FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 17040

FusionGeneSummary for IDS_PHACTR1

check button Fusion gene summary
Fusion gene informationFusion gene name: IDS_PHACTR1
Fusion gene ID: 17040
HgeneTgene
Gene symbol

IDS

PHACTR1

Gene ID

3423

221692

Gene nameiduronate 2-sulfatasephosphatase and actin regulator 1
SynonymsMPS2|SIDSRPEL|RPEL1|dJ257A7.2
Cytomap

Xq28

6p24.1

Type of geneprotein-codingprotein-coding
Descriptioniduronate 2-sulfatasealpha-L-iduronate sulfate sulfataseiduronate 2-sulfatase 14 kDa chainiduronate 2-sulfatase 42 kDa chainidursulfasephosphatase and actin regulator 1RPEL repeat containing 1
Modification date2018052320180519
UniProtAcc

P22304

Q9C0D0

Ensembl transtripts involved in fusion geneENST00000340855, ENST00000537071, 
ENST00000541269, ENST00000422081, 
ENST00000370441, ENST00000490775, 
ENST00000370443, ENST00000427113, 
ENST00000428056, 
ENST00000379350, 
ENST00000379348, ENST00000332995, 
ENST00000482982, ENST00000379345, 
ENST00000457702, ENST00000379335, 
ENST00000379329, 
Fusion gene scores* DoF score7 X 9 X 2=1269 X 8 X 8=576
# samples 910
** MAII scorelog2(9/126*10)=-0.485426827170242
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/576*10)=-2.52606881166759
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: IDS [Title/Abstract] AND PHACTR1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-TQ-A8XE-02AIDSchrX

148577877

-PHACTR1chr6

13160436

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000340855ENST00000379350IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000340855ENST00000379348IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000340855ENST00000332995IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-3UTRENST00000340855ENST00000482982IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-5UTRENST00000340855ENST00000379345IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-5UTRENST00000340855ENST00000457702IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000340855ENST00000379335IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000340855ENST00000379329IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-3CDSENST00000537071ENST00000379350IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-intronENST00000537071ENST00000379348IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-intronENST00000537071ENST00000332995IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-3UTRENST00000537071ENST00000482982IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-5UTRENST00000537071ENST00000379345IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-5UTRENST00000537071ENST00000457702IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-intronENST00000537071ENST00000379335IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-intronENST00000537071ENST00000379329IDSchrX

148577877

-PHACTR1chr6

13160436

+
In-frameENST00000541269ENST00000379350IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000541269ENST00000379348IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000541269ENST00000332995IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-3UTRENST00000541269ENST00000482982IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-5UTRENST00000541269ENST00000379345IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-5UTRENST00000541269ENST00000457702IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000541269ENST00000379335IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000541269ENST00000379329IDSchrX

148577877

-PHACTR1chr6

13160436

+
In-frameENST00000422081ENST00000379350IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000422081ENST00000379348IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000422081ENST00000332995IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-3UTRENST00000422081ENST00000482982IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-5UTRENST00000422081ENST00000379345IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-5UTRENST00000422081ENST00000457702IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000422081ENST00000379335IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000422081ENST00000379329IDSchrX

148577877

-PHACTR1chr6

13160436

+
Frame-shitENST00000370441ENST00000379350IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000370441ENST00000379348IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000370441ENST00000332995IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-3UTRENST00000370441ENST00000482982IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-5UTRENST00000370441ENST00000379345IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-5UTRENST00000370441ENST00000457702IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000370441ENST00000379335IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000370441ENST00000379329IDSchrX

148577877

-PHACTR1chr6

13160436

+
5UTR-3CDSENST00000490775ENST00000379350IDSchrX

148577877

-PHACTR1chr6

13160436

+
5UTR-intronENST00000490775ENST00000379348IDSchrX

148577877

-PHACTR1chr6

13160436

+
5UTR-intronENST00000490775ENST00000332995IDSchrX

148577877

-PHACTR1chr6

13160436

+
5UTR-3UTRENST00000490775ENST00000482982IDSchrX

148577877

-PHACTR1chr6

13160436

+
5UTR-5UTRENST00000490775ENST00000379345IDSchrX

148577877

-PHACTR1chr6

13160436

+
5UTR-5UTRENST00000490775ENST00000457702IDSchrX

148577877

-PHACTR1chr6

13160436

+
5UTR-intronENST00000490775ENST00000379335IDSchrX

148577877

-PHACTR1chr6

13160436

+
5UTR-intronENST00000490775ENST00000379329IDSchrX

148577877

-PHACTR1chr6

13160436

+
Frame-shitENST00000370443ENST00000379350IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000370443ENST00000379348IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000370443ENST00000332995IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-3UTRENST00000370443ENST00000482982IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-5UTRENST00000370443ENST00000379345IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-5UTRENST00000370443ENST00000457702IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000370443ENST00000379335IDSchrX

