FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1702

FusionGeneSummary for ANKFY1_SPINT2

check button Fusion gene summary
Fusion gene informationFusion gene name: ANKFY1_SPINT2
Fusion gene ID: 1702
HgeneTgene
Gene symbol

ANKFY1

SPINT2

Gene ID

51479

10653

Gene nameankyrin repeat and FYVE domain containing 1serine peptidase inhibitor, Kunitz type 2
SynonymsANKHZN|BTBD23|ZFYVE14DIAR3|HAI-2|HAI2|Kop|PB
Cytomap

17p13.2

19q13.2

Type of geneprotein-codingprotein-coding
Descriptionrabankyrin-5Rabankyrin-5ankyrin repeat and FYVE domain-containing protein 1ankyrin repeat hooked to zinc finger motifankyrin repeats hooked to a zinc finger motifrank-5kunitz-type protease inhibitor 2hepatocyte growth factor activator inhibitor type 2serine protease inhibitor, Kunitz type, 2testicular tissue protein Li 183
Modification date2018051920180522
UniProtAcc

Q9P2R3

O43291

Ensembl transtripts involved in fusion geneENST00000341657, ENST00000570535, 
ENST00000574367, ENST00000573722, 
ENST00000433651, 
ENST00000301244, 
ENST00000587090, ENST00000454580, 
Fusion gene scores* DoF score4 X 4 X 3=488 X 2 X 7=112
# samples 48
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/112*10)=-0.485426827170242
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ANKFY1 [Title/Abstract] AND SPINT2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneANKFY1

GO:0034058

endosomal vesicle fusion

15328530

HgeneANKFY1

GO:0048549

positive regulation of pinocytosis

15328530

TgeneSPINT2

GO:0022408

negative regulation of cell-cell adhesion

19592578

TgeneSPINT2

GO:2000146

negative regulation of cell motility

19592578


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-25-1632-01AANKFY1chr17

4077204

-SPINT2chr19

38774267

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000341657ENST00000301244ANKFY1chr17

4077204

-SPINT2chr19

38774267

+
5CDS-5UTRENST00000341657ENST00000587090ANKFY1chr17

4077204

-SPINT2chr19

38774267

+
5CDS-intronENST00000341657ENST00000454580ANKFY1chr17

4077204

-SPINT2chr19

38774267

+
In-frameENST00000570535ENST00000301244ANKFY1chr17

4077204

-SPINT2chr19

38774267

+
5CDS-5UTRENST00000570535ENST00000587090ANKFY1chr17

4077204

-SPINT2chr19

38774267

+
5CDS-intronENST00000570535ENST00000454580ANKFY1chr17

4077204

-SPINT2chr19

38774267

+
In-frameENST00000574367ENST00000301244ANKFY1chr17

4077204

-SPINT2chr19

38774267

+
5CDS-5UTRENST00000574367ENST00000587090ANKFY1chr17

4077204

-SPINT2chr19

38774267

+
5CDS-intronENST00000574367ENST00000454580ANKFY1chr17

4077204

-SPINT2chr19

38774267

+
intron-3CDSENST00000573722ENST00000301244ANKFY1chr17

4077204

-SPINT2chr19

38774267

+
intron-5UTRENST00000573722ENST00000587090ANKFY1chr17

4077204

-SPINT2chr19

38774267

+
intron-intronENST00000573722ENST00000454580ANKFY1chr17

4077204

-SPINT2chr19

38774267

+
intron-3CDSENST00000433651ENST00000301244ANKFY1chr17

4077204

-SPINT2chr19

38774267

+
intron-5UTRENST00000433651ENST00000587090ANKFY1chr17

4077204

-SPINT2chr19

38774267

+
intron-intronENST00000433651ENST00000454580ANKFY1chr17

4077204

-SPINT2chr19

38774267

+

Top

FusionProtFeatures for ANKFY1_SPINT2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ANKFY1

Q9P2R3

SPINT2

O43291

Proposed effector of Rab5. Binds to phosphatidylinositol3-phosphate (PI(3)P). Involved in homotypic early endosome fusionand to a lesser extent in heterotypic fusion of chlathrin-coatedvesicles with early endosomes. Involved in macropinocytosis; thefunction is dependent on Rab5-GTP. Required for correct endosomallocalization. Involved in the internalization and trafficking ofactivated tyrosine kinase receptors such as PDGFRB. Regulates thesubcellular localization of the retromer complex in a EHD1-dependent manner. Involved in endosome-to-Golgi transport andbiosynthetic transport to late endosomes and lysosomes indicativefor a regulation of retromer complex-mediated retrogradetransport. {ECO:0000269|PubMed:15328530,ECO:0000269|PubMed:22284051, ECO:0000269|PubMed:24102721}. Inhibitor of HGF activator. Also inhibits plasmin,plasma and tissue kallikrein, and factor XIa.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-202568_1309741170DomainBTB
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-202568_13010161212DomainBTB
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-202568_1309751171DomainBTB
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025217_2479741170RepeatNote=ANK 1
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025255_2849741170RepeatNote=ANK 2
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025288_3179741170RepeatNote=ANK 3
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025322_3629741170RepeatNote=ANK 4
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025366_3969741170RepeatNote=ANK 5
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025490_5199741170RepeatNote=ANK 6
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025542_5729741170RepeatNote=ANK 7
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025588_6179741170RepeatNote=ANK 8
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025621_6509741170RepeatNote=ANK 9
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025654_6839741170RepeatNote=ANK 10
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025687_7169741170RepeatNote=ANK 11
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025724_7539741170RepeatNote=ANK 12
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025769_7989741170RepeatNote=ANK 13
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025802_8329741170RepeatNote=ANK 14
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025836_8659741170RepeatNote=ANK 15
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025870_8999741170RepeatNote=ANK 16
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025905_9349741170RepeatNote=ANK 17
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025938_9679741170RepeatNote=ANK 18
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025217_24710161212RepeatNote=ANK 1
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025255_28410161212RepeatNote=ANK 2
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025288_31710161212RepeatNote=ANK 3
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025322_36210161212RepeatNote=ANK 4
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025366_39610161212RepeatNote=ANK 5
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025490_51910161212RepeatNote=ANK 6
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025542_57210161212RepeatNote=ANK 7
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025588_61710161212RepeatNote=ANK 8
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025621_65010161212RepeatNote=ANK 9
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025654_68310161212RepeatNote=ANK 10
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025687_71610161212RepeatNote=ANK 11
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025724_75310161212RepeatNote=ANK 12
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025769_79810161212RepeatNote=ANK 13
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025802_83210161212RepeatNote=ANK 14
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025836_86510161212RepeatNote=ANK 15
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025870_89910161212RepeatNote=ANK 16
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025905_93410161212RepeatNote=ANK 17
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025938_96710161212RepeatNote=ANK 18
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025971_100110161212RepeatNote=ANK 19
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025217_2479751171RepeatNote=ANK 1
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025255_2849751171RepeatNote=ANK 2
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025288_3179751171RepeatNote=ANK 3
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025322_3629751171RepeatNote=ANK 4
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025366_3969751171RepeatNote=ANK 5
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025490_5199751171RepeatNote=ANK 6
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025542_5729751171RepeatNote=ANK 7
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025588_6179751171RepeatNote=ANK 8
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025621_6509751171RepeatNote=ANK 9
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025654_6839751171RepeatNote=ANK 10
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025687_7169751171RepeatNote=ANK 11
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025724_7539751171RepeatNote=ANK 12
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025769_7989751171RepeatNote=ANK 13
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025802_8329751171RepeatNote=ANK 14
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025836_8659751171RepeatNote=ANK 15
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025870_8999751171RepeatNote=ANK 16
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025905_9349751171RepeatNote=ANK 17
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025938_9679751171RepeatNote=ANK 18
TgeneSPINT2chr17:4077204chr19:38774267ENST00000301244+07219_25235253Topological domainCytoplasmic
TgeneSPINT2chr17:4077204chr19:38774267ENST00000454580+06219_252-106196Topological domainCytoplasmic
TgeneSPINT2chr17:4077204chr19:38774267ENST00000454580+0628_197-106196Topological domainExtracellular
TgeneSPINT2chr17:4077204chr19:38774267ENST00000301244+07198_21835253TransmembraneHelical
TgeneSPINT2chr17:4077204chr19:38774267ENST00000454580+06198_218-106196TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-11068_130-13488DomainBTB
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-20251005_10379741170RepeatNote=ANK 20
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-20251043_10729741170RepeatNote=ANK 21
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025971_10019741170RepeatNote=ANK 19
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-1101005_1037-13488RepeatNote=ANK 20
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-1101043_1072-13488RepeatNote=ANK 21
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110217_247-13488RepeatNote=ANK 1
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110255_284-13488RepeatNote=ANK 2
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110288_317-13488RepeatNote=ANK 3
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110322_362-13488RepeatNote=ANK 4
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110366_396-13488RepeatNote=ANK 5
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110490_519-13488RepeatNote=ANK 6
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110542_572-13488RepeatNote=ANK 7
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110588_617-13488RepeatNote=ANK 8
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110621_650-13488RepeatNote=ANK 9
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110654_683-13488RepeatNote=ANK 10
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110687_716-13488RepeatNote=ANK 11
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110724_753-13488RepeatNote=ANK 12
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110769_798-13488RepeatNote=ANK 13
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110802_832-13488RepeatNote=ANK 14
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110836_865-13488RepeatNote=ANK 15
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110870_899-13488RepeatNote=ANK 16
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110905_934-13488RepeatNote=ANK 17
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110938_967-13488RepeatNote=ANK 18
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110971_1001-13488RepeatNote=ANK 19
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-20251005_103710161212RepeatNote=ANK 20
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-20251043_107210161212RepeatNote=ANK 21
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-20251005_10379751171RepeatNote=ANK 20
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-20251043_10729751171RepeatNote=ANK 21
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025971_10019751171RepeatNote=ANK 19
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-20251104_11649741170Zinc fingerFYVE-type
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-1101104_1164-13488Zinc fingerFYVE-type
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-20251104_116410161212Zinc fingerFYVE-type
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-20251104_11649751171Zinc fingerFYVE-type
TgeneSPINT2chr17:4077204chr19:38774267ENST00000301244+0728_19735253Topological domainExtracellular


