FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 17630

FusionGeneSummary for IPO11_SLC6A19

check button Fusion gene summary
Fusion gene informationFusion gene name: IPO11_SLC6A19
Fusion gene ID: 17630
HgeneTgene
Gene symbol

IPO11

SLC6A19

Gene ID

51194

340024

Gene nameimportin 11solute carrier family 6 member 19
SynonymsRanBP11B0AT1|HND
Cytomap

5q12.1

5p15.33

Type of geneprotein-codingprotein-coding
Descriptionimportin-11Ran binding protein 11imp11ran-binding protein 11sodium-dependent neutral amino acid transporter B(0)AT1sodium-dependent amino acid transporter system B0solute carrier family 6 (neurotransmitter transporter), member 19solute carrier family 6 (neutral amino acid transporter), member 19system B(0) neu
Modification date2018052320180523
UniProtAcc

Q9UI26

Q695T7

Ensembl transtripts involved in fusion geneENST00000325324, ENST00000409296, 
ENST00000409534, ENST00000512177, 
ENST00000304460, 
Fusion gene scores* DoF score6 X 6 X 4=1445 X 3 X 5=75
# samples 65
** MAII scorelog2(6/144*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: IPO11 [Title/Abstract] AND SLC6A19 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDKIRPTCGA-P4-A5EB-01AIPO11chr5

61772580

+SLC6A19chr5

1219018

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000325324ENST00000304460IPO11chr5

61772580

+SLC6A19chr5

1219018

+
In-frameENST00000409296ENST00000304460IPO11chr5

61772580

+SLC6A19chr5

1219018

+
intron-3CDSENST00000409534ENST00000304460IPO11chr5

61772580

+SLC6A19chr5

1219018

+
intron-3CDSENST00000512177ENST00000304460IPO11chr5

61772580

+SLC6A19chr5

1219018

+

Top

FusionProtFeatures for IPO11_SLC6A19


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
IPO11

Q9UI26

SLC6A19

Q695T7

Functions in nuclear protein import as nuclear transportreceptor. Serves as receptor for nuclear localization signals(NLS) in cargo substrates. Is thought to mediate docking of theimportin/substrate complex to the nuclear pore complex (NPC)through binding to nucleoporin and the complex is subsequentlytranslocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ranbinds to the importin, the importin/substrate complex dissociatesand importin is re-exported from the nucleus to the cytoplasmwhere GTP hydrolysis releases Ran. The directionality of nuclearimport is thought to be conferred by an asymmetric distribution ofthe GTP- and GDP-bound forms of Ran between the cytoplasm andnucleus (By similarity). Mediates the nuclear import of UBE2E3,and of RPL12 (By similarity). {ECO:0000250,ECO:0000269|PubMed:11032817}. Transporter that mediates resorption of neutral aminoacids across the apical membrane of renal and intestinalepithelial cells. This uptake is sodium-dependent and chloride-independent. {ECO:0000269|PubMed:15286788}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+93028_100276976DomainImportin N-terminal
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+93028_1003161016DomainImportin N-terminal
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930123_160276976RepeatNote=HEAT 1
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930209_248276976RepeatNote=HEAT 2
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930123_1603161016RepeatNote=HEAT 1
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930209_2483161016RepeatNote=HEAT 2
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712435_456391635Topological domainCytoplasmic
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712478_490391635Topological domainExtracellular
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712512_531391635Topological domainCytoplasmic
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712553_581391635Topological domainExtracellular
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712603_634391635Topological domainCytoplasmic
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712414_434391635TransmembraneHelical%3B Name%3D8
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712457_477391635TransmembraneHelical%3B Name%3D9
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712491_511391635TransmembraneHelical%3B Name%3D10
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712532_552391635TransmembraneHelical%3B Name%3D11
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712582_602391635TransmembraneHelical%3B Name%3D12