148577877

-PHACTR1chr6

13160436

+
5CDS-intronENST00000370443ENST00000379329IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-3CDSENST00000427113ENST00000379350IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-intronENST00000427113ENST00000379348IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-intronENST00000427113ENST00000332995IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-3UTRENST00000427113ENST00000482982IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-5UTRENST00000427113ENST00000379345IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-5UTRENST00000427113ENST00000457702IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-intronENST00000427113ENST00000379335IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-intronENST00000427113ENST00000379329IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-3CDSENST00000428056ENST00000379350IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-intronENST00000428056ENST00000379348IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-intronENST00000428056ENST00000332995IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-3UTRENST00000428056ENST00000482982IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-5UTRENST00000428056ENST00000379345IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-5UTRENST00000428056ENST00000457702IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-intronENST00000428056ENST00000379335IDSchrX

148577877

-PHACTR1chr6

13160436

+
intron-intronENST00000428056ENST00000379329IDSchrX

148577877

-PHACTR1chr6

13160436

+

Top

FusionProtFeatures for IDS_PHACTR1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
IDS

P22304

PHACTR1

Q9C0D0

Required for the lysosomal degradation of heparansulfate and dermatan sulfate. Binds actin monomers (G actin) and plays a role in thereorganization of the actin cytoskeleton and in formation of actinstress fibers. Plays a role in cell motility. Plays a role in theformation of tubules by endothelial cells. Regulates PPP1CAactivity. Required for normal cell survival.{ECO:0000269|PubMed:21798305, ECO:0000269|PubMed:21939755}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for IDS_PHACTR1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_IDS_ENST00000541269_chrX_148577877_-_PHACTR1_ENST00000379350_chr6_13160436_+_346aa
PWKGKTL_GKAEKS__SEES_RKSMIKMGNSLTPMKRTP_KMGSP_APASCLCLPCPKWSQSQCPGIPAHMRCSNRQTSWMGQILAPL_N
CLVCQ_NCRLRYLQRKS_SVCPWGGQTSHWCPTQPRRVASRVWPSTTTLSCPPRSSTSCSTAATASTSPPPPAPSPCTPRAAE__TSSTK
RWP_PCRGWKALSSGSPVPLLTTALGCTRVMGSPKQDLWAFQK_DKCQLL_LNVMTIKKMCLMSQTTKTLLACIQEKRRKRRRTKTTTAH

>In-frame_IDS_ENST00000422081_chrX_148577877_-_PHACTR1_ENST00000379350_chr6_13160436_+_346aa
PWKGKTL_GKAEKS__SEES_RKSMIKMGNSLTPMKRTP_KMGSP_APASCLCLPCPKWSQSQCPGIPAHMRCSNRQTSWMGQILAPL_N
CLVCQ_NCRLRYLQRKS_SVCPWGGQTSHWCPTQPRRVASRVWPSTTTLSCPPRSSTSCSTAATASTSPPPPAPSPCTPRAAE__TSSTK
RWP_PCRGWKALSSGSPVPLLTTALGCTRVMGSPKQDLWAFQK_DKCQLL_LNVMTIKKMCLMSQTTKTLLACIQEKRRKRRRTKTTTAH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_IDS_ENST00000541269_chrX_148577877_-_PHACTR1_ENST00000379350_chr6_13160436_+_1040nt
CCCTGGAAAGGAAAATATCTATGAGGCAAAGCAGAGAAGAGCTGATAAAGCGAGGAGTCCTGAAGGAAATCTATGATAAAGATGGGGAAC
TCTCTATATCCAATGAAGAGGACTCCCTAGAAAATGGGCAGTCCCTGAGCTCCAGCCAGCTGTCTCTGCCTGCCCTGTCCGAAATGGAGC
CAGTCCCAATGCCCAGGGATCCCTGCTCATATGAGGTGCTCCAACCGTCAGACATCATGGATGGGCCAGATCCTGGCGCCCCTGTGAAAT
TGCCTTGTCTGCCAGTGAAACTGTCGCCTCCGCTACCTCCAAAGAAAGTCATGATCTGTATGCCCGTGGGGGGGCCAGACCTCTCACTGG
TGTCCTACACAGCCCAGAAGAGTGGCCAGCAGGGTGTGGCCCAGCACCACCACACTGTCCTGCCCTCCCAGATCCAGCACCAGCTGCAGT
ACGGCAGCCACGGCCAGCACCTCCCCTCCACCACCGGCTCCCTCCCCATGCACCCCTCGGGCTGCAGAATGATAGACGAGCTCAACAAAA
CGCTGGCCATGACCATGCAGAGGCTGGAAAGCTCTGAGCAGCGGGTCCCCTGTTCCACTTCTTACCACAGCTCTGGGTTGCACTCGGGTG
ATGGGGTCACCAAAGCAGGACCTATGGGCCTTCCAGAAATAAGACAAGTGCCAACTGTTGTGATTGAATGTGATGACAATAAAGAAAATG
TGCCTCATGAGTCAGACTACGAAGACTCTTCTTGCCTGTATACAAGAGAAGAGGAGGAAGAGGAGGAGGACGAAGACGACGACAGCTCAT
TATACACCAGCTCCCTGGCCATGAAGGTCTGCAGGAAGGACTCCTTAGCCATCAAACTCAGCAACAGGCCCTCCAAGCGAGAGCTGGAAG
AAAAGAACATCCTTCCCAGGCAGACGGATGAGGAGCGGCTGGAGCTGAGGCAACAGATTGGCACCAAGCTCACCAGGCGGCTGAGCCAGA