Top

FusionGeneSequence for ANKFY1_SPINT2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ANKFY1_ENST00000341657_chr17_4077204_-_SPINT2_ENST00000301244_chr19_38774267_+_1192aa
MAEEEVAKLEKHLMLLRQEYVKLQKKLAETEKRCALLAAQANKESSSESFISRLLAIVADLYEQEQYSDLKIKVGDRHISAHKFVLAARS
DSWSLANLSSTKELDLSDANPEVTMTMLRWIYTDELEFREDDVFLTELMKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNAS
TLMNYCAEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKVEREDVVFLYLIEMDSQLPGKLNEADHNGDLALDLALSRRLES
IATTLVSHKADVDMVDKSGWSLLHKGIQRGDLFAATFLIKNGAFVNAATLGAQETPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANP
NMQDSKGRTPLHVSIMAGNEYVFSQLLQCKQLDLELKDHEGSTALWLAVQHITVSSDQSVNPFEDVPVVNGTSFDENSFAARLIQRGSHT
DAPDTATGNCLLQRAAGAGNEAAALFLATNGAHVNHRNKWGETPLHTACRHGLANLTAELLQQGANPNLQTEEALPLPKEAASLTSLADS
VHLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTGMHTIAAQLLGSGAAINDTMSDGQTLLHMAI
QRQDSKSALFLLEHQADINVRTQDGETALQLAIRNQLPLVVDAICTRGADMSVPDEKGNPPLWLALANNLEDIASTLVRHGCDATCWGPG
PGGCLQTLLHRAIDENNEPTACFLIRSGCDVNSPRQPGANGEGEEEARDGQTPLHLAASWGLEETVQCLLEFGANVNAQDAEGRTPIHVA
ISSQHGVIIQLLVSHPDIHLNVRDRQGLTPFACAMTFKNNKSAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNSR
VQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLENGVDFAAVDENGNNDFCLVSKVVGRCRASM
PRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGP
CRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQERA

>In-frame_ANKFY1_ENST00000570535_chr17_4077204_-_SPINT2_ENST00000301244_chr19_38774267_+_1234aa
MPTPRDCGRLRSRAGRSRAGAACSRGAPRAAREALDCRRCRDAGGKEVAKLEKHLMLLRQEYVKLQKKLAETEKRCALLAAQANKESSSE
SFISRLLAIVADLYEQEQYSDLKIKVGDRHISAHKFVLAARSDSWSLANLSSTKELDLSDANPEVTMTMLRWIYTDELEFREDDVFLTEL
MKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNASTLMNYCAEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKV
EREDVVFLYLIEMDSQLPGKLNEADHNGDLALDLALSRRLESIATTLVSHKADVDMVDKSGWSLLHKGIQRGDLFAATFLIKNGAFVNAA
TLGAQETPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANPNMQDSKGRTPLHVSIMAGNEYVFSQLLQCKQLDLELKDHEGSTALWLA
VQHITVSSDQSVNPFEDVPVVNGTSFDENSFAARLIQRGSHTDAPDTATGNCLLQRAAGAGNEAAALFLATNGAHVNHRNKWGETPLHTA
CRHGLANLTAELLQQGANPNLQTEEALPLPKEAASLTSLADSVHLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSR
DQTVLGLALWTGMHTIAAQLLGSGAAINDTMSDGQTLLHMAIQRQDSKSALFLLEHQADINVRTQDGETALQLAIRNQLPLVVDAICTRG
ADMSVPDEKGNPPLWLALANNLEDIASTLVRHGCDATCWGPGPGGCLQTLLHRAIDENNEPTACFLIRSGCDVNSPRQPGANGEGEEEAR
DGQTPLHLAASWGLEETVQCLLEFGANVNAQDAEGRTPIHVAISSQHGVIIQLLVSHPDIHLNVRDRQGLTPFACAMTFKNNKSAEAILK
RESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNSRVQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQ
QDLPTICSVLLENGVDFAAVDENGNNDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDL
ATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQEN

>In-frame_ANKFY1_ENST00000574367_chr17_4077204_-_SPINT2_ENST00000301244_chr19_38774267_+_1193aa
MAEEEVAKLEKHLMLLRQEYVKLQKKLAETEKRCALLAAQANKESSSESFISRLLAIVADLYEQEQYSDLKIKVGDRHISAHKFVLAARS
DSWSLANLSSTKELDLSDANPEVTMTMLRWIYTDELEFREDDVFLTELMKLANRFQLQLLRERCEKGVMSLVNVRNCIRFYQTAEELNAS
TLMNYCAEIIASHWDDLRKEDFSSMSAQLLYKMIKSKTEYPLHKAIKVEREDVVFLYLIEMDSQLPGKLNEADHNGDLALDLALSRRLES
IATTLVSHKADVDMVDKSGWSLLHKGIQRGDLFAATFLIKNGAFVNAATLGAQETPLHLVALYSSKKHSADVMSEMAQIAEALLQAGANP
NMQDSKGRTPLHVSIMAGNEYVFSQLLQCKQLDLELKDHEGSTALWLAVQHITVSSDQSVNPFEDVPVVNGTSFDENSFAARLIQRGSHT
DAPDTATGNCLLQRAAGAGNEAAALFLATNGAHVNHRNKWGETPLHTACRHGLANLTAELLQQGANPNLQTEEALPLPKEAASLTSLADS
VHLQTPLHMAIAYNHPDVVSVILEQKANALHATNNLQIIPDFSLKDSRDQTVLGLALWTGMHTIAAQLLGSGAAINDTMSDGQTLLHMAI
QRQDSKSALFLLEHQADINVSRTQDGETALQLAIRNQLPLVVDAICTRGADMSVPDEKGNPPLWLALANNLEDIASTLVRHGCDATCWGP
GPGGCLQTLLHRAIDENNEPTACFLIRSGCDVNSPRQPGANGEGEEEARDGQTPLHLAASWGLEETVQCLLEFGANVNAQDAEGRTPIHV
AISSQHGVIIQLLVSHPDIHLNVRDRQGLTPFACAMTFKNNKSAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNS
RVQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLENGVDFAAVDENGNNDFCLVSKVVGRCRAS
MPRWWYNVTDGSCQLFVYGGCDGNSNNYLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTG
PCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEEACMLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQER