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930318_356276976RepeatNote=HEAT 3
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930422_459276976RepeatNote=HEAT 4
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930473_509276976RepeatNote=HEAT 5
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930511_548276976RepeatNote=HEAT 6
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930555_593276976RepeatNote=HEAT 7
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930600_636276976RepeatNote=HEAT 8
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930640_677276976RepeatNote=HEAT 9
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930683_720276976RepeatNote=HEAT 10
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930743_764276976RepeatNote=HEAT 11
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930765_804276976RepeatNote=HEAT 12
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930819_849276976RepeatNote=HEAT 13
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930850_887276976RepeatNote=HEAT 14
HgeneIPO11chr5:61772580chr5:1219018ENST00000325324+930957_974276976RepeatNote=HEAT 15
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930318_3563161016RepeatNote=HEAT 3
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930422_4593161016RepeatNote=HEAT 4
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930473_5093161016RepeatNote=HEAT 5
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930511_5483161016RepeatNote=HEAT 6
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930555_5933161016RepeatNote=HEAT 7
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930600_6363161016RepeatNote=HEAT 8
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930640_6773161016RepeatNote=HEAT 9
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930683_7203161016RepeatNote=HEAT 10
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930743_7643161016RepeatNote=HEAT 11
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930765_8043161016RepeatNote=HEAT 12
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930819_8493161016RepeatNote=HEAT 13
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930850_8873161016RepeatNote=HEAT 14
HgeneIPO11chr5:61772580chr5:1219018ENST00000409296+930957_9743161016RepeatNote=HEAT 15
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712142_192391635Topological domainExtracellular
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+7121_41391635Topological domainCytoplasmic
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712214_221391635Topological domainCytoplasmic
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712243_268391635Topological domainExtracellular
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712290_304391635Topological domainCytoplasmic
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712326_413391635Topological domainExtracellular
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+71263_67391635Topological domainExtracellular
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+71289_120391635Topological domainCytoplasmic
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712121_141391635TransmembraneHelical%3B Name%3D3
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712193_213391635TransmembraneHelical%3B Name%3D4
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712222_242391635TransmembraneHelical%3B Name%3D5
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712269_289391635TransmembraneHelical%3B Name%3D6
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+712305_325391635TransmembraneHelical%3B Name%3D7
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+71242_62391635TransmembraneHelical%3B Name%3D1
TgeneSLC6A19chr5:61772580chr5:1219018ENST00000304460+71268_88391635TransmembraneHelical%3B Name%3D2


Top

FusionGeneSequence for IPO11_SLC6A19


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_IPO11_ENST00000325324_chr5_61772580_+_SLC6A19_ENST00000304460_chr5_1219018_+_520aa
MDLNSASTVVLQVLTQATSQDTAVLKPAEEQLKQWETQPGFYSVLLNIFTNHTLDINVRWLAVLYFKHGIDRYWRRVAPHALSEEEKTTL
RAGLITNFNEPINQIATQIAVLIAKVARLDCPRQWPELIPTLIESVKVQDDLRQHRALLTFYHVTKTLASKRLAADRKLFYDLASGIYNF
ACSLWNHHTDTFLQEVSSGNEAAILSSLERTLLSLKVLRKLTVNGFVEPHKNMEVMGFLHGIFERLKQFLECSRSIGTDNVCRDRLEKTI
ILFTKVAVEGTGLAFIVFTEAITKMPLSPLWSVLFFIMLFCLGLSSMFGNMEGVVVPLQDLRVIPPKWPKEVLTGLICLGTFLIGFIFTL
NSGQYWLSLLDSYAGSIPLLIIAFCEMFSVVYVYGVDRFNKDIEFMIGHKPNIFWQVTWRVVSPLLMLIIFLFFFVVEVSQELTYSIWDP

