FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 16003

FusionGeneSummary for HDLBP_TMPRSS2

check button Fusion gene summary
Fusion gene informationFusion gene name: HDLBP_TMPRSS2
Fusion gene ID: 16003
HgeneTgene
Gene symbol

HDLBP

TMPRSS2

Gene ID

3069

7113

Gene namehigh density lipoprotein binding proteintransmembrane serine protease 2
SynonymsHBP|PRO2900|VGLPP9284|PRSS10
Cytomap

2q37.3

21q22.3

Type of geneprotein-codingprotein-coding
DescriptionvigilinHDL-binding proteintransmembrane protease serine 2epitheliasinserine protease 10transmembrane protease, serine 2
Modification date2018052220180523
UniProtAcc

Q00341

O15393

Ensembl transtripts involved in fusion geneENST00000391976, ENST00000310931, 
ENST00000391975, ENST00000427183, 
ENST00000476807, 
ENST00000332149, 
ENST00000398585, ENST00000458356, 
ENST00000497881, 
Fusion gene scores* DoF score21 X 18 X 6=226816 X 12 X 3=576
# samples 2320
** MAII scorelog2(23/2268*10)=-3.30171487399785
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(20/576*10)=-1.52606881166759
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: HDLBP [Title/Abstract] AND TMPRSS2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTMPRSS2

GO:0006508

proteolysis

21068237|24227843

TgeneTMPRSS2

GO:0046598

positive regulation of viral entry into host cell

21068237|24227843


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-G9-6351-01AHDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000391976ENST00000332149HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
Frame-shitENST00000391976ENST00000398585HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
Frame-shitENST00000391976ENST00000458356HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
5CDS-intronENST00000391976ENST00000497881HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
Frame-shitENST00000310931ENST00000332149HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
Frame-shitENST00000310931ENST00000398585HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
Frame-shitENST00000310931ENST00000458356HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
5CDS-intronENST00000310931ENST00000497881HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
In-frameENST00000391975ENST00000332149HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
In-frameENST00000391975ENST00000398585HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
In-frameENST00000391975ENST00000458356HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
5CDS-intronENST00000391975ENST00000497881HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
Frame-shitENST00000427183ENST00000332149HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
Frame-shitENST00000427183ENST00000398585HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
Frame-shitENST00000427183ENST00000458356HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
5CDS-intronENST00000427183ENST00000497881HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
intron-3CDSENST00000476807ENST00000332149HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
intron-3CDSENST00000476807ENST00000398585HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
intron-3CDSENST00000476807ENST00000458356HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-
intron-intronENST00000476807ENST00000497881HDLBPchr2

242173235

-TMPRSS2chr21

42845423

-

Top

FusionProtFeatures for HDLBP_TMPRSS2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
HDLBP

Q00341

TMPRSS2

O15393

Appears to play a role in cell sterol metabolism. It mayfunction to protect cells from over-accumulation of cholesterol. Serine protease that proteolytically cleaves andactivates the viral spike glycoproteins which facilitate virus-cell membrane fusions; spike proteins are synthesized andmaintained in precursor intermediate folding states andproteolysis permits the refolding and energy release required tocreate stable virus-cell linkages and membrane coalescence.Facilitates human SARS coronavirus (SARS-CoV) infection via twoindependent mechanisms, proteolytic cleavage of ACE2, which mightpromote viral uptake, and cleavage of coronavirus spikeglycoprotein which activates the glycoprotein for cathepsin L-independent host cell entry. Proteolytically cleaves and activatesthe spike glycoproteins of human coronavirus 229E (HCoV-229E) andhuman coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0of Sendai virus (SeV), human metapneumovirus (HMPV), humanparainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential forspread and pathogenesis of influenza A virus (strains H1N1, H3N2and H7N9); involved in proteolytic cleavage and activation ofhemagglutinin (HA) protein which is essential for viralinfectivity. {ECO:0000269|PubMed:21068237,ECO:0000269|PubMed:21325420, ECO:0000269|PubMed:23536651,ECO:0000269|PubMed:23966399, ECO:0000269|PubMed:24027332,ECO:0000269|PubMed:24227843}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for HDLBP_TMPRSS2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_HDLBP_ENST00000391975_chr2_242173235_-_TMPRSS2_ENST00000332149_chr21_42845423_-_1346aa
MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEKAACLESAQEPSGAWGNKIRPIKASVITQVFHVPLEERKYK
DMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKT
ATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPTNRLVGEIMQETGTRINIPPPSVNRTEIVF
TGEKEQLAQAVARIKKITEEKKKKTTTIAVEVKKSQHKTVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVTAK
ANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDTVEINIDHKFHRHL
IGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEV
IINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSTSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIIT
GKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLA
EEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPK
HHRHFVIRRGQVLREIAEETGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQIT
RDFSVQIKFPDREENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYVIGQ
KGSGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRL
EHDVNIQFPDKDDGNQPAGST_TQAARAGLWAARARSRGPGPGRSACTSRTSTCAEAPSSPPSGS_QPPTAWKNLLTIHGIGRHLRGF_D
NLSCSMEPDTK_KK_FLIQIMTPRPRTMTLR__SCRSL_LSTT__NQCVCPTQA_CCSQNSSAGFPGGGPPRRKGRPQKC_TLPRCFSLR