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ANKFY1_ENST00000341657_chr17_4077204_-_SPINT2_ENST00000301244_chr19_38774267_+_3576nt
ATGGCGGAAGAGGAGGTGGCCAAGTTGGAGAAGCACTTGATGCTTCTGCGGCAGGAGTATGTCAAGCTGCAGAAGAAGCTGGCGGAGACA
GAGAAGCGCTGCGCTCTCTTGGCTGCGCAGGCAAACAAGGAGAGCAGCAGCGAGTCCTTCATCAGCCGTCTGCTGGCCATCGTGGCAGAC
CTCTACGAGCAGGAGCAGTACAGCGATCTGAAGATAAAGGTTGGGGACAGGCACATCAGTGCTCACAAGTTTGTCCTGGCAGCCCGCAGT
GACAGCTGGAGTCTGGCTAACTTGTCTTCCACTAAAGAGTTGGACCTGTCAGATGCTAATCCTGAGGTGACGATGACAATGCTTCGCTGG
ATCTATACAGATGAGCTGGAGTTCAGAGAGGATGATGTGTTCCTGACTGAACTGATGAAACTAGCAAATCGGTTTCAGCTACAGCTCCTC
AGGGAGAGATGTGAGAAGGGTGTTATGTCTCTAGTGAATGTCAGGAACTGTATTCGCTTCTACCAGACGGCAGAGGAGCTGAATGCCAGC
ACACTGATGAACTACTGTGCAGAAATTATTGCAAGTCATTGGGACGACCTGAGGAAGGAGGATTTCAGCAGCATGAGCGCTCAGTTGTTA
TACAAAATGATCAAATCCAAGACAGAGTACCCGCTACATAAAGCCATCAAAGTGGAGAGAGAAGACGTGGTCTTCCTGTATCTGATTGAA
ATGGATTCCCAGCTCCCTGGGAAGCTGAATGAAGCGGATCATAACGGAGATCTGGCATTAGATCTAGCCCTCTCACGACGACTGGAGAGT
ATTGCCACCACGCTGGTTAGTCACAAAGCTGATGTGGACATGGTGGACAAGAGTGGCTGGAGCTTGTTACACAAAGGAATCCAAAGAGGA
GATCTCTTTGCTGCCACTTTCCTCATTAAGAATGGGGCCTTTGTCAACGCTGCTACACTGGGTGCCCAGGAGACACCACTGCACCTTGTG
GCCTTGTACAGTTCAAAGAAACACTCAGCAGATGTGATGTCTGAGATGGCGCAGATTGCAGAGGCCCTTCTGCAGGCTGGTGCCAACCCC
AACATGCAGGACAGCAAGGGGAGGACTCCTTTACATGTGTCCATCATGGCCGGGAATGAATATGTGTTCAGTCAGCTGCTGCAGTGCAAA
CAACTAGATTTAGAACTCAAAGACCACGAGGGCAGCACGGCTCTGTGGCTGGCAGTGCAGCATATCACAGTGTCTTCTGACCAGTCTGTG
AACCCCTTCGAAGATGTCCCCGTGGTAAATGGGACTTCATTTGATGAGAACAGCTTTGCAGCCAGACTCATCCAGCGCGGCAGCCACACA
GACGCACCTGACACGGCGACAGGAAACTGTTTACTACAGCGGGCAGCTGGAGCAGGAAACGAGGCAGCAGCTCTTTTCCTGGCAACCAAC
GGTGCCCATGTCAACCACAGAAACAAGTGGGGAGAAACCCCGTTGCACACAGCGTGTCGGCATGGCCTGGCCAACCTCACGGCAGAGCTC
CTGCAGCAAGGCGCCAACCCAAACCTGCAGACGGAGGAAGCTCTGCCTCTGCCAAAGGAGGCCGCATCCCTGACCAGCTTGGCGGACAGC
GTCCATCTGCAGACGCCACTGCACATGGCGATCGCCTATAACCATCCGGATGTGGTGTCTGTCATCCTGGAGCAGAAAGCCAATGCTCTT
CATGCCACCAACAACTTGCAGATCATTCCGGACTTCAGCCTCAAAGATTCCCGAGACCAGACTGTGCTGGGCCTGGCATTATGGACTGGC
ATGCACACGATCGCAGCCCAGCTGCTGGGCTCTGGAGCCGCCATCAATGACACCATGTCGGATGGGCAGACGCTACTGCACATGGCCATA
CAGCGGCAGGACAGCAAGAGCGCACTCTTCCTGCTGGAGCACCAGGCAGATATAAATGTCAGGACTCAGGACGGGGAGACAGCCCTCCAG
CTGGCCATCAGAAACCAGCTTCCACTCGTAGTTGATGCCATATGCACCCGAGGAGCTGACATGTCTGTGCCAGATGAGAAGGGGAACCCC
CCGCTGTGGCTTGCATTGGCAAACAATCTGGAGGACATCGCATCCACTCTGGTCAGACATGGCTGTGATGCCACATGCTGGGGTCCGGGA
CCTGGTGGGTGCCTTCAGACGCTCCTGCACAGAGCCATTGATGAAAACAACGAGCCCACCGCCTGCTTTCTTATTCGCAGTGGCTGTGAC
GTGAACAGTCCCAGACAACCAGGCGCCAATGGAGAAGGAGAGGAAGAGGCTAGAGATGGGCAGACCCCTTTGCATTTGGCAGCCTCTTGG
GGGCTGGAAGAGACAGTACAGTGTCTTCTGGAGTTTGGTGCCAACGTGAACGCACAGGATGCAGAAGGAAGAACCCCCATCCACGTGGCC
ATCAGCAGCCAACACGGTGTCATCATTCAGCTGTTGGTTTCTCACCCCGATATCCATTTGAATGTACGAGACAGACAAGGGCTGACCCCG
TTTGCCTGTGCCATGACTTTCAAGAACAACAAGTCAGCCGAGGCCATTCTCAAACGAGAGTCCGGGGCTGCTGAGCAGGTGGATAACAAG
GGCCGGAATTTCCTTCATGTGGCAGTTCAGAACTCTGATATTGAAAGTGTGCTGTTCCTGATCAGTGTCCACGCTAATGTGAATTCAAGA
GTCCAGGATGCCTCCAAGTTGACCCCCCTGCACCTCGCTGTCCAAGCAGGCTCAGAAATTATTGTCCGCAATTTGCTTCTTGCGGGAGCC
AAAGTGAACGAATTAACCAAGCATCGCCAGACTGCCCTCCATCTTGCTGCCCAGCAGGACCTGCCCACCATCTGCTCAGTCCTCCTAGAG
AATGGCGTGGACTTTGCTGCCGTGGATGAGAATGGAAACAATGACTTCTGCCTGGTGTCGAAGGTGGTGGGCAGATGCCGGGCCTCCATG
CCTAGGTGGTGGTACAATGTCACTGACGGATCCTGCCAGCTGTTTGTGTATGGGGGCTGTGACGGAAACAGCAATAATTACCTGACCAAG
GAGGAGTGCCTCAAGAAATGTGCCACTGTCACAGAGAATGCCACGGGTGACCTGGCCACCAGCAGGAATGCAGCGGATTCCTCTGTCCCA
AGTGCTCCCAGAAGGCAGGATTCTGAAGACCACTCCAGCGATATGTTCAACTATGAAGAATACTGCACCGCCAACGCAGTCACTGGGCCT
TGCCGTGCATCCTTCCCACGCTGGTACTTTGACGTGGAGAGGAACTCCTGCAATAACTTCATCTATGGAGGCTGCCGGGGCAATAAGAAC
AGCTACCGCTCTGAGGAGGCCTGCATGCTCCGCTGCTTCCGCCAGCAGGAGAATCCTCCCCTGCCCCTTGGCTCAAAGGTGGTGGTTCTG
GCGGGGCTGTTCGTGATGGTGTTGATCCTCTTCCTGGGAGCCTCCATGGTCTACCTGATCCGGGTGGCACGGAGGAACCAGGAGCGTGCC