>In-frame_IPO11_ENST00000409296_chr5_61772580_+_SLC6A19_ENST00000304460_chr5_1219018_+_560aa
MVQPIIHLGYVVYSLLYLGYKPVQHVTALNTVSSCHKMVSMDLNSASTVVLQVLTQATSQDTAVLKPAEEQLKQWETQPGFYSVLLNIFT
NHTLDINVRWLAVLYFKHGIDRYWRRVAPHALSEEEKTTLRAGLITNFNEPINQIATQIAVLIAKVARLDCPRQWPELIPTLIESVKVQD
DLRQHRALLTFYHVTKTLASKRLAADRKLFYDLASGIYNFACSLWNHHTDTFLQEVSSGNEAAILSSLERTLLSLKVLRKLTVNGFVEPH
KNMEVMGFLHGIFERLKQFLECSRSIGTDNVCRDRLEKTIILFTKVAVEGTGLAFIVFTEAITKMPLSPLWSVLFFIMLFCLGLSSMFGN
MEGVVVPLQDLRVIPPKWPKEVLTGLICLGTFLIGFIFTLNSGQYWLSLLDSYAGSIPLLIIAFCEMFSVVYVYGVDRFNKDIEFMIGHK
PNIFWQVTWRVVSPLLMLIIFLFFFVVEVSQELTYSIWDPGYEEFPKSQKISYPNWVYVVVVIVAGVPSLTIPGYAIYKLIRNHCQKPGD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_IPO11_ENST00000325324_chr5_61772580_+_SLC6A19_ENST00000304460_chr5_1219018_+_1560nt
ATGGATCTCAATAGTGCCAGCACTGTTGTTCTTCAGGTGTTAACACAGGCCACCAGTCAGGATACTGCTGTGTTAAAACCAGCTGAGGAG
CAGTTGAAGCAGTGGGAGACACAGCCAGGTTTCTATTCAGTGTTGCTGAATATTTTCACCAACCACACTTTGGATATAAATGTAAGGTGG
CTTGCTGTACTGTATTTTAAACATGGAATTGATCGCTACTGGAGACGTGTAGCACCTCATGCTCTCTCAGAGGAGGAGAAAACTACTCTG
CGTGCAGGGCTCATCACCAACTTCAATGAACCAATAAACCAGATTGCAACTCAGATTGCAGTGCTCATTGCAAAAGTTGCTAGATTGGAT
TGTCCCAGACAGTGGCCTGAACTAATTCCCACTCTTATAGAGTCTGTTAAAGTCCAGGATGATCTTCGACAGCACAGAGCATTACTTACC
TTCTATCATGTTACCAAGACACTGGCATCTAAACGACTTGCTGCTGATAGAAAACTATTTTATGATTTAGCTTCTGGAATTTATAATTTT
GCCTGCTCTCTGTGGAATCACCACACAGACACATTCCTGCAAGAAGTTTCTTCTGGCAATGAAGCTGCAATTTTGAGTTCACTAGAACGA
ACACTGCTATCATTGAAAGTGCTGCGTAAGTTAACTGTTAATGGATTTGTGGAACCTCATAAGAATATGGAGGTGATGGGTTTTTTACAT
GGAATATTTGAACGTCTAAAACAGTTTCTGGAATGCAGTAGAAGTATAGGTACAGATAATGTGTGTAGAGATAGACTGGAAAAGACCATC
ATTCTTTTTACTAAAGTGGCCGTGGAGGGCACAGGCCTGGCCTTCATCGTCTTCACCGAGGCCATCACCAAGATGCCGTTGTCCCCACTG
TGGTCTGTGCTCTTCTTCATTATGCTCTTCTGCCTGGGGCTGTCATCTATGTTTGGGAACATGGAGGGCGTCGTTGTGCCCCTGCAGGAC
CTCAGAGTCATCCCCCCGAAGTGGCCCAAGGAGGTGCTCACAGGCCTCATCTGCCTGGGGACATTCCTCATTGGCTTCATCTTCACGCTG
AACTCCGGCCAGTACTGGCTCTCCCTGCTGGACAGCTATGCCGGCTCCATTCCCCTGCTCATCATCGCCTTCTGCGAGATGTTCTCTGTG
GTCTACGTGTACGGTGTGGACAGGTTCAATAAGGACATCGAGTTCATGATCGGCCACAAGCCCAACATCTTCTGGCAAGTCACGTGGCGC
GTGGTCAGCCCCCTGCTCATGCTGATCATCTTCCTCTTCTTCTTCGTGGTAGAGGTCAGTCAGGAGCTGACCTACAGCATCTGGGACCCT
GGCTACGAGGAATTTCCCAAATCCCAGAAGATCTCCTACCCGAACTGGGTGTATGTGGTGGTGGTGATTGTGGCTGGAGTGCCCTCCCTC
ACCATCCCTGGCTATGCCATCTACAAGCTCATCAGGAACCACTGCCAGAAGCCAGGGGACCATCAGGGGCTGGTGAGCACACTGTCCACA

