FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 17797

FusionGeneSummary for ITFG1_SLC45A2

check button Fusion gene summary
Fusion gene informationFusion gene name: ITFG1_SLC45A2
Fusion gene ID: 17797
HgeneTgene
Gene symbol

ITFG1

SLC45A2

Gene ID

81533

51151

Gene nameintegrin alpha FG-GAP repeat containing 1solute carrier family 45 member 2
Synonyms2310047C21Rik|CDA08|LNKN-1|TIP1A1|AIM1|MATP|OCA4|SHEP5
Cytomap

16q12.1

5p13.2

Type of geneprotein-codingprotein-coding
DescriptionT-cell immunomodulatory proteinLINKINintegrin-alpha FG-GAP repeat-containing protein 1membrane-associated transporter proteinmelanoma antigen AIM1protein AIM-1underwhite
Modification date2018051920180519
UniProtAcc

Q8TB96

Q9UMX9

Ensembl transtripts involved in fusion geneENST00000568047, ENST00000320640, 
ENST00000544001, 
ENST00000296589, 
ENST00000342059, ENST00000382102, 
ENST00000509381, ENST00000345083, 
Fusion gene scores* DoF score2 X 2 X 2=81 X 1 X 1=1
# samples 21
** MAII scorelog2(2/8*10)=1.32192809488736log2(1/1*10)=3.32192809488736
Context

PubMed: ITFG1 [Title/Abstract] AND SLC45A2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-ZG-A9L4-01AITFG1chr16

47345151

-SLC45A2chr5

33964121

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
5UTR-3CDSENST00000568047ENST00000296589ITFG1chr16

47345151

-SLC45A2chr5

33964121

-
5UTR-3CDSENST00000568047ENST00000342059ITFG1chr16

47345151

-SLC45A2chr5

33964121

-
5UTR-3CDSENST00000568047ENST00000382102ITFG1chr16

47345151

-SLC45A2chr5

33964121

-
5UTR-intronENST00000568047ENST00000509381ITFG1chr16

47345151

-SLC45A2chr5

33964121

-
5UTR-intronENST00000568047ENST00000345083ITFG1chr16

47345151

-SLC45A2chr5

33964121

-
Frame-shitENST00000320640ENST00000296589ITFG1chr16

47345151

-SLC45A2chr5

33964121

-
Frame-shitENST00000320640ENST00000342059ITFG1chr16

47345151

-SLC45A2chr5

33964121

-
Frame-shitENST00000320640ENST00000382102ITFG1chr16

47345151

-SLC45A2chr5

33964121

-
5CDS-intronENST00000320640ENST00000509381ITFG1chr16

47345151

-SLC45A2chr5

33964121

-
5CDS-intronENST00000320640ENST00000345083ITFG1chr16

47345151

-SLC45A2chr5

33964121

-
In-frameENST00000544001ENST00000296589ITFG1chr16

47345151

-SLC45A2chr5

33964121

-
In-frameENST00000544001ENST00000342059ITFG1chr16

47345151

-SLC45A2chr5

33964121

-
In-frameENST00000544001ENST00000382102ITFG1chr16

47345151

-SLC45A2chr5

33964121

-
5CDS-intronENST00000544001ENST00000509381ITFG1chr16

47345151

-SLC45A2chr5

33964121

-
5CDS-intronENST00000544001ENST00000345083ITFG1chr16

47345151

-SLC45A2chr5

33964121

-

Top

FusionProtFeatures for ITFG1_SLC45A2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ITFG1

Q8TB96

SLC45A2

Q9UMX9

Modulator of T-cell function. Has a protective effect ingraft versus host disease model (By similarity). {ECO:0000250}. Melanocyte differentiation antigen. May transportsubstances required for melanin biosynthesis (By similarity).{ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ITFG1_SLC45A2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ITFG1_ENST00000544001_chr16_47345151_-_SLC45A2_ENST00000296589_chr5_33964121_-_587aa
MDVLLTTLPKNTAKSELGAVIFWGQNQTLDPNNMTILNRTFQDEPLIMDFNGDLIPDIFGITNESNQPQILLGGNLSWHPALTTTSKMRI
PHSHAFIDLTEDFTADLFLTTLNATTSTFQFEIWENLDGNFSVSTILEKPQNMMVVGQSAFADFDGDGHMDHLLPGCEDKNCQKSTIYLV
RSGMKQWVPVLQDFSNKGTLWGFVPFVDEQQPTEIPIPITLHIGDYNMDGTPDALVILKNTSGRFWRCPGLPFGCTRLGPSGAGKTVGYR
IPGHVLLLCIGAHFVFYCSSVQTL_SPTYRGCKGHSPTANPSGPSIVIRWNVRVWFTRES_KWLRKSRAGNAGSKKQKSC_TDSQGNDIK
VTAESTGEHASSLPLPLHQPPHWMDSLPVQHAVLHRFHGPDCVPRGSL_CTQLHRVSHLRKRSRGWMLGLVHQLRVFLTLFLLSESFGIL
HWIKGSLLHGIFAVWPGDGITWALPECLLHPGPVQPVWCNVQHPVHCAL_PHY_VPPRGRKGEAAGPRRGPRQQREREGHGLRHPHMHGA

