAC
GAGGATGCCCTAATGATGCTGACTTGTCATGGTTGCAGCATTTGAACTTTTGGTGTTAAAAAAAAAAACCTGTAAGTCTGTAACCTGGCA
ACATTTTACAACCCTGTATTTTTAAAGATGGCTTTCTAATAAAAAATCCAGAACCACACAGCCCTATGGTCAAACAATCCTACGTTTGTG
CCTCTGCTTTTAAAGGTGCTGTGCTGGACAGTTGGCATGCCAGGGTTCGAGAAGAGTGAATGGCTTGACGTACTTGCAGTTAACTGTGCA
AAATTGGCTGGCTGCCTCTGTTCCTACTGTACTGTAACTTTGATCATGTCTGTTCCTGTTCCATTCTCCCAGGAGCTTCTCTGCAGACTG
ACACACCCTCCCCCACCCCGGGTAGTGGAGATGCTGGTGTCTGGGTAGTCATGGATTTCTGCTGGACATTTGAATGTGATAAACAATCCA
GCATTACTTAGGAAATGCTACATGCGGAATGTGCACGTTTCCAGGGGCGAGTATTGTCAATCAAAAGGTTTGCAATGATTTCCTTCCTGC

>In-frame_ITGA9_ENST00000422441_chr3_37523098_+_CTDSPL_ENST00000443503_chr3_37988548_+_5125nt
CCGCCCGGCCCGGGACCCGCTCGCGCAGACTTCTCGGGCGGACTGAGGACGCCGCCGCTCGGGGCCGCCCCTGTGCTCGCCTTCAGCGCC
CGCTCAGCCCGCCGTCCGCGCCCCGGTGGCGGGCCCGACGCCCGCATTCCGCCCGTGTCCAGGCGCAGAGCTCCCGCCCCGGGGAGCTTC
CTGGCCGTCGGCGGGCCCCGCGGCCCGCGCGCTCGGCGCCCTGCTCGCCGGGCAGAGGGGAAGGCGGCGGCCGGCTGGGGATGGGCGGCC
CGGCTGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTACAACCTCGACC
CGCAGCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACGCGCTGGGTCC
TTGTGGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCACACCAACCCTG
ACCGGAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGCGATGATGAGT
GGATGGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTACTATGAAGCCG
ACCACATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTATGAAGCCTCCC
AGTGCAACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTC
CACCCAGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGCCACCAGCTAAGTACCTTCTTCCAGAGGTGA
CGGTGCTTGACTATGGAAAGAAATGTGTGGTCATTGATTTAGATGAAACATTGGTGCACAGTTCGTTTAAGCCTATTAGTAATGCTGATT
TTATTGTTCCGGTTGAAATCGATGGAACTATACATCAGGTGTATGTGCTGAAGCGGCCACATGTGGACGAGTTCCTCCAGAGGATGGGGC
AGCTTTTTGAATGTGTGCTCTTTACTGCCAGCTTGGCCAAGTATGCAGACCCTGTGGCTGACCTCCTAGACCGCTGGGGTGTGTTCCGGG
CCCGGCTCTTCAGAGAATCATGTGTTTTTCATCGTGGGAACTACGTGAAGGACCTGAGTCGCCTTGGGCGGGAGCTGAGCAAAGTGATCA
TTGTTGACAATTCCCCTGCCTCATACATCTTCCATCCTGAGAATGCAGTGCCTGTGCAGTCCTGGTTCGATGACATGACGGACACGGAGC