>In-frame_IPO11_ENST00000409296_chr5_61772580_+_SLC6A19_ENST00000304460_chr5_1219018_+_1680nt
ATGGTACAGCCTATTATACACTTGGGCTATGTGGTATATAGCTTATTGTATCTAGGCTATAAGCCTGTACAGCATGTTACTGCACTGAAT
ACTGTAAGCAGTTGTCACAAAATGGTTTCCATGGATCTCAATAGTGCCAGCACTGTTGTTCTTCAGGTGTTAACACAGGCCACCAGTCAG
GATACTGCTGTGTTAAAACCAGCTGAGGAGCAGTTGAAGCAGTGGGAGACACAGCCAGGTTTCTATTCAGTGTTGCTGAATATTTTCACC
AACCACACTTTGGATATAAATGTAAGGTGGCTTGCTGTACTGTATTTTAAACATGGAATTGATCGCTACTGGAGACGTGTAGCACCTCAT
GCTCTCTCAGAGGAGGAGAAAACTACTCTGCGTGCAGGGCTCATCACCAACTTCAATGAACCAATAAACCAGATTGCAACTCAGATTGCA
GTGCTCATTGCAAAAGTTGCTAGATTGGATTGTCCCAGACAGTGGCCTGAACTAATTCCCACTCTTATAGAGTCTGTTAAAGTCCAGGAT
GATCTTCGACAGCACAGAGCATTACTTACCTTCTATCATGTTACCAAGACACTGGCATCTAAACGACTTGCTGCTGATAGAAAACTATTT
TATGATTTAGCTTCTGGAATTTATAATTTTGCCTGCTCTCTGTGGAATCACCACACAGACACATTCCTGCAAGAAGTTTCTTCTGGCAAT
GAAGCTGCAATTTTGAGTTCACTAGAACGAACACTGCTATCATTGAAAGTGCTGCGTAAGTTAACTGTTAATGGATTTGTGGAACCTCAT
AAGAATATGGAGGTGATGGGTTTTTTACATGGAATATTTGAACGTCTAAAACAGTTTCTGGAATGCAGTAGAAGTATAGGTACAGATAAT
GTGTGTAGAGATAGACTGGAAAAGACCATCATTCTTTTTACTAAAGTGGCCGTGGAGGGCACAGGCCTGGCCTTCATCGTCTTCACCGAG
GCCATCACCAAGATGCCGTTGTCCCCACTGTGGTCTGTGCTCTTCTTCATTATGCTCTTCTGCCTGGGGCTGTCATCTATGTTTGGGAAC
ATGGAGGGCGTCGTTGTGCCCCTGCAGGACCTCAGAGTCATCCCCCCGAAGTGGCCCAAGGAGGTGCTCACAGGCCTCATCTGCCTGGGG
ACATTCCTCATTGGCTTCATCTTCACGCTGAACTCCGGCCAGTACTGGCTCTCCCTGCTGGACAGCTATGCCGGCTCCATTCCCCTGCTC
ATCATCGCCTTCTGCGAGATGTTCTCTGTGGTCTACGTGTACGGTGTGGACAGGTTCAATAAGGACATCGAGTTCATGATCGGCCACAAG
CCCAACATCTTCTGGCAAGTCACGTGGCGCGTGGTCAGCCCCCTGCTCATGCTGATCATCTTCCTCTTCTTCTTCGTGGTAGAGGTCAGT
CAGGAGCTGACCTACAGCATCTGGGACCCTGGCTACGAGGAATTTCCCAAATCCCAGAAGATCTCCTACCCGAACTGGGTGTATGTGGTG
GTGGTGATTGTGGCTGGAGTGCCCTCCCTCACCATCCCTGGCTATGCCATCTACAAGCTCATCAGGAACCACTGCCAGAAGCCAGGGGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_IPO11_ENST00000325324_chr5_61772580_+_SLC6A19_ENST00000304460_chr5_1219018_+_4942nt
TTTGGAGCTGCGACGCCAAACATGGCGTGTTCCTAGAAGCCGCTTTCGGCATCAGTAGGCGGCGGCGTGGGGTCTGGCAGCGTGGGGAGA
GGGACCAACCGACGCCACTTCGTGTTGGGAAGTGGGAGCGGGAGGGCCGGGCAATTCCCGACCGAACCAAACGGTTTCCATGGATCTCAA
TAGTGCCAGCACTGTTGTTCTTCAGGTGTTAACACAGGCCACCAGTCAGGATACTGCTGTGTTAAAACCAGCTGAGGAGCAGTTGAAGCA
GTGGGAGACACAGCCAGGTTTCTATTCAGTGTTGCTGAATATTTTCACCAACCACACTTTGGATATAAATGTAAGGTGGCTTGCTGTACT
GTATTTTAAACATGGAATTGATCGCTACTGGAGACGTGTAGCACCTCATGCTCTCTCAGAGGAGGAGAAAACTACTCTGCGTGCAGGGCT
CATCACCAACTTCAATGAACCAATAAACCAGATTGCAACTCAGATTGCAGTGCTCATTGCAAAAGTTGCTAGATTGGATTGTCCCAGACA
GTGGCCTGAACTAATTCCCACTCTTATAGAGTCTGTTAAAGTCCAGGATGATCTTCGACAGCACAGAGCATTACTTACCTTCTATCATGT
TACCAAGACACTGGCATCTAAACGACTTGCTGCTGATAGAAAACTATTTTATGATTTAGCTTCTGGAATTTATAATTTTGCCTGCTCTCT
GTGGAATCACCACACAGACACATTCCTGCAAGAAGTTTCTTCTGGCAATGAAGCTGCAATTTTGAGTTCACTAGAACGAACACTGCTATC
ATTGAAAGTGCTGCGTAAGTTAACTGTTAATGGATTTGTGGAACCTCATAAGAATATGGAGGTGATGGGTTTTTTACATGGAATATTTGA
ACGTCTAAAACAGTTTCTGGAATGCAGTAGAAGTATAGGTACAGATAATGTGTGTAGAGATAGACTGGAAAAGACCATCATTCTTTTTAC
TAAAGTGGCCGTGGAGGGCACAGGCCTGGCCTTCATCGTCTTCACCGAGGCCATCACCAAGATGCCGTTGTCCCCACTGTGGTCTGTGCT
CTTCTTCATTATGCTCTTCTGCCTGGGGCTGTCATCTATGTTTGGGAACATGGAGGGCGTCGTTGTGCCCCTGCAGGACCTCAGAGTCAT
CCCCCCGAAGTGGCCCAAGGAGGTGCTCACAGGCCTCATCTGCCTGGGGACATTCCTCATTGGCTTCATCTTCACGCTGAACTCCGGCCA
GTACTGGCTCTCCCTGCTGGACAGCTATGCCGGCTCCATTCCCCTGCTCATCATCGCCTTCTGCGAGATGTTCTCTGTGGTCTACGTGTA
CGGTGTGGACAGGTTCAATAAGGACATCGAGTTCATGATCGGCCACAAGCCCAACATCTTCTGGCAAGTCACGTGGCGCGTGGTCAGCCC
CCTGCTCATGCTGATCATCTTCCTCTTCTTCTTCGTGGTAGAGGTCAGTCAGGAGCTGACCTACAGCATCTGGGACCCTGGCTACGAGGA