>In-frame_IDS_ENST00000422081_chrX_148577877_-_PHACTR1_ENST00000379350_chr6_13160436_+_1040nt
CCCTGGAAAGGAAAATATCTATGAGGCAAAGCAGAGAAGAGCTGATAAAGCGAGGAGTCCTGAAGGAAATCTATGATAAAGATGGGGAAC
TCTCTATATCCAATGAAGAGGACTCCCTAGAAAATGGGCAGTCCCTGAGCTCCAGCCAGCTGTCTCTGCCTGCCCTGTCCGAAATGGAGC
CAGTCCCAATGCCCAGGGATCCCTGCTCATATGAGGTGCTCCAACCGTCAGACATCATGGATGGGCCAGATCCTGGCGCCCCTGTGAAAT
TGCCTTGTCTGCCAGTGAAACTGTCGCCTCCGCTACCTCCAAAGAAAGTCATGATCTGTATGCCCGTGGGGGGGCCAGACCTCTCACTGG
TGTCCTACACAGCCCAGAAGAGTGGCCAGCAGGGTGTGGCCCAGCACCACCACACTGTCCTGCCCTCCCAGATCCAGCACCAGCTGCAGT
ACGGCAGCCACGGCCAGCACCTCCCCTCCACCACCGGCTCCCTCCCCATGCACCCCTCGGGCTGCAGAATGATAGACGAGCTCAACAAAA
CGCTGGCCATGACCATGCAGAGGCTGGAAAGCTCTGAGCAGCGGGTCCCCTGTTCCACTTCTTACCACAGCTCTGGGTTGCACTCGGGTG
ATGGGGTCACCAAAGCAGGACCTATGGGCCTTCCAGAAATAAGACAAGTGCCAACTGTTGTGATTGAATGTGATGACAATAAAGAAAATG
TGCCTCATGAGTCAGACTACGAAGACTCTTCTTGCCTGTATACAAGAGAAGAGGAGGAAGAGGAGGAGGACGAAGACGACGACAGCTCAT
TATACACCAGCTCCCTGGCCATGAAGGTCTGCAGGAAGGACTCCTTAGCCATCAAACTCAGCAACAGGCCCTCCAAGCGAGAGCTGGAAG
AAAAGAACATCCTTCCCAGGCAGACGGATGAGGAGCGGCTGGAGCTGAGGCAACAGATTGGCACCAAGCTCACCAGGCGGCTGAGCCAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_IDS_ENST00000541269_chrX_148577877_-_PHACTR1_ENST00000379350_chr6_13160436_+_5898nt
TTGGAGTTCAGCCACCTTAGCAAGTCCTGGGTTTGTTCTTCAGACTTTGCTGCTCGCCCATTGCCTGGATCGGGGGCTACTTTGTAAACC
ACCAGGAAGACTCCAGTGTTTCTGGTTAATTTTTAGATGTTTGTTAATTGCTCTTGGTCTCTCATTAATCCCCTGTGGGTCATCCAGGAA
ACATACTCACCACTGTCTGTTCTCTGAGTTTTCATTTCCAGGCATCCGCCCTGCCTGGATCTCCTCACCTGCCAGGAACTTCCTCTCCAC
AAGCCGGCCATCCCAGCAAAAGTTCTAACACCAAAGGTCTGGCAACTAGCCTGCCATCTTGTGCCTGGAGCCGCCTGCGTGCCACCTACT
CCCGAAGATGGGAACCTTGTTGCCAGTTGGGCAGATGCGGGGCAATCCTGTACCAAGACCCCATTTTACCACCTGCTTTCTCAGACCACT
CTGGAACCCACTGTCTCAGATTGTGTCTTCCAGGAAGCAGACCATGAGAGGGAGTTGGCAGGGCCAAAGATTTACTGGGGCTAACTAACA
CTCAGGAAAGGGATAGGAAGGAAACAGGGCTGGAGAGCAGGTTGAGCCCGACCTGACAGTCTCGAGCAGCCCAACAGGGAGGTGTGGAGC
AAGGGTTGCCCACTAGAGGGGCCTGCATTGGGTACGGGTGATGGGGTCCACATGGTACCTGGCATATAGCAGGCTGTGCAATCCATATTA
ACTGACTGGATAAATTAATGCTCAGAAAAGGTGCCCTGGAGAATGGGTGCGTGCTGAACACAATAGGGAAGGGCCCAGCATCTGCCTTGG
CATAGGCAGAACTGTGCTGTGCCCTGCAACAGGCCACCTGAGAGCTGCTTTGATCTTGTGTGTACATTAGACGACTGCCAGGGGCATGAA
GGGGATGTGCTTCCAGGGCATTTGCTGGCAGGGCGTCTTGTGATTTCTTGGTATTGGTGTGAGCATAGCCTGGCAGGAGAGGGCAGATCT
CCGTGCAAAGTATGTCAGAAAGCAGATGGAAGCCAGGCCCCCTCCTGAAAGAGGCTCCTTGAAGATAATTCTAACATCTTTGTCATCAGT
GTTGACATCTCTTGATTGTATCCTGTCATTCCATTTGAGATCTTCCTGGTTCTGGCTGGCATCCTCTGACATCACTCCAGCAGAAGAAAG