>In-frame_ITFG1_ENST00000544001_chr16_47345151_-_SLC45A2_ENST00000342059_chr5_33964121_-_587aa
MDVLLTTLPKNTAKSELGAVIFWGQNQTLDPNNMTILNRTFQDEPLIMDFNGDLIPDIFGITNESNQPQILLGGNLSWHPALTTTSKMRI
PHSHAFIDLTEDFTADLFLTTLNATTSTFQFEIWENLDGNFSVSTILEKPQNMMVVGQSAFADFDGDGHMDHLLPGCEDKNCQKSTIYLV
RSGMKQWVPVLQDFSNKGTLWGFVPFVDEQQPTEIPIPITLHIGDYNMDGTPDALVILKNTSGRFWRCPGLPFGCTRLGPSGAGKTVGYR
IPGHVLLLCIGAHFVFYCSSVQTL_SPTYRGCKGHSPTANPSGPSIVIRWNVRVWFTRES_KWLRKSRAGNAGSKKQKSC_TDSQGNDIK
VTAESTGEHASSLPLPLHQPPHWMDSLPVQHAVLHRFHGPDCVPRGSL_CTQLHRVSHLRKRSRGWMLGLVHQLRVFLTLFLLSESFGIL
HWIKGSLLHGIFAVWPGDGITWALPECLLHPGPVQPVWCNVQHPVHCAL_PHY_VPPRGRKGEAAGPRRGPRQQREREGHGLRHPHMHGA