ATTTCCCAAATCCCAGAAGATCTCCTACCCGAACTGGGTGTATGTGGTGGTGGTGATTGTGGCTGGAGTGCCCTCCCTCACCATCCCTGG
CTATGCCATCTACAAGCTCATCAGGAACCACTGCCAGAAGCCAGGGGACCATCAGGGGCTGGTGAGCACACTGTCCACAGCCTCCATGAA
CGGGGACCTGAAGTACTGAGAAGGCCCATCCCACGGCGTGCCATACACTGGTGTCAGGGAAGGAGGAACCAGCAAGACCTGTGGGGTGGG
GGCCGGGCTGCACCTGCATGTGTGTAAGCGTGAGTGTATGCTCGTGTGTGAGTGTGTGTATTGTACACGCATGTGCCATGTGTGCAGATA
TGTATCGTGTGTGCATGTACATGCATGGGCACTGTGTGAGTGTGCACGTGTATGCACACATATACATGTGTGTGGGTGTGTGTATTGTAT
GTGCATGTGCCATGTGTGCAGATGTGTCATGTTGTGTGTGTGCATGTACATGTATGGACATTGTGTGAGTGTGCAAGTGTGCATGCATAT
ACATGTGTGCGATATTTGCTGCCCGTGTGTGTGCATGTATATATAGACATACATGCCTATGTTGTGTGTGGTGTGCATATGTGTGAACAC
ACACGTGTATACATGCATGCACATGTGCTCGTACAATGGGTGTCCACATGCACGTGTATATGTATATCTGTGAGTGTATATACATGCATG
CAATTGTGTGTATGTGTGTTCTGTGTGTGCGTTTGCAAGTATATATGCACATGTGTATATGTACATGTATGCCTGTGTGACGTGTGTATA
TGTGAGCATGTGTACGTGTGTGTATACGTGTGTTGTGTATATGTGTGTGTCTGTACCTGTTTGTGTATATGTGTGTGATGTGTGCTCGTG
TGTGTGCATATTCAGGCAGGTGTGCATTTGTGCATGCCAGTGTGTATGTATGTGCGCATATGGACACGCATGGACACGCATATGGACACA
TATGGACACACATATGGACACGTGTGGATATGTGTGCGTACACGTCGCTGGGACACATGCCTGCCACTCGGGGCCCAGCTGCCCTCTGTG
TTTGTCCTTGCCACAGTCACGGGGTGCATGTGCAGAGGGGAGCAGACCACTGGGGACGTGCTGTGCCCTGCACGTGCCCGGGGGAAGCGG
AAGCTGCAGCTGGGGTGGGGGCAGCACCTCTATGCTTCATCTCTGTGGGTGGCAGGAGACAAAAGCACAGGGTACTATCTTGGCTCCTGG
GAGCGACTCTTGCTACCCACCCCCACCCATCCCCTTCCCCTTGGTGTTGACCTTTGACCTGGGGGTTCCCAGAGCCCTGTAGCCCTCGAC
CCGGAGCAGCCTCTCGGAAGCCGGAGTGGGCAGTTGCTGGCGATTCTGAGAAAACTTGGCCGCATCCACCGGGGCCCTGCCTCCAGTCGG
CCGCTGCCGAGTCTCTGCGTTCTGGCCGCTTCCCGGCTTAATGAATGCCAGCCATTTAATCATTGCTCCTGCCACCACAAATAGATGAGC
AGTTAAATAAAACTCAACTTGGCATAATTCAAGGCAAATACCACTCTGTGCATTTTCTTAAGAGGACATGAGCTGTGTGAATTTTTAGCC
AGCCTTTGGAAAAGATGGGTTACAGGGTAACTCAACCCTGGCTGCCATCCTTGGGCACTGTGTGTGTCCAGGGCACCTTGGAGGACCGTG
CAGCCCCCAGAAGCTTCCAGCTCCCGCACCACTCAGTGAAGCCCAGCCTGGCGCCTGCCCTGCCCCCGTCACGGGATGGGCCCCCATTGG
GGTTCAACATTCCATCGCAGCCAAAGGCAGTCGGCACTTGGGACATCTGCTTCCACGGACAGGTCACCTCCGCTTTGCACGGAAGAATCT
GGATGCTTACATTAAACTGGTGTTCTGAGAGTTCCTACGGACAGGTCACCTCCGCTTTGCATGGAAGAATCTGGATGCTTACATTAAACT
GGTGTTCTGAGAGTTCCTACGGACAGGTCACCTCTGCTTTCCATAGAAGAATCTGGACGCTTACATTAAACTGATGTTCTGAGAATTCCT
ACAGGCAGGACTGAAAGCCTGGTGTGTGCCAGTATGATGTTCCACCCACAGAAACCTGGTCACAATCGTCCCTTCCAGCACCCCATCCAG
CAGTGACTGCACACACTGAGTCCCCTACCAGCCCCTTTCACCCTGCTGACTGTCACTGGGCCCTGGGATGCGCAAGACTCCACAGCAGCA
GAGGTGGGGGGACATATCACAGCCTCTGCCCCCGGCTGTGATGCCACCGAGGGGCTCGCCTGCTGATGGCTTCAACAGGGTCTCACCTCA
TCTTTTCCTGCTCTTTGGCCCTGGATCGAGAAAATTTCCATCAGTGCCCCATTAATATGCTGCCCTGTGGCATCTGCCCAGGAGGCCCTG
CCAGGCGTGCACAGGTGTGCATTGGTGTACCCTGGCATGCACAGGTGTGCACTGATGTGCCCTGGCATCCATTGGTGTACCCTGGTGTGC
CTGCCATAGGACCCTGGGCGGGAGCTCCCATCTCATCTACATCTCCTGATTCATGCGTTGTTTCATAGGTTTCAATGTCTCTGTAAATGT
GGTAGAAATGCAGGCTTTATGGGCATAAAGTGTACATTTCTAAATAAATCCCTTCTATTGAGTATGCTCACCCTAGAAGTTACTGTTGTC
CAGACGTAGAGGGATGAGTGAGCCAGTGACCTCAGACGGGATGGTGGGGACGGCAGGTCCAGCTCCTGCCTCCTCCTGGGGGGTCTGGCT
TTGGGGGCTTGCTCCGAAGAGGCCATGGCCCAGGCCTGTGGCCTCACAATGGGGACCAACCAGCTCTTCTCATCTTCTTCCCTCACACTT
CCTCTCACTCAAATAAGAACCTTCCAAAAATGTGTCCACCTGGGCCCCTGCCCTGGGACTCATGGATTTGGAGTTGTGGCCACACGGTTG
AGGGGTGCAGTGTCCAGTGGAATGGGGCAATTGCGGGCCTGGGGGCCCTTGGCCTGTCCGTGGCGGGAGCATCTGCAAGGAGGAGCCCCA
GAGTCCAGGGAGCACTGTGGGGAGCTCCTTAGAGCTGAACTCACCCGGCGTCAACTCATCAACCCTCCACCCATGGACAGGGGTGCCCCC
AGCACAGGAGAGGACTCAGCCCTCTGCCCCCACGCACGGTGGGTGCCTGTCACCCTGTCCTGCCCAGCGGCCCGAGGGCAGCAGTGGGTG
TGAGGGCAGCCCCCGGCCTCCCAAGAGCAGCTGAGAGGATCCCTGCGGGAATCCGGGCTTCGGGTGCATGCGATCTGATCTGAGTTGTTT