GGAAGGAACACGCTGCATTACTGCGTGGGATATCTTCTAACCATACCGATGATTCTCCGTATAGCTGGTCTTTTCCACCTTATCATCCTT
CCTCTGAGAAGTATGAAAACACTAAGACATGTCGAGGGCCAGATGGAGAACTCCATGCCAACCTGCTTTGCCCTGTGGATGTGCTGGATG
TTCCCGAGGGCACCTTGCCTGACAAACAGAGCACTGAGCAAGCCATACAGTTGTTGGAAAAGATGAAAACGTCAGCCAGTCCTTTCTTCC
TGGCCGTTGGGTATCATAAGCCACACATCCCCTTCAGATACCCCAAGGAATTTCAGAAGTTGTATCCCTTGGAGAACATCACCCTGGCCC
CCGATCCCGAGGTCCCTGATGGCCTACCCCCTGTGGCCTACAACCCCTGGATGGACATCAGGCAACGGGAAGACGTCCAAGCCTTAAACA
TCAGTGTGCCGTATGGTCCAATTCCTGTGGACTTTCAGCCCTGGAAAGGAAAATATCTATGAGGCAAAGCAGAGAAGAGCTGATAAAGCG
AGGAGTCCTGAAGGAAATCTATGATAAAGATGGGGAACTCTCTATATCCAATGAAGAGGACTCCCTAGAAAATGGGCAGTCCCTGAGCTC
CAGCCAGCTGTCTCTGCCTGCCCTGTCCGAAATGGAGCCAGTCCCAATGCCCAGGGATCCCTGCTCATATGAGGTGCTCCAACCGTCAGA
CATCATGGATGGGCCAGATCCTGGCGCCCCTGTGAAATTGCCTTGTCTGCCAGTGAAACTGTCGCCTCCGCTACCTCCAAAGAAAGTCAT
GATCTGTATGCCCGTGGGGGGGCCAGACCTCTCACTGGTGTCCTACACAGCCCAGAAGAGTGGCCAGCAGGGTGTGGCCCAGCACCACCA
CACTGTCCTGCCCTCCCAGATCCAGCACCAGCTGCAGTACGGCAGCCACGGCCAGCACCTCCCCTCCACCACCGGCTCCCTCCCCATGCA
CCCCTCGGGCTGCAGAATGATAGACGAGCTCAACAAAACGCTGGCCATGACCATGCAGAGGCTGGAAAGCTCTGAGCAGCGGGTCCCCTG
TTCCACTTCTTACCACAGCTCTGGGTTGCACTCGGGTGATGGGGTCACCAAAGCAGGACCTATGGGCCTTCCAGAAATAAGACAAGTGCC
AACTGTTGTGATTGAATGTGATGACAATAAAGAAAATGTGCCTCATGAGTCAGACTACGAAGACTCTTCTTGCCTGTATACAAGAGAAGA
GGAGGAAGAGGAGGAGGACGAAGACGACGACAGCTCATTATACACCAGCTCCCTGGCCATGAAGGTCTGCAGGAAGGACTCCTTAGCCAT
CAAACTCAGCAACAGGCCCTCCAAGCGAGAGCTGGAAGAAAAGAACATCCTTCCCAGGCAGACGGATGAGGAGCGGCTGGAGCTGAGGCA
ACAGATTGGCACCAAGCTCACCAGGCGGCTGAGCCAGAGGCCAACTGCAGAGGAACTGGAACAGAGGAACATTTTGAAACGTAAGTGACT
AAGCCCATGGCAATCCCTGATGTTTTGTGGCGGCTTTTGTTATTATTTAATGGTAGGCCACAAGGTTTCTACCTTGCGCCTCTGCGGAAA
GCATTGAAAACCTTTCTAACGGTTGAAGCTTCATGTGTGCATGTTAGAACACCAAAGACGACCTCCCCAAAGAGAAGGCAAATTTTATTC
CACTTTATTCTTTAGAAGCTCACGGGCGGCAGGCAGAACCTTCCTTTTAGTGAGTTGTAAAGTCAGAGAGAAGCTGAAAAATTAGAGTGA
GACCACTTATTATTTAATGATTTTTAAGAGCAGGGTCACCTTTAAACCAGAATTGGCTTGAAAATGGAGACTGTGATATGCACGGCTAAA
ATAAGGGAAATGTCCATTTGAACTGAGACTAGAAAGCATGACTTTGCATTGCAGCTGGCTGCTGTTGATAAAAATCCCTCATCCCTTTGA
ATGTTAAATTGAAAGACTAAGAAAGCATTTCCAAGTGAAGTGCTTCATGTCTGTCTCTCAGGATTCCCACAGCTGGTCCCGGGCATGCCT
GTCTGATGCTCTCATTCGAGGAAAACTGCCTTTCACCATTGCTGCAGACAGAAAAAAATAAATGAGCCCCTTGTTTGGTTTAGGACACAG
AGACATTTGAATATGTACAGAGGATCCACTTGGTGCTTTAAAAAAAAAAAGAGAAAACAGGATACAAAATACTAAAAGAGATCAAGCATT
TGATGGACAGCAGTATGCGTCAGTTTAGTGGTAGATATTAAATAACTTAAATATCAAACCATTCTATTCATTCATTGCTACCATTCTCGC