TGCTGGACCTCATCCCCTTCTTTGAGGGCCTGAGCCGGGAGGACGACGTGTACAGCATGCTGCACAGACTCTGCAATAGGTAGCCCTGGC
CTCTGCCTGCCTCCCGCCTGTGCACTCTGGAACCTCTGGCCTCAGGGGACCTGCCTGTCCTCAGCTCCCTGGGAGCTGAAAGTGAGGATA
CTCCGTGCTCCAGGCCACAGGGTGAATGTGGCCATGCCTACCTGTTTTGTTTTTTTAAGAACAGAAACAACTATTTTAAAAGAACTCTTT
TAAGAAATTTCATAAAGGGACATGCATTTTACTGGGTTTGCTTTTCTTAAAACATACCAAAAAAGAAAAAAATAGAAAAAAAAAAAAAAA
AAGCTTGATCTCTATCAGACTTCCTTTCAACTGTCCTCCCCTCCAAGCAGACCACCTGTCCCCTTCTATCCCAGCTCAGAGCAGCTGACC
CAACTCAGAATCTCTTTCCTACAGGATGAAGTGCCTTTTGAATGTTATTTTAAGCCGAGAGTTAATTTTTCTACACAACATATTTCCAGA
CATCTTTTAGTCTTTTATTGTCTTAGATACTATAAGAAGATGAACATGACAATTTTCTAGAACCTGGTAGCGTGTGTGTGTGTGGCGGGG
GGTGCTGAGGGAGGGGAGTGAGTCACAGGAGCCTGTCCCCCAACAGGTGTGACTGCTCTGACAACCTGTGGCATGCTGCAGGGTCAGGCT
CCTGATAGGAGGATTTCATGACTATGTCATTGTCTCCACTCATTTTTGACCCAGTTTGGAATGTATCTGCAATTGTGTGGCTCAACACTT
TAGGAAACAATAGATTATTTTATATTATTATTTCTGATGGTGACAAGTTTGTCTTGAGGTCACATTTTCTCCTTGAAAAGTGACATCCTG
TCACTTCTGCTCTCACACTACTGCCATACATTTGTGTTTTTTGTTGTTATTGTTTGGGTAGAGCAGTTACAAGAAACCCTAAAACCCTTG
GATATAAAAGAAATCTGTTTATTGATTTTTAAATCTTTCCTTTCCAAAAGCTGGATACACATGGAGCTGTTTGGGAATTTTCCTTGCTGC
TACCGCGCTGCCACCAAATGGAATTGACCAGCGGCTGTTACACTGTTCTTTGCCACTGTGCCTATGCTCAGAATATGCTCACTGCTAAGC
TACAAACTCGGACAGGGTCAGAAACAGAGGTGTCCCATCCCATTGCAGCCTCCACCACCTGTAACCCCTTCCTGGCATTGGCCACTGAAG
GGTACAAAGGCAAAAGGACCACAGCACCACTTAGGTGTAGCATGGATTTTAAACTGCAGTCAGTATCAGATCCTGTTTGATAAATAAGCT
GACTGTTCTCTCTTGAGAACCTGTGGCCTCAACCAGCCACCAAGCTGATGTGGCCCAAGTCCATCTCTTGGTCTTCTCCTTTGAAGCACA
GCCTATTTCTGAGCCAAGGGTTGGGGAAGCCTGTCTAGATGTGGGACTCATTGCCCCAAACCAGGGAGAGGAAGAGCTCCCACAGGGAGA
GCCCAGGCTCTCTTTGCAGCCTTTCCCAGTTTGGTGTTTAAGCAGTGCCATGTTCCTTGTTTGACAACAAGACAGTCTGTAAAGTATTGC
TCTTAAAAACAATTAAAAAGAACCCTTTCATATTGGCACCATTGCCTTAGTCCTCTGTGGGTTGGTCTTCAGCCAGCATTCTGGTGGGAG
TGACTGGCATTAACAAGACTGGAAATCGGGGGTCAAAGTAAAATATCTTTGTTTTGCTTTCATTCACAAAGTAATGAAGCCAGCTGCCAA
TTACATCCTCCCAACAGCACTTTGGTCTGTGGACTGCTGTGTGAATATTCAGAAGGGAAGTAAGTATTCAGGGGGTAAACAGGTCTCCCA
GCATTCTGAGTGTTCCAAACCAGTAATCCACATGCCAATTCAAATAGAACAGCCCCTTGCTAGATATTACCACAGATAATGACAGTTACA