>In-frame_IPO11_ENST00000409296_chr5_61772580_+_SLC6A19_ENST00000304460_chr5_1219018_+_5023nt
ATAGCACCAGGTGTGAAACTGCTGGGTCATAGAAGATACAGTCACGAGTTGCTTAAGGCTGGGATACATCCTGAGAAATGGGTCGTTAGG
CAATTTTGTTGTTCTATGAACATCATATGAACAAACCTAGATGGTACAGCCTATTATACACTTGGGCTATGTGGTATATAGCTTATTGTA
TCTAGGCTATAAGCCTGTACAGCATGTTACTGCACTGAATACTGTAAGCAGTTGTCACAAAATGGTTTCCATGGATCTCAATAGTGCCAG
CACTGTTGTTCTTCAGGTGTTAACACAGGCCACCAGTCAGGATACTGCTGTGTTAAAACCAGCTGAGGAGCAGTTGAAGCAGTGGGAGAC
ACAGCCAGGTTTCTATTCAGTGTTGCTGAATATTTTCACCAACCACACTTTGGATATAAATGTAAGGTGGCTTGCTGTACTGTATTTTAA
ACATGGAATTGATCGCTACTGGAGACGTGTAGCACCTCATGCTCTCTCAGAGGAGGAGAAAACTACTCTGCGTGCAGGGCTCATCACCAA
CTTCAATGAACCAATAAACCAGATTGCAACTCAGATTGCAGTGCTCATTGCAAAAGTTGCTAGATTGGATTGTCCCAGACAGTGGCCTGA
ACTAATTCCCACTCTTATAGAGTCTGTTAAAGTCCAGGATGATCTTCGACAGCACAGAGCATTACTTACCTTCTATCATGTTACCAAGAC
ACTGGCATCTAAACGACTTGCTGCTGATAGAAAACTATTTTATGATTTAGCTTCTGGAATTTATAATTTTGCCTGCTCTCTGTGGAATCA
CCACACAGACACATTCCTGCAAGAAGTTTCTTCTGGCAATGAAGCTGCAATTTTGAGTTCACTAGAACGAACACTGCTATCATTGAAAGT
GCTGCGTAAGTTAACTGTTAATGGATTTGTGGAACCTCATAAGAATATGGAGGTGATGGGTTTTTTACATGGAATATTTGAACGTCTAAA
ACAGTTTCTGGAATGCAGTAGAAGTATAGGTACAGATAATGTGTGTAGAGATAGACTGGAAAAGACCATCATTCTTTTTACTAAAGTGGC
CGTGGAGGGCACAGGCCTGGCCTTCATCGTCTTCACCGAGGCCATCACCAAGATGCCGTTGTCCCCACTGTGGTCTGTGCTCTTCTTCAT
TATGCTCTTCTGCCTGGGGCTGTCATCTATGTTTGGGAACATGGAGGGCGTCGTTGTGCCCCTGCAGGACCTCAGAGTCATCCCCCCGAA
GTGGCCCAAGGAGGTGCTCACAGGCCTCATCTGCCTGGGGACATTCCTCATTGGCTTCATCTTCACGCTGAACTCCGGCCAGTACTGGCT
CTCCCTGCTGGACAGCTATGCCGGCTCCATTCCCCTGCTCATCATCGCCTTCTGCGAGATGTTCTCTGTGGTCTACGTGTACGGTGTGGA
CAGGTTCAATAAGGACATCGAGTTCATGATCGGCCACAAGCCCAACATCTTCTGGCAAGTCACGTGGCGCGTGGTCAGCCCCCTGCTCAT
GCTGATCATCTTCCTCTTCTTCTTCGTGGTAGAGGTCAGTCAGGAGCTGACCTACAGCATCTGGGACCCTGGCTACGAGGAATTTCCCAA
ATCCCAGAAGATCTCCTACCCGAACTGGGTGTATGTGGTGGTGGTGATTGTGGCTGGAGTGCCCTCCCTCACCATCCCTGGCTATGCCAT
CTACAAGCTCATCAGGAACCACTGCCAGAAGCCAGGGGACCATCAGGGGCTGGTGAGCACACTGTCCACAGCCTCCATGAACGGGGACCT
GAAGTACTGAGAAGGCCCATCCCACGGCGTGCCATACACTGGTGTCAGGGAAGGAGGAACCAGCAAGACCTGTGGGGTGGGGGCCGGGCT
GCACCTGCATGTGTGTAAGCGTGAGTGTATGCTCGTGTGTGAGTGTGTGTATTGTACACGCATGTGCCATGTGTGCAGATATGTATCGTG
TGTGCATGTACATGCATGGGCACTGTGTGAGTGTGCACGTGTATGCACACATATACATGTGTGTGGGTGTGTGTATTGTATGTGCATGTG
CCATGTGTGCAGATGTGTCATGTTGTGTGTGTGCATGTACATGTATGGACATTGTGTGAGTGTGCAAGTGTGCATGCATATACATGTGTG
CGATATTTGCTGCCCGTGTGTGTGCATGTATATATAGACATACATGCCTATGTTGTGTGTGGTGTGCATATGTGTGAACACACACGTGTA
TACATGCATGCACATGTGCTCGTACAATGGGTGTCCACATGCACGTGTATATGTATATCTGTGAGTGTATATACATGCATGCAATTGTGT
GTATGTGTGTTCTGTGTGTGCGTTTGCAAGTATATATGCACATGTGTATATGTACATGTATGCCTGTGTGACGTGTGTATATGTGAGCAT