>In-frame_ANKFY1_ENST00000570535_chr17_4077204_-_SPINT2_ENST00000301244_chr19_38774267_+_3702nt
ATGCCGACCCCGCGGGACTGCGGCCGGCTGCGGAGCCGGGCTGGCAGGTCCCGCGCCGGTGCTGCGTGCAGCCGCGGGGCCCCGAGGGCA
GCACGGGAGGCTCTTGATTGCCGGCGGTGCCGGGACGCCGGGGGAAAGGAGGTGGCCAAGTTGGAGAAGCACTTGATGCTTCTGCGGCAG
GAGTATGTCAAGCTGCAGAAGAAGCTGGCGGAGACAGAGAAGCGCTGCGCTCTCTTGGCTGCGCAGGCAAACAAGGAGAGCAGCAGCGAG
TCCTTCATCAGCCGTCTGCTGGCCATCGTGGCAGACCTCTACGAGCAGGAGCAGTACAGCGATCTGAAGATAAAGGTTGGGGACAGGCAC
ATCAGTGCTCACAAGTTTGTCCTGGCAGCCCGCAGTGACAGCTGGAGTCTGGCTAACTTGTCTTCCACTAAAGAGTTGGACCTGTCAGAT
GCTAATCCTGAGGTGACGATGACAATGCTTCGCTGGATCTATACAGATGAGCTGGAGTTCAGAGAGGATGATGTGTTCCTGACTGAACTG
ATGAAACTAGCAAATCGGTTTCAGCTACAGCTCCTCAGGGAGAGATGTGAGAAGGGTGTTATGTCTCTAGTGAATGTCAGGAACTGTATT
CGCTTCTACCAGACGGCAGAGGAGCTGAATGCCAGCACACTGATGAACTACTGTGCAGAAATTATTGCAAGTCATTGGGACGACCTGAGG
AAGGAGGATTTCAGCAGCATGAGCGCTCAGTTGTTATACAAAATGATCAAATCCAAGACAGAGTACCCGCTACATAAAGCCATCAAAGTG
GAGAGAGAAGACGTGGTCTTCCTGTATCTGATTGAAATGGATTCCCAGCTCCCTGGGAAGCTGAATGAAGCGGATCATAACGGAGATCTG
GCATTAGATCTAGCCCTCTCACGACGACTGGAGAGTATTGCCACCACGCTGGTTAGTCACAAAGCTGATGTGGACATGGTGGACAAGAGT
GGCTGGAGCTTGTTACACAAAGGAATCCAAAGAGGAGATCTCTTTGCTGCCACTTTCCTCATTAAGAATGGGGCCTTTGTCAACGCTGCT
ACACTGGGTGCCCAGGAGACACCACTGCACCTTGTGGCCTTGTACAGTTCAAAGAAACACTCAGCAGATGTGATGTCTGAGATGGCGCAG
ATTGCAGAGGCCCTTCTGCAGGCTGGTGCCAACCCCAACATGCAGGACAGCAAGGGGAGGACTCCTTTACATGTGTCCATCATGGCCGGG
AATGAATATGTGTTCAGTCAGCTGCTGCAGTGCAAACAACTAGATTTAGAACTCAAAGACCACGAGGGCAGCACGGCTCTGTGGCTGGCA
GTGCAGCATATCACAGTGTCTTCTGACCAGTCTGTGAACCCCTTCGAAGATGTCCCCGTGGTAAATGGGACTTCATTTGATGAGAACAGC
TTTGCAGCCAGACTCATCCAGCGCGGCAGCCACACAGACGCACCTGACACGGCGACAGGAAACTGTTTACTACAGCGGGCAGCTGGAGCA
GGAAACGAGGCAGCAGCTCTTTTCCTGGCAACCAACGGTGCCCATGTCAACCACAGAAACAAGTGGGGAGAAACCCCGTTGCACACAGCG
TGTCGGCATGGCCTGGCCAACCTCACGGCAGAGCTCCTGCAGCAAGGCGCCAACCCAAACCTGCAGACGGAGGAAGCTCTGCCTCTGCCA
AAGGAGGCCGCATCCCTGACCAGCTTGGCGGACAGCGTCCATCTGCAGACGCCACTGCACATGGCGATCGCCTATAACCATCCGGATGTG
GTGTCTGTCATCCTGGAGCAGAAAGCCAATGCTCTTCATGCCACCAACAACTTGCAGATCATTCCGGACTTCAGCCTCAAAGATTCCCGA
GACCAGACTGTGCTGGGCCTGGCATTATGGACTGGCATGCACACGATCGCAGCCCAGCTGCTGGGCTCTGGAGCCGCCATCAATGACACC
ATGTCGGATGGGCAGACGCTACTGCACATGGCCATACAGCGGCAGGACAGCAAGAGCGCACTCTTCCTGCTGGAGCACCAGGCAGATATA
AATGTCAGGACTCAGGACGGGGAGACAGCCCTCCAGCTGGCCATCAGAAACCAGCTTCCACTCGTAGTTGATGCCATATGCACCCGAGGA
GCTGACATGTCTGTGCCAGATGAGAAGGGGAACCCCCCGCTGTGGCTTGCATTGGCAAACAATCTGGAGGACATCGCATCCACTCTGGTC
AGACATGGCTGTGATGCCACATGCTGGGGTCCGGGACCTGGTGGGTGCCTTCAGACGCTCCTGCACAGAGCCATTGATGAAAACAACGAG
CCCACCGCCTGCTTTCTTATTCGCAGTGGCTGTGACGTGAACAGTCCCAGACAACCAGGCGCCAATGGAGAAGGAGAGGAAGAGGCTAGA
GATGGGCAGACCCCTTTGCATTTGGCAGCCTCTTGGGGGCTGGAAGAGACAGTACAGTGTCTTCTGGAGTTTGGTGCCAACGTGAACGCA
CAGGATGCAGAAGGAAGAACCCCCATCCACGTGGCCATCAGCAGCCAACACGGTGTCATCATTCAGCTGTTGGTTTCTCACCCCGATATC
CATTTGAATGTACGAGACAGACAAGGGCTGACCCCGTTTGCCTGTGCCATGACTTTCAAGAACAACAAGTCAGCCGAGGCCATTCTCAAA
CGAGAGTCCGGGGCTGCTGAGCAGGTGGATAACAAGGGCCGGAATTTCCTTCATGTGGCAGTTCAGAACTCTGATATTGAAAGTGTGCTG
TTCCTGATCAGTGTCCACGCTAATGTGAATTCAAGAGTCCAGGATGCCTCCAAGTTGACCCCCCTGCACCTCGCTGTCCAAGCAGGCTCA
GAAATTATTGTCCGCAATTTGCTTCTTGCGGGAGCCAAAGTGAACGAATTAACCAAGCATCGCCAGACTGCCCTCCATCTTGCTGCCCAG
CAGGACCTGCCCACCATCTGCTCAGTCCTCCTAGAGAATGGCGTGGACTTTGCTGCCGTGGATGAGAATGGAAACAATGACTTCTGCCTG
GTGTCGAAGGTGGTGGGCAGATGCCGGGCCTCCATGCCTAGGTGGTGGTACAATGTCACTGACGGATCCTGCCAGCTGTTTGTGTATGGG
GGCTGTGACGGAAACAGCAATAATTACCTGACCAAGGAGGAGTGCCTCAAGAAATGTGCCACTGTCACAGAGAATGCCACGGGTGACCTG
GCCACCAGCAGGAATGCAGCGGATTCCTCTGTCCCAAGTGCTCCCAGAAGGCAGGATTCTGAAGACCACTCCAGCGATATGTTCAACTAT
GAAGAATACTGCACCGCCAACGCAGTCACTGGGCCTTGCCGTGCATCCTTCCCACGCTGGTACTTTGACGTGGAGAGGAACTCCTGCAAT
AACTTCATCTATGGAGGCTGCCGGGGCAATAAGAACAGCTACCGCTCTGAGGAGGCCTGCATGCTCCGCTGCTTCCGCCAGCAGGAGAAT
CCTCCCCTGCCCCTTGGCTCAAAGGTGGTGGTTCTGGCGGGGCTGTTCGTGATGGTGTTGATCCTCTTCCTGGGAGCCTCCATGGTCTAC
CTGATCCGGGTGGCACGGAGGAACCAGGAGCGTGCCCTGCGCACCGTCTGGAGCTCCGGAGATGACAAGGAGCAGCTGGTGAAGAACACA