>In-frame_ITFG1_ENST00000544001_chr16_47345151_-_SLC45A2_ENST00000382102_chr5_33964121_-_517aa
MDVLLTTLPKNTAKSELGAVIFWGQNQTLDPNNMTILNRTFQDEPLIMDFNGDLIPDIFGITNESNQPQILLGGNLSWHPALTTTSKMRI
PHSHAFIDLTEDFTADLFLTTLNATTSTFQFEIWENLDGNFSVSTILEKPQNMMVVGQSAFADFDGDGHMDHLLPGCEDKNCQKSTIYLV
RSGMKQWVPVLQDFSNKGTLWGFVPFVDEQQPTEIPIPITLHIGDYNMDGTPDALVILKNTSGRFWRCPGLPFGCTRLGPSGAGKTVGYR
IPGHVLLLCIGAHFVFYCSSVQTL_SPTYRGCKGHSPTANPSGPSIVIRWNVRVWFTRES_KWLRKSRAGNAGSKKQKSC_TDSQGNDIK
VTAESTGEHASSLPLPLHQPPHWMDSLPVQHAVLHRFHGPDCVPRGSL_CTQLHRVSHLRKRSRGWMLGLVHQLRVFLTLFLLSESFGIL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ITFG1_ENST00000544001_chr16_47345151_-_SLC45A2_ENST00000296589_chr5_33964121_-_1762nt
ATGGATGTCCTTCTGACATATCTTCCCAAAAATTATGCCAAGAGTGAATTAGGAGCTGTTATCTTCTGGGGACAAAATCAAACATTAGAT
CCTAACAATATGACCATACTCAATAGGACTTTTCAAGATGAGCCACTAATTATGGATTTCAATGGTGATCTAATTCCTGATATTTTTGGT
ATCACAAATGAATCCAACCAGCCACAGATACTATTAGGAGGGAATTTATCATGGCATCCAGCATTGACCACTACAAGTAAAATGCGAATT
CCACATTCTCATGCATTTATTGATCTGACTGAAGATTTTACAGCAGATTTATTCCTGACGACATTGAATGCCACCACTAGTACCTTCCAG
TTTGAAATATGGGAAAATTTGGATGGAAACTTCTCTGTCAGTACTATATTGGAAAAACCTCAAAATATGATGGTGGTTGGACAGTCAGCA
TTTGCAGACTTTGATGGAGATGGACACATGGATCATTTACTGCCAGGCTGTGAAGATAAAAATTGCCAAAAGAGTACCATCTACTTAGTG
AGATCTGGGATGAAGCAGTGGGTTCCAGTCCTACAAGATTTCAGCAATAAGGGCACACTCTGGGGCTTTGTGCCATTTGTGGATGAACAG
CAACCAACTGAAATACCAATTCCAATTACCCTTCATATTGGAGACTACAATATGGATGGCTATCCAGACGCTCTGGTCATACTAAAGAAC
ACATCTGGAAGGTTTTGGAGGTGCCCTGGGTTACCTTTTGGGTGCTATAGACTGGGCCCATCTGGAGCTGGGAAGACTGTTGGGTACAGA
ATTCCAGGTCATGTTCTTCTTCTCTGCATTGGTGCTCACTTTGTGTTTTACTGTTCATCTGTGCAGTATCTCTGAAGCCCCACTTACAGA
GGTTGCAAAGGGCATTCCCCCACAGCAAACCCCTCAGGACCCTCCATTGTCATCAGATGGAATGTACGAGTATGGTTCTATCGAGAAAGT
TAAAAATGGTTACGTAAATCCAGAGCTGGCAATGCAGGGAGCAAAAAACAAAAATCATGCTGAACAGACTCGCAGGGCAATGACATTAAA
GTCACTGCTGAGAGCACTGGTGAACATGCCTCCTCACTACCGCTACCTTTGCATCAGCCACCTCATTGGATGGACAGCCTTCCTGTCCAA
CATGCTGTTCTTCACAGATTTCATGGGCCAGATTGTGTACCGCGGGGATCCCTATAGTGCACACAACTCCACAGAGTTTCTCATCTACGA
AAGAGGAGTCGAGGTTGGATGTTGGGGCTTGTGCATCAACTCCGTGTTTTCCTCACTTTATTCTTACTTTCAGAAAGTTTTGGTATCCTA
CATTGGATTAAAGGGTCTTTACTTCACGGGATATTTGCTGTTTGGCCTGGGGACGGGATTTATTGGGCTCTTCCCGAATGTCTACTCCAC
CCTGGTCCTGTGCAGCCTGTTTGGTGTAATGTCCAGCACCCTGTACACTGTGCCCTTTAACCTCATTACTGAGTACCACCGCGAGGAAGA
AAAGGAGAGGCAGCAGGCCCCAGGAGGGGACCCAGACAACAGCGTGAGAGGGAAGGGCATGGACTGCGCCACCCTCACATGCATGGTGCA
GCTGGCTCAGATCCTGGTCGGAGGTGGCCTGGGCTTTCTGGTCAACACAGCCGGGACCGTTGTCGTCGTGGTGATCACAGCGTCTGCGGT