GTGTACGTGTGTGTATACGTGTGTTGTGTATATGTGTGTGTCTGTACCTGTTTGTGTATATGTGTGTGATGTGTGCTCGTGTGTGTGCAT
ATTCAGGCAGGTGTGCATTTGTGCATGCCAGTGTGTATGTATGTGCGCATATGGACACGCATGGACACGCATATGGACACATATGGACAC
ACATATGGACACGTGTGGATATGTGTGCGTACACGTCGCTGGGACACATGCCTGCCACTCGGGGCCCAGCTGCCCTCTGTGTTTGTCCTT
GCCACAGTCACGGGGTGCATGTGCAGAGGGGAGCAGACCACTGGGGACGTGCTGTGCCCTGCACGTGCCCGGGGGAAGCGGAAGCTGCAG
CTGGGGTGGGGGCAGCACCTCTATGCTTCATCTCTGTGGGTGGCAGGAGACAAAAGCACAGGGTACTATCTTGGCTCCTGGGAGCGACTC
TTGCTACCCACCCCCACCCATCCCCTTCCCCTTGGTGTTGACCTTTGACCTGGGGGTTCCCAGAGCCCTGTAGCCCTCGACCCGGAGCAG
CCTCTCGGAAGCCGGAGTGGGCAGTTGCTGGCGATTCTGAGAAAACTTGGCCGCATCCACCGGGGCCCTGCCTCCAGTCGGCCGCTGCCG
AGTCTCTGCGTTCTGGCCGCTTCCCGGCTTAATGAATGCCAGCCATTTAATCATTGCTCCTGCCACCACAAATAGATGAGCAGTTAAATA
AAACTCAACTTGGCATAATTCAAGGCAAATACCACTCTGTGCATTTTCTTAAGAGGACATGAGCTGTGTGAATTTTTAGCCAGCCTTTGG
AAAAGATGGGTTACAGGGTAACTCAACCCTGGCTGCCATCCTTGGGCACTGTGTGTGTCCAGGGCACCTTGGAGGACCGTGCAGCCCCCA
GAAGCTTCCAGCTCCCGCACCACTCAGTGAAGCCCAGCCTGGCGCCTGCCCTGCCCCCGTCACGGGATGGGCCCCCATTGGGGTTCAACA
TTCCATCGCAGCCAAAGGCAGTCGGCACTTGGGACATCTGCTTCCACGGACAGGTCACCTCCGCTTTGCACGGAAGAATCTGGATGCTTA
CATTAAACTGGTGTTCTGAGAGTTCCTACGGACAGGTCACCTCCGCTTTGCATGGAAGAATCTGGATGCTTACATTAAACTGGTGTTCTG
AGAGTTCCTACGGACAGGTCACCTCTGCTTTCCATAGAAGAATCTGGACGCTTACATTAAACTGATGTTCTGAGAATTCCTACAGGCAGG
ACTGAAAGCCTGGTGTGTGCCAGTATGATGTTCCACCCACAGAAACCTGGTCACAATCGTCCCTTCCAGCACCCCATCCAGCAGTGACTG
CACACACTGAGTCCCCTACCAGCCCCTTTCACCCTGCTGACTGTCACTGGGCCCTGGGATGCGCAAGACTCCACAGCAGCAGAGGTGGGG
GGACATATCACAGCCTCTGCCCCCGGCTGTGATGCCACCGAGGGGCTCGCCTGCTGATGGCTTCAACAGGGTCTCACCTCATCTTTTCCT
GCTCTTTGGCCCTGGATCGAGAAAATTTCCATCAGTGCCCCATTAATATGCTGCCCTGTGGCATCTGCCCAGGAGGCCCTGCCAGGCGTG
CACAGGTGTGCATTGGTGTACCCTGGCATGCACAGGTGTGCACTGATGTGCCCTGGCATCCATTGGTGTACCCTGGTGTGCCTGCCATAG
GACCCTGGGCGGGAGCTCCCATCTCATCTACATCTCCTGATTCATGCGTTGTTTCATAGGTTTCAATGTCTCTGTAAATGTGGTAGAAAT
GCAGGCTTTATGGGCATAAAGTGTACATTTCTAAATAAATCCCTTCTATTGAGTATGCTCACCCTAGAAGTTACTGTTGTCCAGACGTAG
AGGGATGAGTGAGCCAGTGACCTCAGACGGGATGGTGGGGACGGCAGGTCCAGCTCCTGCCTCCTCCTGGGGGGTCTGGCTTTGGGGGCT
TGCTCCGAAGAGGCCATGGCCCAGGCCTGTGGCCTCACAATGGGGACCAACCAGCTCTTCTCATCTTCTTCCCTCACACTTCCTCTCACT
CAAATAAGAACCTTCCAAAAATGTGTCCACCTGGGCCCCTGCCCTGGGACTCATGGATTTGGAGTTGTGGCCACACGGTTGAGGGGTGCA
GTGTCCAGTGGAATGGGGCAATTGCGGGCCTGGGGGCCCTTGGCCTGTCCGTGGCGGGAGCATCTGCAAGGAGGAGCCCCAGAGTCCAGG
GAGCACTGTGGGGAGCTCCTTAGAGCTGAACTCACCCGGCGTCAACTCATCAACCCTCCACCCATGGACAGGGGTGCCCCCAGCACAGGA
GAGGACTCAGCCCTCTGCCCCCACGCACGGTGGGTGCCTGTCACCCTGTCCTGCCCAGCGGCCCGAGGGCAGCAGTGGGTGTGAGGGCAG
CCCCCGGCCTCCCAAGAGCAGCTGAGAGGATCCCTGCGGGAATCCGGGCTTCGGGTGCATGCGATCTGATCTGAGTTGTTTCTGACAGTG