TGGTAGAACTGCCCATGCCACAAATATTTATTTGGAAAAGTAGTCATTAAATGAACCCACTGCCTTAAATGTCTTGAATGTTGCAGTCAA
GTGTCTGTCATGTGTTGATATCCACACAGAATTAGGCCCTAATGAGAGCCTTAGACCCTCAACCATGCCCCCTTCGTTGGCATCACAGGG
CCTTATTTGGAAGAGCGGGCAAAGAGGATGGAAATCATAAAATATTTCATGGGAATCGAACCTAGGGATAGTGCTCCACTTCTGACGATG
GAGTGAAGACACTTGGCAGACTTGAGCCAGACACTTCACCTAGTAGTTCCTGAAACTGTGAGCACCACTGCACTAAGCCAGTGCGGAGCT
GTTAGGGACGGGCCCAGCTCCTGCACCACGGACACAGAATGTCTGGAGAGGGCCAGCAGGCCCTCTGAGGGTTCTGGAATCTGTGCACCT
TATTTGACCACACTCCAAAATTCTGTTTTTATTTTAACCCTTGAATCTGCTTTATGTACATAATCAAAATATCTATATCTATATCTATAT
CTATATCTATATATTTTTAATCATCTACATGTAAATGAAGCAATAGAATTCTAACATAAGGCCAAGAAATGAGACGAATGTTTGGGGTTT
ATGTTTTTTAAGGTAAATACGGGTATTGTTTTTAATTATTACCATGTATTAAATTGTGGGCTTTGAAACCTAATGAAACCTGTTAGCCAC
TTCTCTGTGCCATATACTTCCCATGTTACCAAAATACCCCCAACTCTTTAGCCAAAAGAGAACCCTGACCTCCTGAGTTTCCATGCTCCT
TTCTGTACCAGGTTTAAATGTAGTCTTCTGGAGAAGTATTTTTGACATTGAGCTCTGGGACAGGACACCTTGGGTTTGTGGACTGCAGCC
CACTATGATGTTATTACTTCTCTGGCCAGGCCTCCAGTGGAAGTGCACAGGCACTCCCAATGTTGTTAATGCTCTGTCTTCCATTTGTTC
TGGAATCCTACGTGTTGGTCTGTGGTTCCATGCATTAGCTGTTTGTAAATAATGCATTTGCATACTGAAAAAGGAATGCCACCTGCCACA
GTTGATGGTGAGGAAGCTCCTTTGACGTGGTGCAATTTTGATGAGATGTCTCTGGGGACACGAGGATGCCCTAATGATGCTGACTTGTCA
TGGTTGCAGCATTTGAACTTTTGGTGTTAAAAAAAAAAACCTGTAAGTCTGTAACCTGGCAACATTTTACAACCCTGTATTTTTAAAGAT
GGCTTTCTAATAAAAAATCCAGAACCACACAGCCCTATGGTCAAACAATCCTACGTTTGTGCCTCTGCTTTTAAAGGTGCTGTGCTGGAC
AGTTGGCATGCCAGGGTTCGAGAAGAGTGAATGGCTTGACGTACTTGCAGTTAACTGTGCAAAATTGGCTGGCTGCCTCTGTTCCTACTG
TACTGTAACTTTGATCATGTCTGTTCCTGTTCCATTCTCCCAGGAGCTTCTCTGCAGACTGACACACCCTCCCCCACCCCGGGTAGTGGA
GATGCTGGTGTCTGGGTAGTCATGGATTTCTGCTGGACATTTGAATGTGATAAACAATCCAGCATTACTTAGGAAATGCTACATGCGGAA

>In-frame_ITGA9_ENST00000422441_chr3_37523098_+_CTDSPL_ENST00000273179_chr3_37988548_+_5158nt
CCGCCCGGCCCGGGACCCGCTCGCGCAGACTTCTCGGGCGGACTGAGGACGCCGCCGCTCGGGGCCGCCCCTGTGCTCGCCTTCAGCGCC
CGCTCAGCCCGCCGTCCGCGCCCCGGTGGCGGGCCCGACGCCCGCATTCCGCCCGTGTCCAGGCGCAGAGCTCCCGCCCCGGGGAGCTTC
CTGGCCGTCGGCGGGCCCCGCGGCCCGCGCGCTCGGCGCCCTGCTCGCCGGGCAGAGGGGAAGGCGGCGGCCGGCTGGGGATGGGCGGCC