>In-frame_ITFG1_ENST00000544001_chr16_47345151_-_SLC45A2_ENST00000342059_chr5_33964121_-_1762nt
ATGGATGTCCTTCTGACATATCTTCCCAAAAATTATGCCAAGAGTGAATTAGGAGCTGTTATCTTCTGGGGACAAAATCAAACATTAGAT
CCTAACAATATGACCATACTCAATAGGACTTTTCAAGATGAGCCACTAATTATGGATTTCAATGGTGATCTAATTCCTGATATTTTTGGT
ATCACAAATGAATCCAACCAGCCACAGATACTATTAGGAGGGAATTTATCATGGCATCCAGCATTGACCACTACAAGTAAAATGCGAATT
CCACATTCTCATGCATTTATTGATCTGACTGAAGATTTTACAGCAGATTTATTCCTGACGACATTGAATGCCACCACTAGTACCTTCCAG
TTTGAAATATGGGAAAATTTGGATGGAAACTTCTCTGTCAGTACTATATTGGAAAAACCTCAAAATATGATGGTGGTTGGACAGTCAGCA
TTTGCAGACTTTGATGGAGATGGACACATGGATCATTTACTGCCAGGCTGTGAAGATAAAAATTGCCAAAAGAGTACCATCTACTTAGTG
AGATCTGGGATGAAGCAGTGGGTTCCAGTCCTACAAGATTTCAGCAATAAGGGCACACTCTGGGGCTTTGTGCCATTTGTGGATGAACAG
CAACCAACTGAAATACCAATTCCAATTACCCTTCATATTGGAGACTACAATATGGATGGCTATCCAGACGCTCTGGTCATACTAAAGAAC
ACATCTGGAAGGTTTTGGAGGTGCCCTGGGTTACCTTTTGGGTGCTATAGACTGGGCCCATCTGGAGCTGGGAAGACTGTTGGGTACAGA
ATTCCAGGTCATGTTCTTCTTCTCTGCATTGGTGCTCACTTTGTGTTTTACTGTTCATCTGTGCAGTATCTCTGAAGCCCCACTTACAGA
GGTTGCAAAGGGCATTCCCCCACAGCAAACCCCTCAGGACCCTCCATTGTCATCAGATGGAATGTACGAGTATGGTTCTATCGAGAAAGT
TAAAAATGGTTACGTAAATCCAGAGCTGGCAATGCAGGGAGCAAAAAACAAAAATCATGCTGAACAGACTCGCAGGGCAATGACATTAAA
GTCACTGCTGAGAGCACTGGTGAACATGCCTCCTCACTACCGCTACCTTTGCATCAGCCACCTCATTGGATGGACAGCCTTCCTGTCCAA
CATGCTGTTCTTCACAGATTTCATGGGCCAGATTGTGTACCGCGGGGATCCCTATAGTGCACACAACTCCACAGAGTTTCTCATCTACGA
AAGAGGAGTCGAGGTTGGATGTTGGGGCTTGTGCATCAACTCCGTGTTTTCCTCACTTTATTCTTACTTTCAGAAAGTTTTGGTATCCTA
CATTGGATTAAAGGGTCTTTACTTCACGGGATATTTGCTGTTTGGCCTGGGGACGGGATTTATTGGGCTCTTCCCGAATGTCTACTCCAC
CCTGGTCCTGTGCAGCCTGTTTGGTGTAATGTCCAGCACCCTGTACACTGTGCCCTTTAACCTCATTACTGAGTACCACCGCGAGGAAGA
AAAGGAGAGGCAGCAGGCCCCAGGAGGGGACCCAGACAACAGCGTGAGAGGGAAGGGCATGGACTGCGCCACCCTCACATGCATGGTGCA
GCTGGCTCAGATCCTGGTCGGAGGTGGCCTGGGCTTTCTGGTCAACACAGCCGGGACCGTTGTCGTCGTGGTGATCACAGCGTCTGCGGT