Top

FusionGenePPI for IPO11_SLC6A19


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
IPO11TRAF2, PLCD4, C20orf24, RPL12, DDX5, KEAP1, RAN, UBE2E1, UBE2E3, UBE2E2, NXF1, SH3GL2, CFTR, PHB, EGFR, FBXO6, MOB1A, MOB1B, AARS, CACYBP, DR1, EIF4A3, HNRNPD, HNRNPH1, AGFG1, ARPC1B, CALU, HSF1, LPP, METTL1, TPD52L2, TTLL12, UBE3A, PDLIM5, PKM, PLIN3, PRDX2, RANGAP1, SRP9, TPRKB, EIF4A2, C1orf94, ADORA3, COMTD1, BSG, TNFSF13B, PNKD, LPAR6, P2RY12, PTGER3, ARL13B, SCN2B, XPO1, NTRK1, CEP128, SIGLECL1, IL13RA2, HTR2C, FZD10, CHRM4, TMEM206, OPRM1, CD70, SLC15A1, APLNR, STOM, AAR2, TRIM25SLC6A19


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for IPO11_SLC6A19


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for IPO11_SLC6A19


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneIPO11C0001973Alcoholic Intoxication, Chronic1PSYGENET
HgeneIPO11C0043094Weight Gain1CTD_human
TgeneSLC6A19C0018609Hartnup Disease2CTD_human;ORPHANET;UNIPROT