CAACACTGGCCTCAAGATAGTGAACAAATATTTCTGGCTTAATTCATGACCCTGTTCCCCCTACCCCACAACACACTTCTAATTTCTCTC
CAGAAGAGAAAGATATATACTATGCAGAGTTTTCTAGAAATGCTATGTTGTACAGACTGACTCCTTGCCTCCCCCGGCCCCCCCGCCCCG
CCCCGCCCCGTGCCCAGTAAATCACATGCAACCGCAGTGTGAGTTTGCCGGGAATTTCCACTGAAACCACACTAAGATATTCTTGACTTT
ACCTTTCTACCGTGCTCACTGTGGCCTTGTGACTTGGTCGGCATTTCGTAGTCTGCTGAAGGTGGGTGCTGGGTTCCGCTTTGGTGGGGA
GACCTGTTGCCTACAGCACCCACCCCCGCCCGACGCCCCCGCATGTCCGTTTATGTCAACTCTGCCTTTATCAATGTCTTGCCTCCCGTC
CCCACGCCAGCCGCCACTTCCTCAACTCTCAGTAGAAGTTATTTTCAGGATTAGCCTTCCTCAGTCGTGGGGGAACCCTACGCTTTGCCT
AGGTCTCTAGGAATGTGTGTTTACTTTTTTCTGCCCAAGGGGTACCCTTTAAAGTTTCCAAGCTTAATATTCTATATAATGAATTCAGAG
CTTTTTCAAAGCATTTCCAAGGTCAGGGAAGCATTTGGCTTGTAGGATGTCTTCCTTTCGGCCCCAATCTGGTACCTGAGCCATTATAAA
CTTCCCATTGTTGGAGAGAAAGATAAACAGCCAGGTGAACCTGTACAACTTACTCACAGCCCGCTGCTGTACTTGTGGCCTCTGACCTGA
GACCTAAACTCAAAGAAGCTAAAAGCCTCCGGGGGATTATTTAGGTTTCAGAAAATAGTGCTTATCACACCAGGAGTACGGTTTCTGGAG
AGATCTAAAATCCCCTAGCTCAGCTCTGGGCTCTCTCAAAGATATCAGATCCCCGCTGTGGCTTGTCCAGATCCCTGGGAGACTACAGGT
CCTTTGAGCTTGGGTTTTTACCGCCATCAACCAGGGAACTTAGATTCAGGGGACCAAAAAGGAGTTGTGAAAGATTGTTCCCATGGTTCT
CTTTTATTCTCTTCCCTAATCCCTCTTGTCCTGGCCACATAGTTGCAAATTAAAGAACTACTTGACCAATTCTAACAGGTTGGTCATTTC
ATAGTTTTGAAACTTTTCAGAAATCAACTTGTTTTCCCATAGGTTCTTATTTTTCCCTGTATTCTGGAACTATGTTCTCCTAAATATTTT
TTTAAATTTAATCTATTGCGATTGTTAAACAAAAAAAATGTCTAGTGGTATAAGAAAACATCCTCCAATAGTTTGTTTTAAAACTGATTT
TCTGAGCTTTCAGCCATTTGAGGAACTGCTCGGTGTTGGGTGGTGGGGAACAGGGCACAGAGATGCCATGGCTCAGCCCTGGAGCTTTGA
GAGCCTTGGGTTGGTTTCCAGCCCCACCCTGCCTGGTCCTGGGAGCAGCCCCTGTTCTGTCCAGCAGCCAGTGAGGCCCTGTGCACCTCT
GAGCACATAATGAACCCTCTGACGGTGGCAGCTGTAATGACGACATCGTAGGCCTTTCCTGGCCTGTCTTCCTAGTTGCCTAATGGGGTT
GTCTTGGTACCTTCTGCCTGAAAATTCATGAACCTGGGTTGGTCAATGGCTTTGAACTAAAGGTATCAATTCTGTAGGTGGTAGCTTGTG
GCCCCACCCCTCAGAGTGACCTAAGAAACGCACATAGGAGATGAAGGCTCCATGCTGTGTCAGCTGTGTCACAGGATGCCCGCCTTCACG
GCTCTGAAGGGACCTGTAGGATCAGAAGTCTGAGGCTAGTAATGAGGAGGAGAGCCGGCCCCACACAAAACATGACCACAGGAAAAAACC
TATCTGTGTAACCACTGAGCCAGGTAGGGTGTGACTGGCCACTTAACACCCCTGAGGCTTCAGATCCTCAGTTATAAACCAGGAGTGGTA
GACGAGGTGGTCACTAGGTCCCCTCATGGCCCTAGTATTCTGTGCTTCTGTAAATTTTCACCGTGTGCCCTCTAGCTGTCCCTGGTGACC
CAACATCCAGACCACCTTTTCTTCCATCCGTTTTCCCACCTGAGACATCGCAAAATGGGAGTTCCCTCCTTCTGGTTCTTGCTGTCTGCC
TCCCCATTTAACTCTGCTAGATTAATTCATACTAAGATATTAATGGCTGACTAGTTTAATAGGTTTTATCCCACTGAAATTTGCATTTGT
ACAAATGTCACTGTCTGGGGGCTCCCTACTTCCGGGTGTTGCTGTCTGCCCCCCAGTTTATCTCTACTAGATTAATTCATACTGAGCTAT