>In-frame_ITFG1_ENST00000544001_chr16_47345151_-_SLC45A2_ENST00000382102_chr5_33964121_-_1552nt
ATGGATGTCCTTCTGACATATCTTCCCAAAAATTATGCCAAGAGTGAATTAGGAGCTGTTATCTTCTGGGGACAAAATCAAACATTAGAT
CCTAACAATATGACCATACTCAATAGGACTTTTCAAGATGAGCCACTAATTATGGATTTCAATGGTGATCTAATTCCTGATATTTTTGGT
ATCACAAATGAATCCAACCAGCCACAGATACTATTAGGAGGGAATTTATCATGGCATCCAGCATTGACCACTACAAGTAAAATGCGAATT
CCACATTCTCATGCATTTATTGATCTGACTGAAGATTTTACAGCAGATTTATTCCTGACGACATTGAATGCCACCACTAGTACCTTCCAG
TTTGAAATATGGGAAAATTTGGATGGAAACTTCTCTGTCAGTACTATATTGGAAAAACCTCAAAATATGATGGTGGTTGGACAGTCAGCA
TTTGCAGACTTTGATGGAGATGGACACATGGATCATTTACTGCCAGGCTGTGAAGATAAAAATTGCCAAAAGAGTACCATCTACTTAGTG
AGATCTGGGATGAAGCAGTGGGTTCCAGTCCTACAAGATTTCAGCAATAAGGGCACACTCTGGGGCTTTGTGCCATTTGTGGATGAACAG
CAACCAACTGAAATACCAATTCCAATTACCCTTCATATTGGAGACTACAATATGGATGGCTATCCAGACGCTCTGGTCATACTAAAGAAC
ACATCTGGAAGGTTTTGGAGGTGCCCTGGGTTACCTTTTGGGTGCTATAGACTGGGCCCATCTGGAGCTGGGAAGACTGTTGGGTACAGA
ATTCCAGGTCATGTTCTTCTTCTCTGCATTGGTGCTCACTTTGTGTTTTACTGTTCATCTGTGCAGTATCTCTGAAGCCCCACTTACAGA
GGTTGCAAAGGGCATTCCCCCACAGCAAACCCCTCAGGACCCTCCATTGTCATCAGATGGAATGTACGAGTATGGTTCTATCGAGAAAGT
TAAAAATGGTTACGTAAATCCAGAGCTGGCAATGCAGGGAGCAAAAAACAAAAATCATGCTGAACAGACTCGCAGGGCAATGACATTAAA
GTCACTGCTGAGAGCACTGGTGAACATGCCTCCTCACTACCGCTACCTTTGCATCAGCCACCTCATTGGATGGACAGCCTTCCTGTCCAA
CATGCTGTTCTTCACAGATTTCATGGGCCAGATTGTGTACCGCGGGGATCCCTATAGTGCACACAACTCCACAGAGTTTCTCATCTACGA
AAGAGGAGTCGAGGTTGGATGTTGGGGCTTGTGCATCAACTCCGTGTTTTCCTCACTTTATTCTTACTTTCAGAAAGTTTTGGTATCCTA
CATTGGATTAAAGGGTCTTTACTTCACGGGATATTTGCTGTTTGGCCTGGGGACGGGATTTATTGGGCTCTTCCCGAATGTCTACTCCAC
CCTGGTCCTGTGCAGCCTGTTTGGTGTAATGTCCAGCACCCTGTACACTGTGCCCTTTAACCTCATTACTGAGTACCACCGCGAGGAAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ITFG1_ENST00000544001_chr16_47345151_-_SLC45A2_ENST00000296589_chr5_33964121_-_2085nt
ACTGTCGGGAGGCGCGCCTGCCGGAAGTGAGCGTGAGGGCGGCTTTCACCCTAGCTCCACTGCTTTTTTAGCGTCGGAAGGGCAGCCCTA
GTGGGAGAGAGAAAAAGGAGCCGGCAGCGGCTCTTACGCGTCCCGGGGCTGCGCGCCACTCTCTCGGCCGGAAATGACTTAATCGTCTTT