CGGCTGCGCCGAGGGGCGCCGGGAGGCTCCGCGCGCTGCTGCTGGCGCTGGTGGTCGCGGGGATCCCCGCGGGCGCCTACAACCTCGACC
CGCAGCGCCCCGTGCACTTCCAGGGCCCCGCTGACTCGTTCTTCGGCTACGCAGTTCTGGAGCATTTCCACGACAACACGCGCTGGGTCC
TTGTGGGCGCACCAAAGGCAGATTCCAAATACAGCCCTTCAGTGAAGTCTCCTGGGGCTGTGTTTAAGTGCCGTGTTCACACCAACCCTG
ACCGGAGATGCACCGAACTGGACATGGCTCGAGGGAAGAATCGGGGCACGTCCTGCGGAAAGACCTGCCGGGAAGACCGCGATGATGAGT
GGATGGGGGTGAGCCTGGCCCGACAGCCCAAGGCTGATGGCCGTGTGTTGGCCTGTGCTCATCGCTGGAAGAACATCTACTATGAAGCCG
ACCACATCCTACCCCATGGCTTCTGCTACATCATCCCCTCCAACCTCCAGGCCAAAGGCAGGACGCTGATCCCTTGCTATGAAGCCTCCC
AGTGCAACGTCAGCTTAAAGAAGCAGAGGAGCCGCAGCATCCTTAGCTCCTTCTTCTGCTGCTTCCGTGATTACAATGTGGAGGCCCCTC
CACCCAGCAGCCCCAGTGTGCTTCCGCCACTGGTGGAGGAGAATGGTGGGCTTCAGAAGGGTGACCAGAGGCAGGTCATTCCCATACCAA
GTCCACCAGCTAAGTACCTTCTTCCAGAGGTGACGGTGCTTGACTATGGAAAGAAATGTGTGGTCATTGATTTAGATGAAACATTGGTGC
ACAGTTCGTTTAAGCCTATTAGTAATGCTGATTTTATTGTTCCGGTTGAAATCGATGGAACTATACATCAGGTGTATGTGCTGAAGCGGC
CACATGTGGACGAGTTCCTCCAGAGGATGGGGCAGCTTTTTGAATGTGTGCTCTTTACTGCCAGCTTGGCCAAGTATGCAGACCCTGTGG
CTGACCTCCTAGACCGCTGGGGTGTGTTCCGGGCCCGGCTCTTCAGAGAATCATGTGTTTTTCATCGTGGGAACTACGTGAAGGACCTGA
GTCGCCTTGGGCGGGAGCTGAGCAAAGTGATCATTGTTGACAATTCCCCTGCCTCATACATCTTCCATCCTGAGAATGCAGTGCCTGTGC
AGTCCTGGTTCGATGACATGACGGACACGGAGCTGCTGGACCTCATCCCCTTCTTTGAGGGCCTGAGCCGGGAGGACGACGTGTACAGCA
TGCTGCACAGACTCTGCAATAGGTAGCCCTGGCCTCTGCCTGCCTCCCGCCTGTGCACTCTGGAACCTCTGGCCTCAGGGGACCTGCCTG
TCCTCAGCTCCCTGGGAGCTGAAAGTGAGGATACTCCGTGCTCCAGGCCACAGGGTGAATGTGGCCATGCCTACCTGTTTTGTTTTTTTA
AGAACAGAAACAACTATTTTAAAAGAACTCTTTTAAGAAATTTCATAAAGGGACATGCATTTTACTGGGTTTGCTTTTCTTAAAACATAC
CAAAAAAGAAAAAAATAGAAAAAAAAAAAAAAAAAGCTTGATCTCTATCAGACTTCCTTTCAACTGTCCTCCCCTCCAAGCAGACCACCT
GTCCCCTTCTATCCCAGCTCAGAGCAGCTGACCCAACTCAGAATCTCTTTCCTACAGGATGAAGTGCCTTTTGAATGTTATTTTAAGCCG
AGAGTTAATTTTTCTACACAACATATTTCCAGACATCTTTTAGTCTTTTATTGTCTTAGATACTATAAGAAGATGAACATGACAATTTTC
TAGAACCTGGTAGCGTGTGTGTGTGTGGCGGGGGGTGCTGAGGGAGGGGAGTGAGTCACAGGAGCCTGTCCCCCAACAGGTGTGACTGCT
CTGACAACCTGTGGCATGCTGCAGGGTCAGGCTCCTGATAGGAGGATTTCATGACTATGTCATTGTCTCCACTCATTTTTGACCCAGTTT