>In-frame_IDS_ENST00000422081_chrX_148577877_-_PHACTR1_ENST00000379350_chr6_13160436_+_5898nt
TTGGAGTTCAGCCACCTTAGCAAGTCCTGGGTTTGTTCTTCAGACTTTGCTGCTCGCCCATTGCCTGGATCGGGGGCTACTTTGTAAACC
ACCAGGAAGACTCCAGTGTTTCTGGTTAATTTTTAGATGTTTGTTAATTGCTCTTGGTCTCTCATTAATCCCCTGTGGGTCATCCAGGAA
ACATACTCACCACTGTCTGTTCTCTGAGTTTTCATTTCCAGGCATCCGCCCTGCCTGGATCTCCTCACCTGCCAGGAACTTCCTCTCCAC
AAGCCGGCCATCCCAGCAAAAGTTCTAACACCAAAGGTCTGGCAACTAGCCTGCCATCTTGTGCCTGGAGCCGCCTGCGTGCCACCTACT
CCCGAAGATGGGAACCTTGTTGCCAGTTGGGCAGATGCGGGGCAATCCTGTACCAAGACCCCATTTTACCACCTGCTTTCTCAGACCACT
CTGGAACCCACTGTCTCAGATTGTGTCTTCCAGGAAGCAGACCATGAGAGGGAGTTGGCAGGGCCAAAGATTTACTGGGGCTAACTAACA
CTCAGGAAAGGGATAGGAAGGAAACAGGGCTGGAGAGCAGGTTGAGCCCGACCTGACAGTCTCGAGCAGCCCAACAGGGAGGTGTGGAGC
AAGGGTTGCCCACTAGAGGGGCCTGCATTGGGTACGGGTGATGGGGTCCACATGGTACCTGGCATATAGCAGGCTGTGCAATCCATATTA
ACTGACTGGATAAATTAATGCTCAGAAAAGGTGCCCTGGAGAATGGGTGCGTGCTGAACACAATAGGGAAGGGCCCAGCATCTGCCTTGG
CATAGGCAGAACTGTGCTGTGCCCTGCAACAGGCCACCTGAGAGCTGCTTTGATCTTGTGTGTACATTAGACGACTGCCAGGGGCATGAA
GGGGATGTGCTTCCAGGGCATTTGCTGGCAGGGCGTCTTGTGATTTCTTGGTATTGGTGTGAGCATAGCCTGGCAGGAGAGGGCAGATCT
CCGTGCAAAGTATGTCAGAAAGCAGATGGAAGCCAGGCCCCCTCCTGAAAGAGGCTCCTTGAAGATAATTCTAACATCTTTGTCATCAGT
GTTGACATCTCTTGATTGTATCCTGTCATTCCATTTGAGATCTTCCTGGTTCTGGCTGGCATCCTCTGACATCACTCCAGCAGAAGAAAG
GGAAGGAACACGCTGCATTACTGCGTGGGATATCTTCTAACCATACCGATGATTCTCCGTATAGCTGGTCTTTTCCACCTTATCATCCTT
CCTCTGAGAAGTATGAAAACACTAAGACATGTCGAGGGCCAGATGGAGAACTCCATGCCAACCTGCTTTGCCCTGTGGATGTGCTGGATG
TTCCCGAGGGCACCTTGCCTGACAAACAGAGCACTGAGCAAGCCATACAGTTGTTGGAAAAGATGAAAACGTCAGCCAGTCCTTTCTTCC
TGGCCGTTGGGTATCATAAGCCACACATCCCCTTCAGATACCCCAAGGAATTTCAGAAGTTGTATCCCTTGGAGAACATCACCCTGGCCC
CCGATCCCGAGGTCCCTGATGGCCTACCCCCTGTGGCCTACAACCCCTGGATGGACATCAGGCAACGGGAAGACGTCCAAGCCTTAAACA
TCAGTGTGCCGTATGGTCCAATTCCTGTGGACTTTCAGCCCTGGAAAGGAAAATATCTATGAGGCAAAGCAGAGAAGAGCTGATAAAGCG
AGGAGTCCTGAAGGAAATCTATGATAAAGATGGGGAACTCTCTATATCCAATGAAGAGGACTCCCTAGAAAATGGGCAGTCCCTGAGCTC
CAGCCAGCTGTCTCTGCCTGCCCTGTCCGAAATGGAGCCAGTCCCAATGCCCAGGGATCCCTGCTCATATGAGGTGCTCCAACCGTCAGA
CATCATGGATGGGCCAGATCCTGGCGCCCCTGTGAAATTGCCTTGTCTGCCAGTGAAACTGTCGCCTCCGCTACCTCCAAAGAAAGTCAT
GATCTGTATGCCCGTGGGGGGGCCAGACCTCTCACTGGTGTCCTACACAGCCCAGAAGAGTGGCCAGCAGGGTGTGGCCCAGCACCACCA
CACTGTCCTGCCCTCCCAGATCCAGCACCAGCTGCAGTACGGCAGCCACGGCCAGCACCTCCCCTCCACCACCGGCTCCCTCCCCATGCA