>In-frame_ANKFY1_ENST00000574367_chr17_4077204_-_SPINT2_ENST00000301244_chr19_38774267_+_3579nt
ATGGCGGAAGAGGAGGTGGCCAAGTTGGAGAAGCACTTGATGCTTCTGCGGCAGGAGTATGTCAAGCTGCAGAAGAAGCTGGCGGAGACA
GAGAAGCGCTGCGCTCTCTTGGCTGCGCAGGCAAACAAGGAGAGCAGCAGCGAGTCCTTCATCAGCCGTCTGCTGGCCATCGTGGCAGAC
CTCTACGAGCAGGAGCAGTACAGCGATCTGAAGATAAAGGTTGGGGACAGGCACATCAGTGCTCACAAGTTTGTCCTGGCAGCCCGCAGT
GACAGCTGGAGTCTGGCTAACTTGTCTTCCACTAAAGAGTTGGACCTGTCAGATGCTAATCCTGAGGTGACGATGACAATGCTTCGCTGG
ATCTATACAGATGAGCTGGAGTTCAGAGAGGATGATGTGTTCCTGACTGAACTGATGAAACTAGCAAATCGGTTTCAGCTACAGCTCCTC
AGGGAGAGATGTGAGAAGGGTGTTATGTCTCTAGTGAATGTCAGGAACTGTATTCGCTTCTACCAGACGGCAGAGGAGCTGAATGCCAGC
ACACTGATGAACTACTGTGCAGAAATTATTGCAAGTCATTGGGACGACCTGAGGAAGGAGGATTTCAGCAGCATGAGCGCTCAGTTGTTA
TACAAAATGATCAAATCCAAGACAGAGTACCCGCTACATAAAGCCATCAAAGTGGAGAGAGAAGACGTGGTCTTCCTGTATCTGATTGAA
ATGGATTCCCAGCTCCCTGGGAAGCTGAATGAAGCGGATCATAACGGAGATCTGGCATTAGATCTAGCCCTCTCACGACGACTGGAGAGT
ATTGCCACCACGCTGGTTAGTCACAAAGCTGATGTGGACATGGTGGACAAGAGTGGCTGGAGCTTGTTACACAAAGGAATCCAAAGAGGA
GATCTCTTTGCTGCCACTTTCCTCATTAAGAATGGGGCCTTTGTCAACGCTGCTACACTGGGTGCCCAGGAGACACCACTGCACCTTGTG
GCCTTGTACAGTTCAAAGAAACACTCAGCAGATGTGATGTCTGAGATGGCGCAGATTGCAGAGGCCCTTCTGCAGGCTGGTGCCAACCCC
AACATGCAGGACAGCAAGGGGAGGACTCCTTTACATGTGTCCATCATGGCCGGGAATGAATATGTGTTCAGTCAGCTGCTGCAGTGCAAA
CAACTAGATTTAGAACTCAAAGACCACGAGGGCAGCACGGCTCTGTGGCTGGCAGTGCAGCATATCACAGTGTCTTCTGACCAGTCTGTG
AACCCCTTCGAAGATGTCCCCGTGGTAAATGGGACTTCATTTGATGAGAACAGCTTTGCAGCCAGACTCATCCAGCGCGGCAGCCACACA
GACGCACCTGACACGGCGACAGGAAACTGTTTACTACAGCGGGCAGCTGGAGCAGGAAACGAGGCAGCAGCTCTTTTCCTGGCAACCAAC
GGTGCCCATGTCAACCACAGAAACAAGTGGGGAGAAACCCCGTTGCACACAGCGTGTCGGCATGGCCTGGCCAACCTCACGGCAGAGCTC
CTGCAGCAAGGCGCCAACCCAAACCTGCAGACGGAGGAAGCTCTGCCTCTGCCAAAGGAGGCCGCATCCCTGACCAGCTTGGCGGACAGC
GTCCATCTGCAGACGCCACTGCACATGGCGATCGCCTATAACCATCCGGATGTGGTGTCTGTCATCCTGGAGCAGAAAGCCAATGCTCTT
CATGCCACCAACAACTTGCAGATCATTCCGGACTTCAGCCTCAAAGATTCCCGAGACCAGACTGTGCTGGGCCTGGCATTATGGACTGGC
ATGCACACGATCGCAGCCCAGCTGCTGGGCTCTGGAGCCGCCATCAATGACACCATGTCGGATGGGCAGACGCTACTGCACATGGCCATA
CAGCGGCAGGACAGCAAGAGCGCACTCTTCCTGCTGGAGCACCAGGCAGATATAAATGTCAGCAGGACTCAGGACGGGGAGACAGCCCTC
CAGCTGGCCATCAGAAACCAGCTTCCACTCGTAGTTGATGCCATATGCACCCGAGGAGCTGACATGTCTGTGCCAGATGAGAAGGGGAAC
CCCCCGCTGTGGCTTGCATTGGCAAACAATCTGGAGGACATCGCATCCACTCTGGTCAGACATGGCTGTGATGCCACATGCTGGGGTCCG
GGACCTGGTGGGTGCCTTCAGACGCTCCTGCACAGAGCCATTGATGAAAACAACGAGCCCACCGCCTGCTTTCTTATTCGCAGTGGCTGT
GACGTGAACAGTCCCAGACAACCAGGCGCCAATGGAGAAGGAGAGGAAGAGGCTAGAGATGGGCAGACCCCTTTGCATTTGGCAGCCTCT
TGGGGGCTGGAAGAGACAGTACAGTGTCTTCTGGAGTTTGGTGCCAACGTGAACGCACAGGATGCAGAAGGAAGAACCCCCATCCACGTG
GCCATCAGCAGCCAACACGGTGTCATCATTCAGCTGTTGGTTTCTCACCCCGATATCCATTTGAATGTACGAGACAGACAAGGGCTGACC
CCGTTTGCCTGTGCCATGACTTTCAAGAACAACAAGTCAGCCGAGGCCATTCTCAAACGAGAGTCCGGGGCTGCTGAGCAGGTGGATAAC
AAGGGCCGGAATTTCCTTCATGTGGCAGTTCAGAACTCTGATATTGAAAGTGTGCTGTTCCTGATCAGTGTCCACGCTAATGTGAATTCA
AGAGTCCAGGATGCCTCCAAGTTGACCCCCCTGCACCTCGCTGTCCAAGCAGGCTCAGAAATTATTGTCCGCAATTTGCTTCTTGCGGGA
GCCAAAGTGAACGAATTAACCAAGCATCGCCAGACTGCCCTCCATCTTGCTGCCCAGCAGGACCTGCCCACCATCTGCTCAGTCCTCCTA
GAGAATGGCGTGGACTTTGCTGCCGTGGATGAGAATGGAAACAATGACTTCTGCCTGGTGTCGAAGGTGGTGGGCAGATGCCGGGCCTCC
ATGCCTAGGTGGTGGTACAATGTCACTGACGGATCCTGCCAGCTGTTTGTGTATGGGGGCTGTGACGGAAACAGCAATAATTACCTGACC
AAGGAGGAGTGCCTCAAGAAATGTGCCACTGTCACAGAGAATGCCACGGGTGACCTGGCCACCAGCAGGAATGCAGCGGATTCCTCTGTC
CCAAGTGCTCCCAGAAGGCAGGATTCTGAAGACCACTCCAGCGATATGTTCAACTATGAAGAATACTGCACCGCCAACGCAGTCACTGGG
CCTTGCCGTGCATCCTTCCCACGCTGGTACTTTGACGTGGAGAGGAACTCCTGCAATAACTTCATCTATGGAGGCTGCCGGGGCAATAAG
AACAGCTACCGCTCTGAGGAGGCCTGCATGCTCCGCTGCTTCCGCCAGCAGGAGAATCCTCCCCTGCCCCTTGGCTCAAAGGTGGTGGTT
CTGGCGGGGCTGTTCGTGATGGTGTTGATCCTCTTCCTGGGAGCCTCCATGGTCTACCTGATCCGGGTGGCACGGAGGAACCAGGAGCGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ANKFY1_ENST00000341657_chr17_4077204_-_SPINT2_ENST00000301244_chr19_38774267_+_4220nt
ACTTCTCGCGAGGTTGCAGGCAGTGCCGGGCCAGACATGGCGGAAGAGGAGGTGGCCAAGTTGGAGAAGCACTTGATGCTTCTGCGGCAG
GAGTATGTCAAGCTGCAGAAGAAGCTGGCGGAGACAGAGAAGCGCTGCGCTCTCTTGGCTGCGCAGGCAAACAAGGAGAGCAGCAGCGAG
TCCTTCATCAGCCGTCTGCTGGCCATCGTGGCAGACCTCTACGAGCAGGAGCAGTACAGCGATCTGAAGATAAAGGTTGGGGACAGGCAC
ATCAGTGCTCACAAGTTTGTCCTGGCAGCCCGCAGTGACAGCTGGAGTCTGGCTAACTTGTCTTCCACTAAAGAGTTGGACCTGTCAGAT
GCTAATCCTGAGGTGACGATGACAATGCTTCGCTGGATCTATACAGATGAGCTGGAGTTCAGAGAGGATGATGTGTTCCTGACTGAACTG
ATGAAACTAGCAAATCGGTTTCAGCTACAGCTCCTCAGGGAGAGATGTGAGAAGGGTGTTATGTCTCTAGTGAATGTCAGGAACTGTATT
CGCTTCTACCAGACGGCAGAGGAGCTGAATGCCAGCACACTGATGAACTACTGTGCAGAAATTATTGCAAGTCATTGGGACGACCTGAGG
AAGGAGGATTTCAGCAGCATGAGCGCTCAGTTGTTATACAAAATGATCAAATCCAAGACAGAGTACCCGCTACATAAAGCCATCAAAGTG
GAGAGAGAAGACGTGGTCTTCCTGTATCTGATTGAAATGGATTCCCAGCTCCCTGGGAAGCTGAATGAAGCGGATCATAACGGAGATCTG
GCATTAGATCTAGCCCTCTCACGACGACTGGAGAGTATTGCCACCACGCTGGTTAGTCACAAAGCTGATGTGGACATGGTGGACAAGAGT
GGCTGGAGCTTGTTACACAAAGGAATCCAAAGAGGAGATCTCTTTGCTGCCACTTTCCTCATTAAGAATGGGGCCTTTGTCAACGCTGCT
ACACTGGGTGCCCAGGAGACACCACTGCACCTTGTGGCCTTGTACAGTTCAAAGAAACACTCAGCAGATGTGATGTCTGAGATGGCGCAG
ATTGCAGAGGCCCTTCTGCAGGCTGGTGCCAACCCCAACATGCAGGACAGCAAGGGGAGGACTCCTTTACATGTGTCCATCATGGCCGGG
AATGAATATGTGTTCAGTCAGCTGCTGCAGTGCAAACAACTAGATTTAGAACTCAAAGACCACGAGGGCAGCACGGCTCTGTGGCTGGCA
GTGCAGCATATCACAGTGTCTTCTGACCAGTCTGTGAACCCCTTCGAAGATGTCCCCGTGGTAAATGGGACTTCATTTGATGAGAACAGC
TTTGCAGCCAGACTCATCCAGCGCGGCAGCCACACAGACGCACCTGACACGGCGACAGGAAACTGTTTACTACAGCGGGCAGCTGGAGCA
GGAAACGAGGCAGCAGCTCTTTTCCTGGCAACCAACGGTGCCCATGTCAACCACAGAAACAAGTGGGGAGAAACCCCGTTGCACACAGCG
TGTCGGCATGGCCTGGCCAACCTCACGGCAGAGCTCCTGCAGCAAGGCGCCAACCCAAACCTGCAGACGGAGGAAGCTCTGCCTCTGCCA
AAGGAGGCCGCATCCCTGACCAGCTTGGCGGACAGCGTCCATCTGCAGACGCCACTGCACATGGCGATCGCCTATAACCATCCGGATGTG
GTGTCTGTCATCCTGGAGCAGAAAGCCAATGCTCTTCATGCCACCAACAACTTGCAGATCATTCCGGACTTCAGCCTCAAAGATTCCCGA
GACCAGACTGTGCTGGGCCTGGCATTATGGACTGGCATGCACACGATCGCAGCCCAGCTGCTGGGCTCTGGAGCCGCCATCAATGACACC
ATGTCGGATGGGCAGACGCTACTGCACATGGCCATACAGCGGCAGGACAGCAAGAGCGCACTCTTCCTGCTGGAGCACCAGGCAGATATA
AATGTCAGGACTCAGGACGGGGAGACAGCCCTCCAGCTGGCCATCAGAAACCAGCTTCCACTCGTAGTTGATGCCATATGCACCCGAGGA
GCTGACATGTCTGTGCCAGATGAGAAGGGGAACCCCCCGCTGTGGCTTGCATTGGCAAACAATCTGGAGGACATCGCATCCACTCTGGTC
AGACATGGCTGTGATGCCACATGCTGGGGTCCGGGACCTGGTGGGTGCCTTCAGACGCTCCTGCACAGAGCCATTGATGAAAACAACGAG
CCCACCGCCTGCTTTCTTATTCGCAGTGGCTGTGACGTGAACAGTCCCAGACAACCAGGCGCCAATGGAGAAGGAGAGGAAGAGGCTAGA
GATGGGCAGACCCCTTTGCATTTGGCAGCCTCTTGGGGGCTGGAAGAGACAGTACAGTGTCTTCTGGAGTTTGGTGCCAACGTGAACGCA
CAGGATGCAGAAGGAAGAACCCCCATCCACGTGGCCATCAGCAGCCAACACGGTGTCATCATTCAGCTGTTGGTTTCTCACCCCGATATC
CATTTGAATGTACGAGACAGACAAGGGCTGACCCCGTTTGCCTGTGCCATGACTTTCAAGAACAACAAGTCAGCCGAGGCCATTCTCAAA
CGAGAGTCCGGGGCTGCTGAGCAGGTGGATAACAAGGGCCGGAATTTCCTTCATGTGGCAGTTCAGAACTCTGATATTGAAAGTGTGCTG
TTCCTGATCAGTGTCCACGCTAATGTGAATTCAAGAGTCCAGGATGCCTCCAAGTTGACCCCCCTGCACCTCGCTGTCCAAGCAGGCTCA
GAAATTATTGTCCGCAATTTGCTTCTTGCGGGAGCCAAAGTGAACGAATTAACCAAGCATCGCCAGACTGCCCTCCATCTTGCTGCCCAG
CAGGACCTGCCCACCATCTGCTCAGTCCTCCTAGAGAATGGCGTGGACTTTGCTGCCGTGGATGAGAATGGAAACAATGACTTCTGCCTG
GTGTCGAAGGTGGTGGGCAGATGCCGGGCCTCCATGCCTAGGTGGTGGTACAATGTCACTGACGGATCCTGCCAGCTGTTTGTGTATGGG
GGCTGTGACGGAAACAGCAATAATTACCTGACCAAGGAGGAGTGCCTCAAGAAATGTGCCACTGTCACAGAGAATGCCACGGGTGACCTG
GCCACCAGCAGGAATGCAGCGGATTCCTCTGTCCCAAGTGCTCCCAGAAGGCAGGATTCTGAAGACCACTCCAGCGATATGTTCAACTAT
GAAGAATACTGCACCGCCAACGCAGTCACTGGGCCTTGCCGTGCATCCTTCCCACGCTGGTACTTTGACGTGGAGAGGAACTCCTGCAAT
AACTTCATCTATGGAGGCTGCCGGGGCAATAAGAACAGCTACCGCTCTGAGGAGGCCTGCATGCTCCGCTGCTTCCGCCAGCAGGAGAAT
CCTCCCCTGCCCCTTGGCTCAAAGGTGGTGGTTCTGGCGGGGCTGTTCGTGATGGTGTTGATCCTCTTCCTGGGAGCCTCCATGGTCTAC
CTGATCCGGGTGGCACGGAGGAACCAGGAGCGTGCCCTGCGCACCGTCTGGAGCTCCGGAGATGACAAGGAGCAGCTGGTGAAGAACACA
TATGTCCTGTGACCGCCCTGTCGCCAAGAGGACTGGGGAAGGGAGGGGAGACTATGTGTGAGCTTTTTTTAAATAGAGGGATTGACTCGG
ATTTGAGTGATCATTAGGGCTGAGGTCTGTTTCTCTGGGAGGTAGGACGGCTGCTTCCTGGTCTGGCAGGGATGGGTTTGCTTTGGAAAT
CCTCTAGGAGGCTCCTCCTCGCATGGCCTGCAGTCTGGCAGCAGCCCCGAGTTGTTTCCTCGCTGATCGATTTCTTTCCTCCAGGTAGAG
TTTTCTTTGCTTATGTTGAATTCCATTGCCTCTTTTCTCATCACAGAAGTGATGTTGGAATCGTTTCTTTTGTTTGTCTGATTTATGGTT
TTTTTAAGTATAAACAAAAGTTTTTTATTAGCATTCTGAAAGAAGGAAAGTAAAATGTACAAGTTTAATAAAAAGGGGCCTTCCCCTTTA
GAATAAATTTCAGCATGTGCTTTCTTTATGGGAGTCCTAATTTCAACCCTACCAAAATGATCACAAGACACTATCTGAGGTGTCCCATTC