GGAATGTATCTGCAATTGTGTGGCTCAACACTTTAGGAAACAATAGATTATTTTATATTATTATTTCTGATGGTGACAAGTTTGTCTTGA
GGTCACATTTTCTCCTTGAAAAGTGACATCCTGTCACTTCTGCTCTCACACTACTGCCATACATTTGTGTTTTTTGTTGTTATTGTTTGG
GTAGAGCAGTTACAAGAAACCCTAAAACCCTTGGATATAAAAGAAATCTGTTTATTGATTTTTAAATCTTTCCTTTCCAAAAGCTGGATA
CACATGGAGCTGTTTGGGAATTTTCCTTGCTGCTACCGCGCTGCCACCAAATGGAATTGACCAGCGGCTGTTACACTGTTCTTTGCCACT
GTGCCTATGCTCAGAATATGCTCACTGCTAAGCTACAAACTCGGACAGGGTCAGAAACAGAGGTGTCCCATCCCATTGCAGCCTCCACCA
CCTGTAACCCCTTCCTGGCATTGGCCACTGAAGGGTACAAAGGCAAAAGGACCACAGCACCACTTAGGTGTAGCATGGATTTTAAACTGC
AGTCAGTATCAGATCCTGTTTGATAAATAAGCTGACTGTTCTCTCTTGAGAACCTGTGGCCTCAACCAGCCACCAAGCTGATGTGGCCCA
AGTCCATCTCTTGGTCTTCTCCTTTGAAGCACAGCCTATTTCTGAGCCAAGGGTTGGGGAAGCCTGTCTAGATGTGGGACTCATTGCCCC
AAACCAGGGAGAGGAAGAGCTCCCACAGGGAGAGCCCAGGCTCTCTTTGCAGCCTTTCCCAGTTTGGTGTTTAAGCAGTGCCATGTTCCT
TGTTTGACAACAAGACAGTCTGTAAAGTATTGCTCTTAAAAACAATTAAAAAGAACCCTTTCATATTGGCACCATTGCCTTAGTCCTCTG
TGGGTTGGTCTTCAGCCAGCATTCTGGTGGGAGTGACTGGCATTAACAAGACTGGAAATCGGGGGTCAAAGTAAAATATCTTTGTTTTGC
TTTCATTCACAAAGTAATGAAGCCAGCTGCCAATTACATCCTCCCAACAGCACTTTGGTCTGTGGACTGCTGTGTGAATATTCAGAAGGG
AAGTAAGTATTCAGGGGGTAAACAGGTCTCCCAGCATTCTGAGTGTTCCAAACCAGTAATCCACATGCCAATTCAAATAGAACAGCCCCT
TGCTAGATATTACCACAGATAATGACAGTTACATGGTAGAACTGCCCATGCCACAAATATTTATTTGGAAAAGTAGTCATTAAATGAACC
CACTGCCTTAAATGTCTTGAATGTTGCAGTCAAGTGTCTGTCATGTGTTGATATCCACACAGAATTAGGCCCTAATGAGAGCCTTAGACC
CTCAACCATGCCCCCTTCGTTGGCATCACAGGGCCTTATTTGGAAGAGCGGGCAAAGAGGATGGAAATCATAAAATATTTCATGGGAATC
GAACCTAGGGATAGTGCTCCACTTCTGACGATGGAGTGAAGACACTTGGCAGACTTGAGCCAGACACTTCACCTAGTAGTTCCTGAAACT
GTGAGCACCACTGCACTAAGCCAGTGCGGAGCTGTTAGGGACGGGCCCAGCTCCTGCACCACGGACACAGAATGTCTGGAGAGGGCCAGC
AGGCCCTCTGAGGGTTCTGGAATCTGTGCACCTTATTTGACCACACTCCAAAATTCTGTTTTTATTTTAACCCTTGAATCTGCTTTATGT
ACATAATCAAAATATCTATATCTATATCTATATCTATATCTATATATTTTTAATCATCTACATGTAAATGAAGCAATAGAATTCTAACAT
AAGGCCAAGAAATGAGACGAATGTTTGGGGTTTATGTTTTTTAAGGTAAATACGGGTATTGTTTTTAATTATTACCATGTATTAAATTGT
GGGCTTTGAAACCTAATGAAACCTGTTAGCCACTTCTCTGTGCCATATACTTCCCATGTTACCAAAATACCCCCAACTCTTTAGCCAAAA