TTGGCAGACCAGAATGCACCCTATTTTAAACCCAAAGTAAAGGTATCTTTCAAGAATCACAGTGCATTGATAACAAGTGTAGTCCCTGGG
GATTATGATGGAGATTCTCAAATGGATGTCCTTCTGACATATCTTCCCAAAAATTATGCCAAGAGTGAATTAGGAGCTGTTATCTTCTGG
GGACAAAATCAAACATTAGATCCTAACAATATGACCATACTCAATAGGACTTTTCAAGATGAGCCACTAATTATGGATTTCAATGGTGAT
CTAATTCCTGATATTTTTGGTATCACAAATGAATCCAACCAGCCACAGATACTATTAGGAGGGAATTTATCATGGCATCCAGCATTGACC
ACTACAAGTAAAATGCGAATTCCACATTCTCATGCATTTATTGATCTGACTGAAGATTTTACAGCAGATTTATTCCTGACGACATTGAAT
GCCACCACTAGTACCTTCCAGTTTGAAATATGGGAAAATTTGGATGGAAACTTCTCTGTCAGTACTATATTGGAAAAACCTCAAAATATG
ATGGTGGTTGGACAGTCAGCATTTGCAGACTTTGATGGAGATGGACACATGGATCATTTACTGCCAGGCTGTGAAGATAAAAATTGCCAA
AAGAGTACCATCTACTTAGTGAGATCTGGGATGAAGCAGTGGGTTCCAGTCCTACAAGATTTCAGCAATAAGGGCACACTCTGGGGCTTT
GTGCCATTTGTGGATGAACAGCAACCAACTGAAATACCAATTCCAATTACCCTTCATATTGGAGACTACAATATGGATGGCTATCCAGAC
GCTCTGGTCATACTAAAGAACACATCTGGAAGGTTTTGGAGGTGCCCTGGGTTACCTTTTGGGTGCTATAGACTGGGCCCATCTGGAGCT
GGGAAGACTGTTGGGTACAGAATTCCAGGTCATGTTCTTCTTCTCTGCATTGGTGCTCACTTTGTGTTTTACTGTTCATCTGTGCAGTAT
CTCTGAAGCCCCACTTACAGAGGTTGCAAAGGGCATTCCCCCACAGCAAACCCCTCAGGACCCTCCATTGTCATCAGATGGAATGTACGA
GTATGGTTCTATCGAGAAAGTTAAAAATGGTTACGTAAATCCAGAGCTGGCAATGCAGGGAGCAAAAAACAAAAATCATGCTGAACAGAC
TCGCAGGGCAATGACATTAAAGTCACTGCTGAGAGCACTGGTGAACATGCCTCCTCACTACCGCTACCTTTGCATCAGCCACCTCATTGG
ATGGACAGCCTTCCTGTCCAACATGCTGTTCTTCACAGATTTCATGGGCCAGATTGTGTACCGCGGGGATCCCTATAGTGCACACAACTC
CACAGAGTTTCTCATCTACGAAAGAGGAGTCGAGGTTGGATGTTGGGGCTTGTGCATCAACTCCGTGTTTTCCTCACTTTATTCTTACTT
TCAGAAAGTTTTGGTATCCTACATTGGATTAAAGGGTCTTTACTTCACGGGATATTTGCTGTTTGGCCTGGGGACGGGATTTATTGGGCT
CTTCCCGAATGTCTACTCCACCCTGGTCCTGTGCAGCCTGTTTGGTGTAATGTCCAGCACCCTGTACACTGTGCCCTTTAACCTCATTAC
TGAGTACCACCGCGAGGAAGAAAAGGAGAGGCAGCAGGCCCCAGGAGGGGACCCAGACAACAGCGTGAGAGGGAAGGGCATGGACTGCGC
CACCCTCACATGCATGGTGCAGCTGGCTCAGATCCTGGTCGGAGGTGGCCTGGGCTTTCTGGTCAACACAGCCGGGACCGTTGTCGTCGT
GGTGATCACAGCGTCTGCGGTGGCACTGATAGGCTGTTGCTTTGTCGCTCTCTTTGTTAGATATGTGGATTAGGTCAATAAAGAGACAAT