CCCCTCGGGCTGCAGAATGATAGACGAGCTCAACAAAACGCTGGCCATGACCATGCAGAGGCTGGAAAGCTCTGAGCAGCGGGTCCCCTG
TTCCACTTCTTACCACAGCTCTGGGTTGCACTCGGGTGATGGGGTCACCAAAGCAGGACCTATGGGCCTTCCAGAAATAAGACAAGTGCC
AACTGTTGTGATTGAATGTGATGACAATAAAGAAAATGTGCCTCATGAGTCAGACTACGAAGACTCTTCTTGCCTGTATACAAGAGAAGA
GGAGGAAGAGGAGGAGGACGAAGACGACGACAGCTCATTATACACCAGCTCCCTGGCCATGAAGGTCTGCAGGAAGGACTCCTTAGCCAT
CAAACTCAGCAACAGGCCCTCCAAGCGAGAGCTGGAAGAAAAGAACATCCTTCCCAGGCAGACGGATGAGGAGCGGCTGGAGCTGAGGCA
ACAGATTGGCACCAAGCTCACCAGGCGGCTGAGCCAGAGGCCAACTGCAGAGGAACTGGAACAGAGGAACATTTTGAAACGTAAGTGACT
AAGCCCATGGCAATCCCTGATGTTTTGTGGCGGCTTTTGTTATTATTTAATGGTAGGCCACAAGGTTTCTACCTTGCGCCTCTGCGGAAA
GCATTGAAAACCTTTCTAACGGTTGAAGCTTCATGTGTGCATGTTAGAACACCAAAGACGACCTCCCCAAAGAGAAGGCAAATTTTATTC
CACTTTATTCTTTAGAAGCTCACGGGCGGCAGGCAGAACCTTCCTTTTAGTGAGTTGTAAAGTCAGAGAGAAGCTGAAAAATTAGAGTGA
GACCACTTATTATTTAATGATTTTTAAGAGCAGGGTCACCTTTAAACCAGAATTGGCTTGAAAATGGAGACTGTGATATGCACGGCTAAA
ATAAGGGAAATGTCCATTTGAACTGAGACTAGAAAGCATGACTTTGCATTGCAGCTGGCTGCTGTTGATAAAAATCCCTCATCCCTTTGA
ATGTTAAATTGAAAGACTAAGAAAGCATTTCCAAGTGAAGTGCTTCATGTCTGTCTCTCAGGATTCCCACAGCTGGTCCCGGGCATGCCT
GTCTGATGCTCTCATTCGAGGAAAACTGCCTTTCACCATTGCTGCAGACAGAAAAAAATAAATGAGCCCCTTGTTTGGTTTAGGACACAG
AGACATTTGAATATGTACAGAGGATCCACTTGGTGCTTTAAAAAAAAAAAGAGAAAACAGGATACAAAATACTAAAAGAGATCAAGCATT
TGATGGACAGCAGTATGCGTCAGTTTAGTGGTAGATATTAAATAACTTAAATATCAAACCATTCTATTCATTCATTGCTACCATTCTCGC
CAACACTGGCCTCAAGATAGTGAACAAATATTTCTGGCTTAATTCATGACCCTGTTCCCCCTACCCCACAACACACTTCTAATTTCTCTC
CAGAAGAGAAAGATATATACTATGCAGAGTTTTCTAGAAATGCTATGTTGTACAGACTGACTCCTTGCCTCCCCCGGCCCCCCCGCCCCG
CCCCGCCCCGTGCCCAGTAAATCACATGCAACCGCAGTGTGAGTTTGCCGGGAATTTCCACTGAAACCACACTAAGATATTCTTGACTTT
ACCTTTCTACCGTGCTCACTGTGGCCTTGTGACTTGGTCGGCATTTCGTAGTCTGCTGAAGGTGGGTGCTGGGTTCCGCTTTGGTGGGGA
GACCTGTTGCCTACAGCACCCACCCCCGCCCGACGCCCCCGCATGTCCGTTTATGTCAACTCTGCCTTTATCAATGTCTTGCCTCCCGTC
CCCACGCCAGCCGCCACTTCCTCAACTCTCAGTAGAAGTTATTTTCAGGATTAGCCTTCCTCAGTCGTGGGGGAACCCTACGCTTTGCCT
AGGTCTCTAGGAATGTGTGTTTACTTTTTTCTGCCCAAGGGGTACCCTTTAAAGTTTCCAAGCTTAATATTCTATATAATGAATTCAGAG
CTTTTTCAAAGCATTTCCAAGGTCAGGGAAGCATTTGGCTTGTAGGATGTCTTCCTTTCGGCCCCAATCTGGTACCTGAGCCATTATAAA
CTTCCCATTGTTGGAGAGAAAGATAAACAGCCAGGTGAACCTGTACAACTTACTCACAGCCCGCTGCTGTACTTGTGGCCTCTGACCTGA
GACCTAAACTCAAAGAAGCTAAAAGCCTCCGGGGGATTATTTAGGTTTCAGAAAATAGTGCTTATCACACCAGGAGTACGGTTTCTGGAG