>In-frame_ANKFY1_ENST00000570535_chr17_4077204_-_SPINT2_ENST00000301244_chr19_38774267_+_4427nt
GGCCGGGCGTGGTTGCATGGGGGCTCCGCGGGTCTCGCGAGCCTTCCTGTCTAGCCTCTCCGGAGCTTCTCGGGCCGGGGTCCGGAGCGC
GGTTCCTATGACAACGTCCCTCCCGCGATGCCGACCCCGCGGGACTGCGGCCGGCTGCGGAGCCGGGCTGGCAGGTCCCGCGCCGGTGCT
GCGTGCAGCCGCGGGGCCCCGAGGGCAGCACGGGAGGCTCTTGATTGCCGGCGGTGCCGGGACGCCGGGGGAAAGGAGGTGGCCAAGTTG
GAGAAGCACTTGATGCTTCTGCGGCAGGAGTATGTCAAGCTGCAGAAGAAGCTGGCGGAGACAGAGAAGCGCTGCGCTCTCTTGGCTGCG
CAGGCAAACAAGGAGAGCAGCAGCGAGTCCTTCATCAGCCGTCTGCTGGCCATCGTGGCAGACCTCTACGAGCAGGAGCAGTACAGCGAT
CTGAAGATAAAGGTTGGGGACAGGCACATCAGTGCTCACAAGTTTGTCCTGGCAGCCCGCAGTGACAGCTGGAGTCTGGCTAACTTGTCT
TCCACTAAAGAGTTGGACCTGTCAGATGCTAATCCTGAGGTGACGATGACAATGCTTCGCTGGATCTATACAGATGAGCTGGAGTTCAGA
GAGGATGATGTGTTCCTGACTGAACTGATGAAACTAGCAAATCGGTTTCAGCTACAGCTCCTCAGGGAGAGATGTGAGAAGGGTGTTATG
TCTCTAGTGAATGTCAGGAACTGTATTCGCTTCTACCAGACGGCAGAGGAGCTGAATGCCAGCACACTGATGAACTACTGTGCAGAAATT
ATTGCAAGTCATTGGGACGACCTGAGGAAGGAGGATTTCAGCAGCATGAGCGCTCAGTTGTTATACAAAATGATCAAATCCAAGACAGAG
TACCCGCTACATAAAGCCATCAAAGTGGAGAGAGAAGACGTGGTCTTCCTGTATCTGATTGAAATGGATTCCCAGCTCCCTGGGAAGCTG
AATGAAGCGGATCATAACGGAGATCTGGCATTAGATCTAGCCCTCTCACGACGACTGGAGAGTATTGCCACCACGCTGGTTAGTCACAAA
GCTGATGTGGACATGGTGGACAAGAGTGGCTGGAGCTTGTTACACAAAGGAATCCAAAGAGGAGATCTCTTTGCTGCCACTTTCCTCATT
AAGAATGGGGCCTTTGTCAACGCTGCTACACTGGGTGCCCAGGAGACACCACTGCACCTTGTGGCCTTGTACAGTTCAAAGAAACACTCA
GCAGATGTGATGTCTGAGATGGCGCAGATTGCAGAGGCCCTTCTGCAGGCTGGTGCCAACCCCAACATGCAGGACAGCAAGGGGAGGACT
CCTTTACATGTGTCCATCATGGCCGGGAATGAATATGTGTTCAGTCAGCTGCTGCAGTGCAAACAACTAGATTTAGAACTCAAAGACCAC
GAGGGCAGCACGGCTCTGTGGCTGGCAGTGCAGCATATCACAGTGTCTTCTGACCAGTCTGTGAACCCCTTCGAAGATGTCCCCGTGGTA
AATGGGACTTCATTTGATGAGAACAGCTTTGCAGCCAGACTCATCCAGCGCGGCAGCCACACAGACGCACCTGACACGGCGACAGGAAAC
TGTTTACTACAGCGGGCAGCTGGAGCAGGAAACGAGGCAGCAGCTCTTTTCCTGGCAACCAACGGTGCCCATGTCAACCACAGAAACAAG
TGGGGAGAAACCCCGTTGCACACAGCGTGTCGGCATGGCCTGGCCAACCTCACGGCAGAGCTCCTGCAGCAAGGCGCCAACCCAAACCTG
CAGACGGAGGAAGCTCTGCCTCTGCCAAAGGAGGCCGCATCCCTGACCAGCTTGGCGGACAGCGTCCATCTGCAGACGCCACTGCACATG
GCGATCGCCTATAACCATCCGGATGTGGTGTCTGTCATCCTGGAGCAGAAAGCCAATGCTCTTCATGCCACCAACAACTTGCAGATCATT
CCGGACTTCAGCCTCAAAGATTCCCGAGACCAGACTGTGCTGGGCCTGGCATTATGGACTGGCATGCACACGATCGCAGCCCAGCTGCTG
GGCTCTGGAGCCGCCATCAATGACACCATGTCGGATGGGCAGACGCTACTGCACATGGCCATACAGCGGCAGGACAGCAAGAGCGCACTC
TTCCTGCTGGAGCACCAGGCAGATATAAATGTCAGGACTCAGGACGGGGAGACAGCCCTCCAGCTGGCCATCAGAAACCAGCTTCCACTC
GTAGTTGATGCCATATGCACCCGAGGAGCTGACATGTCTGTGCCAGATGAGAAGGGGAACCCCCCGCTGTGGCTTGCATTGGCAAACAAT
CTGGAGGACATCGCATCCACTCTGGTCAGACATGGCTGTGATGCCACATGCTGGGGTCCGGGACCTGGTGGGTGCCTTCAGACGCTCCTG
CACAGAGCCATTGATGAAAACAACGAGCCCACCGCCTGCTTTCTTATTCGCAGTGGCTGTGACGTGAACAGTCCCAGACAACCAGGCGCC
AATGGAGAAGGAGAGGAAGAGGCTAGAGATGGGCAGACCCCTTTGCATTTGGCAGCCTCTTGGGGGCTGGAAGAGACAGTACAGTGTCTT
CTGGAGTTTGGTGCCAACGTGAACGCACAGGATGCAGAAGGAAGAACCCCCATCCACGTGGCCATCAGCAGCCAACACGGTGTCATCATT
CAGCTGTTGGTTTCTCACCCCGATATCCATTTGAATGTACGAGACAGACAAGGGCTGACCCCGTTTGCCTGTGCCATGACTTTCAAGAAC
AACAAGTCAGCCGAGGCCATTCTCAAACGAGAGTCCGGGGCTGCTGAGCAGGTGGATAACAAGGGCCGGAATTTCCTTCATGTGGCAGTT
CAGAACTCTGATATTGAAAGTGTGCTGTTCCTGATCAGTGTCCACGCTAATGTGAATTCAAGAGTCCAGGATGCCTCCAAGTTGACCCCC
CTGCACCTCGCTGTCCAAGCAGGCTCAGAAATTATTGTCCGCAATTTGCTTCTTGCGGGAGCCAAAGTGAACGAATTAACCAAGCATCGC
CAGACTGCCCTCCATCTTGCTGCCCAGCAGGACCTGCCCACCATCTGCTCAGTCCTCCTAGAGAATGGCGTGGACTTTGCTGCCGTGGAT
GAGAATGGAAACAATGACTTCTGCCTGGTGTCGAAGGTGGTGGGCAGATGCCGGGCCTCCATGCCTAGGTGGTGGTACAATGTCACTGAC
GGATCCTGCCAGCTGTTTGTGTATGGGGGCTGTGACGGAAACAGCAATAATTACCTGACCAAGGAGGAGTGCCTCAAGAAATGTGCCACT
GTCACAGAGAATGCCACGGGTGACCTGGCCACCAGCAGGAATGCAGCGGATTCCTCTGTCCCAAGTGCTCCCAGAAGGCAGGATTCTGAA
GACCACTCCAGCGATATGTTCAACTATGAAGAATACTGCACCGCCAACGCAGTCACTGGGCCTTGCCGTGCATCCTTCCCACGCTGGTAC
TTTGACGTGGAGAGGAACTCCTGCAATAACTTCATCTATGGAGGCTGCCGGGGCAATAAGAACAGCTACCGCTCTGAGGAGGCCTGCATG
CTCCGCTGCTTCCGCCAGCAGGAGAATCCTCCCCTGCCCCTTGGCTCAAAGGTGGTGGTTCTGGCGGGGCTGTTCGTGATGGTGTTGATC
CTCTTCCTGGGAGCCTCCATGGTCTACCTGATCCGGGTGGCACGGAGGAACCAGGAGCGTGCCCTGCGCACCGTCTGGAGCTCCGGAGAT
GACAAGGAGCAGCTGGTGAAGAACACATATGTCCTGTGACCGCCCTGTCGCCAAGAGGACTGGGGAAGGGAGGGGAGACTATGTGTGAGC
TTTTTTTAAATAGAGGGATTGACTCGGATTTGAGTGATCATTAGGGCTGAGGTCTGTTTCTCTGGGAGGTAGGACGGCTGCTTCCTGGTC
TGGCAGGGATGGGTTTGCTTTGGAAATCCTCTAGGAGGCTCCTCCTCGCATGGCCTGCAGTCTGGCAGCAGCCCCGAGTTGTTTCCTCGC
TGATCGATTTCTTTCCTCCAGGTAGAGTTTTCTTTGCTTATGTTGAATTCCATTGCCTCTTTTCTCATCACAGAAGTGATGTTGGAATCG
TTTCTTTTGTTTGTCTGATTTATGGTTTTTTTAAGTATAAACAAAAGTTTTTTATTAGCATTCTGAAAGAAGGAAAGTAAAATGTACAAG
TTTAATAAAAAGGGGCCTTCCCCTTTAGAATAAATTTCAGCATGTGCTTTCTTTATGGGAGTCCTAATTTCAACCCTACCAAAATGATCA
CAAGACACTATCTGAGGTGTCCCATTCTAGAAATAGACCCCTCAAAATAGCGTCTTTCAGATCTTTTTGAATGAATCCACAAGATGAAAT