>In-frame_ITFG1_ENST00000544001_chr16_47345151_-_SLC45A2_ENST00000342059_chr5_33964121_-_2082nt
ACTGTCGGGAGGCGCGCCTGCCGGAAGTGAGCGTGAGGGCGGCTTTCACCCTAGCTCCACTGCTTTTTTAGCGTCGGAAGGGCAGCCCTA
GTGGGAGAGAGAAAAAGGAGCCGGCAGCGGCTCTTACGCGTCCCGGGGCTGCGCGCCACTCTCTCGGCCGGAAATGACTTAATCGTCTTT
TTGGCAGACCAGAATGCACCCTATTTTAAACCCAAAGTAAAGGTATCTTTCAAGAATCACAGTGCATTGATAACAAGTGTAGTCCCTGGG
GATTATGATGGAGATTCTCAAATGGATGTCCTTCTGACATATCTTCCCAAAAATTATGCCAAGAGTGAATTAGGAGCTGTTATCTTCTGG
GGACAAAATCAAACATTAGATCCTAACAATATGACCATACTCAATAGGACTTTTCAAGATGAGCCACTAATTATGGATTTCAATGGTGAT
CTAATTCCTGATATTTTTGGTATCACAAATGAATCCAACCAGCCACAGATACTATTAGGAGGGAATTTATCATGGCATCCAGCATTGACC
ACTACAAGTAAAATGCGAATTCCACATTCTCATGCATTTATTGATCTGACTGAAGATTTTACAGCAGATTTATTCCTGACGACATTGAAT
GCCACCACTAGTACCTTCCAGTTTGAAATATGGGAAAATTTGGATGGAAACTTCTCTGTCAGTACTATATTGGAAAAACCTCAAAATATG
ATGGTGGTTGGACAGTCAGCATTTGCAGACTTTGATGGAGATGGACACATGGATCATTTACTGCCAGGCTGTGAAGATAAAAATTGCCAA
AAGAGTACCATCTACTTAGTGAGATCTGGGATGAAGCAGTGGGTTCCAGTCCTACAAGATTTCAGCAATAAGGGCACACTCTGGGGCTTT
GTGCCATTTGTGGATGAACAGCAACCAACTGAAATACCAATTCCAATTACCCTTCATATTGGAGACTACAATATGGATGGCTATCCAGAC
GCTCTGGTCATACTAAAGAACACATCTGGAAGGTTTTGGAGGTGCCCTGGGTTACCTTTTGGGTGCTATAGACTGGGCCCATCTGGAGCT
GGGAAGACTGTTGGGTACAGAATTCCAGGTCATGTTCTTCTTCTCTGCATTGGTGCTCACTTTGTGTTTTACTGTTCATCTGTGCAGTAT
CTCTGAAGCCCCACTTACAGAGGTTGCAAAGGGCATTCCCCCACAGCAAACCCCTCAGGACCCTCCATTGTCATCAGATGGAATGTACGA
GTATGGTTCTATCGAGAAAGTTAAAAATGGTTACGTAAATCCAGAGCTGGCAATGCAGGGAGCAAAAAACAAAAATCATGCTGAACAGAC
TCGCAGGGCAATGACATTAAAGTCACTGCTGAGAGCACTGGTGAACATGCCTCCTCACTACCGCTACCTTTGCATCAGCCACCTCATTGG
ATGGACAGCCTTCCTGTCCAACATGCTGTTCTTCACAGATTTCATGGGCCAGATTGTGTACCGCGGGGATCCCTATAGTGCACACAACTC
CACAGAGTTTCTCATCTACGAAAGAGGAGTCGAGGTTGGATGTTGGGGCTTGTGCATCAACTCCGTGTTTTCCTCACTTTATTCTTACTT
TCAGAAAGTTTTGGTATCCTACATTGGATTAAAGGGTCTTTACTTCACGGGATATTTGCTGTTTGGCCTGGGGACGGGATTTATTGGGCT
CTTCCCGAATGTCTACTCCACCCTGGTCCTGTGCAGCCTGTTTGGTGTAATGTCCAGCACCCTGTACACTGTGCCCTTTAACCTCATTAC
TGAGTACCACCGCGAGGAAGAAAAGGAGAGGCAGCAGGCCCCAGGAGGGGACCCAGACAACAGCGTGAGAGGGAAGGGCATGGACTGCGC
CACCCTCACATGCATGGTGCAGCTGGCTCAGATCCTGGTCGGAGGTGGCCTGGGCTTTCTGGTCAACACAGCCGGGACCGTTGTCGTCGT
GGTGATCACAGCGTCTGCGGTGGCACTGATAGGCTGTTGCTTTGTCGCTCTCTTTGTTAGATATGTGGATTAGGTCAATAAAGAGACAAT