AGATCTAAAATCCCCTAGCTCAGCTCTGGGCTCTCTCAAAGATATCAGATCCCCGCTGTGGCTTGTCCAGATCCCTGGGAGACTACAGGT
CCTTTGAGCTTGGGTTTTTACCGCCATCAACCAGGGAACTTAGATTCAGGGGACCAAAAAGGAGTTGTGAAAGATTGTTCCCATGGTTCT
CTTTTATTCTCTTCCCTAATCCCTCTTGTCCTGGCCACATAGTTGCAAATTAAAGAACTACTTGACCAATTCTAACAGGTTGGTCATTTC
ATAGTTTTGAAACTTTTCAGAAATCAACTTGTTTTCCCATAGGTTCTTATTTTTCCCTGTATTCTGGAACTATGTTCTCCTAAATATTTT
TTTAAATTTAATCTATTGCGATTGTTAAACAAAAAAAATGTCTAGTGGTATAAGAAAACATCCTCCAATAGTTTGTTTTAAAACTGATTT
TCTGAGCTTTCAGCCATTTGAGGAACTGCTCGGTGTTGGGTGGTGGGGAACAGGGCACAGAGATGCCATGGCTCAGCCCTGGAGCTTTGA
GAGCCTTGGGTTGGTTTCCAGCCCCACCCTGCCTGGTCCTGGGAGCAGCCCCTGTTCTGTCCAGCAGCCAGTGAGGCCCTGTGCACCTCT
GAGCACATAATGAACCCTCTGACGGTGGCAGCTGTAATGACGACATCGTAGGCCTTTCCTGGCCTGTCTTCCTAGTTGCCTAATGGGGTT
GTCTTGGTACCTTCTGCCTGAAAATTCATGAACCTGGGTTGGTCAATGGCTTTGAACTAAAGGTATCAATTCTGTAGGTGGTAGCTTGTG
GCCCCACCCCTCAGAGTGACCTAAGAAACGCACATAGGAGATGAAGGCTCCATGCTGTGTCAGCTGTGTCACAGGATGCCCGCCTTCACG
GCTCTGAAGGGACCTGTAGGATCAGAAGTCTGAGGCTAGTAATGAGGAGGAGAGCCGGCCCCACACAAAACATGACCACAGGAAAAAACC
TATCTGTGTAACCACTGAGCCAGGTAGGGTGTGACTGGCCACTTAACACCCCTGAGGCTTCAGATCCTCAGTTATAAACCAGGAGTGGTA
GACGAGGTGGTCACTAGGTCCCCTCATGGCCCTAGTATTCTGTGCTTCTGTAAATTTTCACCGTGTGCCCTCTAGCTGTCCCTGGTGACC
CAACATCCAGACCACCTTTTCTTCCATCCGTTTTCCCACCTGAGACATCGCAAAATGGGAGTTCCCTCCTTCTGGTTCTTGCTGTCTGCC
TCCCCATTTAACTCTGCTAGATTAATTCATACTAAGATATTAATGGCTGACTAGTTTAATAGGTTTTATCCCACTGAAATTTGCATTTGT
ACAAATGTCACTGTCTGGGGGCTCCCTACTTCCGGGTGTTGCTGTCTGCCCCCCAGTTTATCTCTACTAGATTAATTCATACTGAGCTAT


Top

FusionGenePPI for IDS_PHACTR1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
IDSTUBB8, SUMF1, HSPA5, WDR47, B3GALTL, KLHL15, TAZ, P3H4, XYLT2, MESDC2, COCH, FBXO3, GALNT18, GUSB, AP3M1, CUL1, LOXL2, PDIA5, FKBP14, CBWD3, FBXO21, PAM, ERGIC2, TMPPE, CERCAM, EXT2, GALNS, B3GALNT2, ENTPD5, DHFRL1, NDST2, NDST1, PPT2, TCTN1, MANEAL, POMGNT2, ADAMTS2, ST3GAL4, LEPREL2, PDF, IL17RAPHACTR1ACTA1, PPP1CA, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for IDS_PHACTR1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for IDS_PHACTR1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneIDSC0026705Mucopolysaccharidosis II28CTD_human;UNIPROT
TgenePHACTR1C1956346Coronary Artery Disease3CTD_human
TgenePHACTR1C0027051Myocardial Infarction2CTD_human
TgenePHACTR1C0338480Common Migraine1CTD_human