>In-frame_ANKFY1_ENST00000574367_chr17_4077204_-_SPINT2_ENST00000301244_chr19_38774267_+_4202nt
AGTGCCGGGCCAGACATGGCGGAAGAGGAGGTGGCCAAGTTGGAGAAGCACTTGATGCTTCTGCGGCAGGAGTATGTCAAGCTGCAGAAG
AAGCTGGCGGAGACAGAGAAGCGCTGCGCTCTCTTGGCTGCGCAGGCAAACAAGGAGAGCAGCAGCGAGTCCTTCATCAGCCGTCTGCTG
GCCATCGTGGCAGACCTCTACGAGCAGGAGCAGTACAGCGATCTGAAGATAAAGGTTGGGGACAGGCACATCAGTGCTCACAAGTTTGTC
CTGGCAGCCCGCAGTGACAGCTGGAGTCTGGCTAACTTGTCTTCCACTAAAGAGTTGGACCTGTCAGATGCTAATCCTGAGGTGACGATG
ACAATGCTTCGCTGGATCTATACAGATGAGCTGGAGTTCAGAGAGGATGATGTGTTCCTGACTGAACTGATGAAACTAGCAAATCGGTTT
CAGCTACAGCTCCTCAGGGAGAGATGTGAGAAGGGTGTTATGTCTCTAGTGAATGTCAGGAACTGTATTCGCTTCTACCAGACGGCAGAG
GAGCTGAATGCCAGCACACTGATGAACTACTGTGCAGAAATTATTGCAAGTCATTGGGACGACCTGAGGAAGGAGGATTTCAGCAGCATG
AGCGCTCAGTTGTTATACAAAATGATCAAATCCAAGACAGAGTACCCGCTACATAAAGCCATCAAAGTGGAGAGAGAAGACGTGGTCTTC
CTGTATCTGATTGAAATGGATTCCCAGCTCCCTGGGAAGCTGAATGAAGCGGATCATAACGGAGATCTGGCATTAGATCTAGCCCTCTCA
CGACGACTGGAGAGTATTGCCACCACGCTGGTTAGTCACAAAGCTGATGTGGACATGGTGGACAAGAGTGGCTGGAGCTTGTTACACAAA
GGAATCCAAAGAGGAGATCTCTTTGCTGCCACTTTCCTCATTAAGAATGGGGCCTTTGTCAACGCTGCTACACTGGGTGCCCAGGAGACA
CCACTGCACCTTGTGGCCTTGTACAGTTCAAAGAAACACTCAGCAGATGTGATGTCTGAGATGGCGCAGATTGCAGAGGCCCTTCTGCAG
GCTGGTGCCAACCCCAACATGCAGGACAGCAAGGGGAGGACTCCTTTACATGTGTCCATCATGGCCGGGAATGAATATGTGTTCAGTCAG
CTGCTGCAGTGCAAACAACTAGATTTAGAACTCAAAGACCACGAGGGCAGCACGGCTCTGTGGCTGGCAGTGCAGCATATCACAGTGTCT
TCTGACCAGTCTGTGAACCCCTTCGAAGATGTCCCCGTGGTAAATGGGACTTCATTTGATGAGAACAGCTTTGCAGCCAGACTCATCCAG
CGCGGCAGCCACACAGACGCACCTGACACGGCGACAGGAAACTGTTTACTACAGCGGGCAGCTGGAGCAGGAAACGAGGCAGCAGCTCTT
TTCCTGGCAACCAACGGTGCCCATGTCAACCACAGAAACAAGTGGGGAGAAACCCCGTTGCACACAGCGTGTCGGCATGGCCTGGCCAAC
CTCACGGCAGAGCTCCTGCAGCAAGGCGCCAACCCAAACCTGCAGACGGAGGAAGCTCTGCCTCTGCCAAAGGAGGCCGCATCCCTGACC
AGCTTGGCGGACAGCGTCCATCTGCAGACGCCACTGCACATGGCGATCGCCTATAACCATCCGGATGTGGTGTCTGTCATCCTGGAGCAG
AAAGCCAATGCTCTTCATGCCACCAACAACTTGCAGATCATTCCGGACTTCAGCCTCAAAGATTCCCGAGACCAGACTGTGCTGGGCCTG
GCATTATGGACTGGCATGCACACGATCGCAGCCCAGCTGCTGGGCTCTGGAGCCGCCATCAATGACACCATGTCGGATGGGCAGACGCTA
CTGCACATGGCCATACAGCGGCAGGACAGCAAGAGCGCACTCTTCCTGCTGGAGCACCAGGCAGATATAAATGTCAGCAGGACTCAGGAC
GGGGAGACAGCCCTCCAGCTGGCCATCAGAAACCAGCTTCCACTCGTAGTTGATGCCATATGCACCCGAGGAGCTGACATGTCTGTGCCA
GATGAGAAGGGGAACCCCCCGCTGTGGCTTGCATTGGCAAACAATCTGGAGGACATCGCATCCACTCTGGTCAGACATGGCTGTGATGCC
ACATGCTGGGGTCCGGGACCTGGTGGGTGCCTTCAGACGCTCCTGCACAGAGCCATTGATGAAAACAACGAGCCCACCGCCTGCTTTCTT
ATTCGCAGTGGCTGTGACGTGAACAGTCCCAGACAACCAGGCGCCAATGGAGAAGGAGAGGAAGAGGCTAGAGATGGGCAGACCCCTTTG
CATTTGGCAGCCTCTTGGGGGCTGGAAGAGACAGTACAGTGTCTTCTGGAGTTTGGTGCCAACGTGAACGCACAGGATGCAGAAGGAAGA
ACCCCCATCCACGTGGCCATCAGCAGCCAACACGGTGTCATCATTCAGCTGTTGGTTTCTCACCCCGATATCCATTTGAATGTACGAGAC
AGACAAGGGCTGACCCCGTTTGCCTGTGCCATGACTTTCAAGAACAACAAGTCAGCCGAGGCCATTCTCAAACGAGAGTCCGGGGCTGCT
GAGCAGGTGGATAACAAGGGCCGGAATTTCCTTCATGTGGCAGTTCAGAACTCTGATATTGAAAGTGTGCTGTTCCTGATCAGTGTCCAC
GCTAATGTGAATTCAAGAGTCCAGGATGCCTCCAAGTTGACCCCCCTGCACCTCGCTGTCCAAGCAGGCTCAGAAATTATTGTCCGCAAT
TTGCTTCTTGCGGGAGCCAAAGTGAACGAATTAACCAAGCATCGCCAGACTGCCCTCCATCTTGCTGCCCAGCAGGACCTGCCCACCATC
TGCTCAGTCCTCCTAGAGAATGGCGTGGACTTTGCTGCCGTGGATGAGAATGGAAACAATGACTTCTGCCTGGTGTCGAAGGTGGTGGGC
AGATGCCGGGCCTCCATGCCTAGGTGGTGGTACAATGTCACTGACGGATCCTGCCAGCTGTTTGTGTATGGGGGCTGTGACGGAAACAGC
AATAATTACCTGACCAAGGAGGAGTGCCTCAAGAAATGTGCCACTGTCACAGAGAATGCCACGGGTGACCTGGCCACCAGCAGGAATGCA
GCGGATTCCTCTGTCCCAAGTGCTCCCAGAAGGCAGGATTCTGAAGACCACTCCAGCGATATGTTCAACTATGAAGAATACTGCACCGCC
AACGCAGTCACTGGGCCTTGCCGTGCATCCTTCCCACGCTGGTACTTTGACGTGGAGAGGAACTCCTGCAATAACTTCATCTATGGAGGC
TGCCGGGGCAATAAGAACAGCTACCGCTCTGAGGAGGCCTGCATGCTCCGCTGCTTCCGCCAGCAGGAGAATCCTCCCCTGCCCCTTGGC
TCAAAGGTGGTGGTTCTGGCGGGGCTGTTCGTGATGGTGTTGATCCTCTTCCTGGGAGCCTCCATGGTCTACCTGATCCGGGTGGCACGG
AGGAACCAGGAGCGTGCCCTGCGCACCGTCTGGAGCTCCGGAGATGACAAGGAGCAGCTGGTGAAGAACACATATGTCCTGTGACCGCCC
TGTCGCCAAGAGGACTGGGGAAGGGAGGGGAGACTATGTGTGAGCTTTTTTTAAATAGAGGGATTGACTCGGATTTGAGTGATCATTAGG
GCTGAGGTCTGTTTCTCTGGGAGGTAGGACGGCTGCTTCCTGGTCTGGCAGGGATGGGTTTGCTTTGGAAATCCTCTAGGAGGCTCCTCC
TCGCATGGCCTGCAGTCTGGCAGCAGCCCCGAGTTGTTTCCTCGCTGATCGATTTCTTTCCTCCAGGTAGAGTTTTCTTTGCTTATGTTG
AATTCCATTGCCTCTTTTCTCATCACAGAAGTGATGTTGGAATCGTTTCTTTTGTTTGTCTGATTTATGGTTTTTTTAAGTATAAACAAA
AGTTTTTTATTAGCATTCTGAAAGAAGGAAAGTAAAATGTACAAGTTTAATAAAAAGGGGCCTTCCCCTTTAGAATAAATTTCAGCATGT
GCTTTCTTTATGGGAGTCCTAATTTCAACCCTACCAAAATGATCACAAGACACTATCTGAGGTGTCCCATTCTAGAAATAGACCCCTCAA