GAGAACCCTGACCTCCTGAGTTTCCATGCTCCTTTCTGTACCAGGTTTAAATGTAGTCTTCTGGAGAAGTATTTTTGACATTGAGCTCTG
GGACAGGACACCTTGGGTTTGTGGACTGCAGCCCACTATGATGTTATTACTTCTCTGGCCAGGCCTCCAGTGGAAGTGCACAGGCACTCC
CAATGTTGTTAATGCTCTGTCTTCCATTTGTTCTGGAATCCTACGTGTTGGTCTGTGGTTCCATGCATTAGCTGTTTGTAAATAATGCAT
TTGCATACTGAAAAAGGAATGCCACCTGCCACAGTTGATGGTGAGGAAGCTCCTTTGACGTGGTGCAATTTTGATGAGATGTCTCTGGGG
ACACGAGGATGCCCTAATGATGCTGACTTGTCATGGTTGCAGCATTTGAACTTTTGGTGTTAAAAAAAAAAACCTGTAAGTCTGTAACCT
GGCAACATTTTACAACCCTGTATTTTTAAAGATGGCTTTCTAATAAAAAATCCAGAACCACACAGCCCTATGGTCAAACAATCCTACGTT
TGTGCCTCTGCTTTTAAAGGTGCTGTGCTGGACAGTTGGCATGCCAGGGTTCGAGAAGAGTGAATGGCTTGACGTACTTGCAGTTAACTG
TGCAAAATTGGCTGGCTGCCTCTGTTCCTACTGTACTGTAACTTTGATCATGTCTGTTCCTGTTCCATTCTCCCAGGAGCTTCTCTGCAG
ACTGACACACCCTCCCCCACCCCGGGTAGTGGAGATGCTGGTGTCTGGGTAGTCATGGATTTCTGCTGGACATTTGAATGTGATAAACAA
TCCAGCATTACTTAGGAAATGCTACATGCGGAATGTGCACGTTTCCAGGGGCGAGTATTGTCAATCAAAAGGTTTGCAATGATTTCCTTC


Top

FusionGenePPI for ITGA9_CTDSPL


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ITGA9ITGB1, ALDH1A3, LCN2, SERPINB4, SPRR1B, PCYOX1L, SMOC1, IGLL5, KLK10, IVL, HSPA5, CALML5, EVPL, IGKC, TUBA4ACTDSPLSNAI1, ELAVL1, CTDSP1, CDCA3, TBC1D4, ARVCF, CADM1, RFTN1, PACS1, DAB2IP, ARHGAP39, CD44, ABCC1, ATP2B4, NOTCH1, PVRL2, MCAM, ITGA5, USP31, C2CD4C, TBC1D10B, TIAM1, ITGA6, KIRREL, SPTBN2, PPP1R9A, CDC42EP1, TMEM2, CACHD1, MICAL3, ANK3, FMN2, ROBO1, MPZL1, ADD2, PALM2, NUMBL, AKAP5, SLC30A1, KIAA1549, CTNNA1, FLVCR1, SLC29A1, CXADR, FAM171B, TTC7B, PCDH7, MARVELD2, NF2, SLC39A6, BASP1, CNNM3, SLC39A10, CLCN7, GPRIN3, ESYT2, FAM171A1, LPHN2, RELL1, SLC12A7, NUMB, CEP89, SLC12A2, CTNND1, DTNA, CCDC8, SLC38A1, TJP1, ZDHHC5, PALM, EGFR, PTPN14, TULP3, FAM129B, GPRIN1, HSPA12A, ATP2B1, EFR3B, SLC3A2, ARL13B, PSD3, MBP, FGFR2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ITGA9_CTDSPL


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ITGA9_CTDSPL


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneITGA9C0005586Bipolar Disorder1PSYGENET
HgeneITGA9C1839839MAJOR AFFECTIVE DISORDER 21PSYGENET