>In-frame_ITFG1_ENST00000544001_chr16_47345151_-_SLC45A2_ENST00000382102_chr5_33964121_-_3125nt
ACTGTCGGGAGGCGCGCCTGCCGGAAGTGAGCGTGAGGGCGGCTTTCACCCTAGCTCCACTGCTTTTTTAGCGTCGGAAGGGCAGCCCTA
GTGGGAGAGAGAAAAAGGAGCCGGCAGCGGCTCTTACGCGTCCCGGGGCTGCGCGCCACTCTCTCGGCCGGAAATGACTTAATCGTCTTT
TTGGCAGACCAGAATGCACCCTATTTTAAACCCAAAGTAAAGGTATCTTTCAAGAATCACAGTGCATTGATAACAAGTGTAGTCCCTGGG
GATTATGATGGAGATTCTCAAATGGATGTCCTTCTGACATATCTTCCCAAAAATTATGCCAAGAGTGAATTAGGAGCTGTTATCTTCTGG
GGACAAAATCAAACATTAGATCCTAACAATATGACCATACTCAATAGGACTTTTCAAGATGAGCCACTAATTATGGATTTCAATGGTGAT
CTAATTCCTGATATTTTTGGTATCACAAATGAATCCAACCAGCCACAGATACTATTAGGAGGGAATTTATCATGGCATCCAGCATTGACC
ACTACAAGTAAAATGCGAATTCCACATTCTCATGCATTTATTGATCTGACTGAAGATTTTACAGCAGATTTATTCCTGACGACATTGAAT
GCCACCACTAGTACCTTCCAGTTTGAAATATGGGAAAATTTGGATGGAAACTTCTCTGTCAGTACTATATTGGAAAAACCTCAAAATATG
ATGGTGGTTGGACAGTCAGCATTTGCAGACTTTGATGGAGATGGACACATGGATCATTTACTGCCAGGCTGTGAAGATAAAAATTGCCAA
AAGAGTACCATCTACTTAGTGAGATCTGGGATGAAGCAGTGGGTTCCAGTCCTACAAGATTTCAGCAATAAGGGCACACTCTGGGGCTTT
GTGCCATTTGTGGATGAACAGCAACCAACTGAAATACCAATTCCAATTACCCTTCATATTGGAGACTACAATATGGATGGCTATCCAGAC
GCTCTGGTCATACTAAAGAACACATCTGGAAGGTTTTGGAGGTGCCCTGGGTTACCTTTTGGGTGCTATAGACTGGGCCCATCTGGAGCT
GGGAAGACTGTTGGGTACAGAATTCCAGGTCATGTTCTTCTTCTCTGCATTGGTGCTCACTTTGTGTTTTACTGTTCATCTGTGCAGTAT
CTCTGAAGCCCCACTTACAGAGGTTGCAAAGGGCATTCCCCCACAGCAAACCCCTCAGGACCCTCCATTGTCATCAGATGGAATGTACGA
GTATGGTTCTATCGAGAAAGTTAAAAATGGTTACGTAAATCCAGAGCTGGCAATGCAGGGAGCAAAAAACAAAAATCATGCTGAACAGAC
TCGCAGGGCAATGACATTAAAGTCACTGCTGAGAGCACTGGTGAACATGCCTCCTCACTACCGCTACCTTTGCATCAGCCACCTCATTGG
ATGGACAGCCTTCCTGTCCAACATGCTGTTCTTCACAGATTTCATGGGCCAGATTGTGTACCGCGGGGATCCCTATAGTGCACACAACTC
CACAGAGTTTCTCATCTACGAAAGAGGAGTCGAGGTTGGATGTTGGGGCTTGTGCATCAACTCCGTGTTTTCCTCACTTTATTCTTACTT
TCAGAAAGTTTTGGTATCCTACATTGGATTAAAGGGTCTTTACTTCACGGGATATTTGCTGTTTGGCCTGGGGACGGGATTTATTGGGCT
CTTCCCGAATGTCTACTCCACCCTGGTCCTGTGCAGCCTGTTTGGTGTAATGTCCAGCACCCTGTACACTGTGCCCTTTAACCTCATTAC
TGAGTACCACCGCGAGGAAGAAAAGGAGGTGTGCTGTCATTGAACCTCTGCCTTGGGTAACATCCAGACTCATCTGAAGGCTGGGGAGGA
TTTGGTAGCAATGTGTAGAGCAGAGCTGGAAAATAAGGGTTCTTGAAACAGCAACAGTCAAATGCCCAACCAACTGCAACCATGATCTGG
TACAGGCATGCTCACCAGCCCAGCCCAGCCCAGCTGTCCTGTCCTCCTTATTCTCAACTCCTGCTCACTTAGGGAGCTGTAGGGCAAGAA
GTGTTACTCCCATTTTTCTAATTAGAAAAAGGCTTGGTGAGGCTGAGAAACCAGCCCACAATTACACAAAGACAAAAAAAGGGGGACCCA
GGTCTTCTGTAACCACCTCATAGGTCTCCCTGGTGCCACCTGCAGCATTTCTAGATACCGACAATAAGGGTCTCCCTATCCCCAACTTTC
AGAGGTACATAGTGGAATTTCTTGGCATTATTTGCTGAGGGTAGGAAAGTCCTAGGCAATGGAGTCCAGATTTTAGTAAGTCAGACCCCA
TGTGTGAGAAGGAAAGCTGGAATCATGGGTGGTAATCCCCACTTTGCTGCCCTGAGCGGGACCTGTGCCATTTAAACCTTGGAACGCAAC
TAGTGAACAAGCGCCTATGCAGTGCTTATAACAGAGTTGGTGTTTCCACTCTAAAATTACCACCTCTTCTTATCAAAATTTGCAACTTTC
TTCCTGTGAAAATAGGCTTATAGTTCCTTAACTGGAGCAATGATATAAAAGCTACAGAGATAACTCCAAGTTTAATCCAGCTCAGCATGA
AACTGCAAAAACACTGAACATATAACCATCAGACTATAATTCTGGCCATGTTTTTCATCATTTGATCTGGCAGCAGGGCAGAGGTGCACC
AGGAGTAAAAACCTTTCAAAAAAGAGGTGTGGCTTTCCTCATCCCCTGGCAAACATTGTCACCAAGGTGGGATGTTGCTGCTAATGGGAG
AGTCATCATAAAAAACTGTCCCTACAAGGAGAGTGTTACATGGTGTTGGGGGAAGAAAACCTACGCTTCAGGCTCAGAGAAACCTGGATT
CAAATCCTGCCTCTCTCACTTGGAAGCTGTGTTACACTGGGGATGTTATTTACTTGTTTATTAGTTAGCACTTAGAATGAGTTCATTTTT
AGGTGAGATAATATATTCACAATGATACACAAAAGTGCACACTGTGTGCTCCCTTTACCATTTACTATCTCCCTCCAGCCCCAACGTGTT


Top

FusionGenePPI for ITFG1_SLC45A2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ITFG1HMOX2, MRPL44, CDC73, SERBP1, TAF1D, NUDT3, FAM118B, TNFRSF14, FBXO6, HLA-DPA1, CD1B, CEACAM21, HLA-C, PCDHGB1, TMEM30B, CDH5SLC45A2GAPDHS, EGFR, SQRDL, UBB, ATG9A, CYHR1, FAM63A, PCNXL3, ATP2B2, MID1IP1, GTF2E1, AMFR, TMEM63A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ITFG1_SLC45A2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ITFG1_SLC45A2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSLC45A2C1847836Oculocutaneous Albinism, Type IV5CTD_human;ORPHANET;UNIPROT
TgeneSLC45A2C0025202melanoma2CTD_human
TgeneSLC45A2C0007117Basal cell carcinoma1CTD_human
TgeneSLC45A2C0007137Squamous cell carcinoma1CTD_human
TgeneSLC45A2C0236969Substance-Related Disorders1CTD_human