Top

FusionGenePPI for ANKFY1_SPINT2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ANKFY1USPL1, ATG101, DDA1, GABARAP, GBAS, PIK3C2A, CUL3, RAB5A, EHD1, MICALL1, VPS35, VPS26A, GRK5, SMURF1, KIAA0101, FAM21A, MON2, ROCK1, KIAA1033, RHOD, RHOF, EZH2, ANKRD44, CCDC183, MEMO1, TTC29, NTRK1, SRPK2, CLK1, ERAL1, CAMSAP3, HIF1AN, C19orf45, CYLDSPINT2ITIH2, APP, TUBG1, MOV10, CUL7, ILK, TUBGCP2, LSR, ATP12A, LIN54, TBC1D9B, TBC1D15, ATP2A3, ITPRIPL1, FNDC3A, ZNF696, OCRL, ABCA3, RPS7, TMEM214, NCAPD3, SREBF2, THAP11, IQCB1, TSC2, WDR44, LEMD3, POM121, UBR3, TBL2, ATP8B2, DIP2A, NFRKB, SACM1L, ZDHHC13, RETSAT, DHRS7, SPTLC2, ARFGEF1, CCZ1, ACVR1B, CYP51A1, PRR14, LRIF1, MAP7D3, CDC20, TYW1, C20orf24, SMC2, DNAJC16, MOSPD2, BAG3, KIF14, EPHX1, TAF6L, ALG5, NOP9, OSBPL8, NUS1, SLC35F5, TEX264, CKAP5, TMUB1, POLE2, HMGCR, UPK3BL, FNDC3B, VRK2, MZT2B, SLC39A10, SEC22A, ELF2, SLC39A6, C1orf112, USP33, NDC1, SLC30A7, LMF1, GOLGA5, GTPBP3, DAGLB, VANGL2, FAM189B, DPH1, FRMD5, CHD8, PI4K2B, SLC27A3, CMTM6, EGFL7, PKMYT1, LRP10, CNTNAP1, ZDHHC18, CTU1, TIGD5, KLHL26, LRP12, ASPHD2, SCARF2, HGFAC, RNF13, MARC1, GPN3, ARL6IP6


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneANKFY1chr17:4077204chr19:38774267ENST00000341657-2025650_7599741170RHOD and RAB5A
HgeneANKFY1chr17:4077204chr19:38774267ENST00000570535-2025650_75910161212RHOD and RAB5A
HgeneANKFY1chr17:4077204chr19:38774267ENST00000574367-2025650_7599751171RHOD and RAB5A


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneANKFY1chr17:4077204chr19:38774267ENST00000433651-110650_759-13488RHOD and RAB5A


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ANKFY1_SPINT2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ANKFY1_SPINT2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneANKFY1C0005695Bladder Neoplasm1CTD_human
TgeneSPINT2C0024667Animal Mammary Neoplasms1CTD_human
TgeneSPINT2C0024668Mammary Neoplasms, Experimental1CTD_human
TgeneSPINT2C0027794Neural Tube Defects1CTD_human
TgeneSPINT2C0032045Placenta Disorders1CTD_human
TgeneSPINT2C0267663Congenital secretory diarrhea, sodium type (disorder)1CTD_human;ORPHANET;UNIPROT