>In-frame_HDLBP_ENST00000391975_chr2_242173235_-_TMPRSS2_ENST00000398585_chr21_42845423_-_1346aa
MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEKAACLESAQEPSGAWGNKIRPIKASVITQVFHVPLEERKYK
DMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKT
ATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPTNRLVGEIMQETGTRINIPPPSVNRTEIVF
TGEKEQLAQAVARIKKITEEKKKKTTTIAVEVKKSQHKTVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVTAK
ANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDTVEINIDHKFHRHL
IGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEV
IINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSTSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIIT
GKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLA
EEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPK
HHRHFVIRRGQVLREIAEETGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQIT
RDFSVQIKFPDREENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYVIGQ
KGSGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRL
EHDVNIQFPDKDDGNQPAGST_TQAARAGLWAARARSRGPGPGRSACTSRTSTCAEAPSSPPSGS_QPPTAWKNLLTIHGIGRHLRGF_D
NLSCSMEPDTK_KK_FLIQIMTPRPRTMTLR__SCRSL_LSTT__NQCVCPTQA_CCSQNSSAGFPGGGPPRRKGRPQKC_TLPRCFSLR

>In-frame_HDLBP_ENST00000391975_chr2_242173235_-_TMPRSS2_ENST00000458356_chr21_42845423_-_1346aa
MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEKAACLESAQEPSGAWGNKIRPIKASVITQVFHVPLEERKYK
DMNQFGEGEQAKICLEIMQRTGAHLELSLAKDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKT
ATKIQIPRPDDPSNQIKITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGPTNRLVGEIMQETGTRINIPPPSVNRTEIVF
TGEKEQLAQAVARIKKITEEKKKKTTTIAVEVKKSQHKTVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVTAK
ANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVNVAQEQIEGMVKDLINRMDTVEINIDHKFHRHL
IGKSGANINRIKDQYKVSVRIPPDSEKSNLIRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEV
IINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSTSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDLPAENSNSETIIIT
GKRANCEAARSRILSIQKDLANIAEVEVSIPAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLA
EEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDSTGARVIFPAAEDKDQDLITIIGKEDAVREAQKELEALIQNLDNVVEDSMLVDPK
HHRHFVIRRGQVLREIAEETGGVMVSFPRSGTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTLECAIPQKFHRSVMGPKGSRIQQIT
RDFSVQIKFPDREENAVHSTEPVVQENGDEAGEGREAKDCDPGSPRRCDIIIISGRKEKCEAAKEALEALVPVTIEVEVPFDLHRYVIGQ
KGSGIRKMMDEFEVNIHVPAPELQSDIIAITGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRL
EHDVNIQFPDKDDGNQPAGST_TQAARAGLWAARARSRGPGPGRSACTSRTSTCAEAPSSPPSGS_QPPTAWKNLLTIHGIGRHLRGF_D
NLSCSMEPDTK_KK_FLIQIMTPRPRTMTLR__SCRSL_LSTT__NQCVCPTQA_CCSQNSSAGFPGGGPPRRKGRPQKC_TLPRCFSLR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_HDLBP_ENST00000391975_chr2_242173235_-_TMPRSS2_ENST00000332149_chr21_42845423_-_4040nt
ATGAGTTCCGTTGCAGTTTTGACCCAAGAGAGTTTTGCTGAACACCGAAGTGGGCTGGTTCCGCAACAAATCAAAGTTGCCACTCTAAAT
TCAGAAGAGGAGAGCGACCCTCCAACCTACAAGGATGCCTTCCCTCCACTTCCTGAGAAAGCTGCTTGCCTGGAAAGTGCCCAGGAACCC
TCTGGAGCCTGGGGGAACAAGATCCGACCCATCAAGGCTTCTGTCATCACTCAGGTGTTCCATGTACCCCTGGAGGAGAGAAAATACAAG
GATATGAACCAGTTTGGAGAAGGTGAACAAGCAAAAATCTGCCTTGAGATCATGCAGAGAACTGGTGCTCACTTGGAGCTGTCTTTGGCC
AAAGACCAAGGCCTCTCCATCATGGTGTCAGGAAAGCTGGATGCTGTCATGAAAGCTCGGAAGGACATTGTTGCTAGACTGCAGACTCAG
GCCTCAGCAACTGTTGCCATTCCCAAAGAACACCATCGCTTTGTTATTGGCAAAAATGGAGAGAAACTGCAAGACTTGGAGCTAAAAACT
GCAACCAAAATCCAGATCCCACGCCCAGATGACCCCAGCAATCAGATCAAGATCACTGGCACCAAAGAGGGCATCGAGAAAGCTCGCCAT
GAAGTCTTACTCATCTCTGCCGAGCAGGACAAACGTGCTGTGGAGAGGCTAGAAGTAGAAAAGGCATTCCACCCCTTCATCGCTGGGCCG
TATAATAGACTGGTTGGCGAGATCATGCAGGAGACAGGCACGCGCATCAACATCCCCCCACCCAGCGTGAACCGGACAGAGATTGTCTTC
ACTGGAGAGAAGGAACAGTTGGCTCAGGCTGTGGCTCGCATCAAGAAGATTTATGAGGAGAAGAAAAAGAAGACTACAACCATTGCAGTG
GAAGTGAAGAAATCCCAACACAAGTATGTCATTGGGCCCAAGGGCAATTCATTGCAGGAGATCCTTGAGAGAACTGGAGTTTCCGTTGAG
ATCCCACCCTCAGACAGCATCTCTGAGACTGTAATACTTCGAGGCGAACCTGAAAAGTTAGGTCAGGCGTTGACTGAAGTCTATGCCAAG
GCCAATAGCTTCACCGTCTCCTCTGTCGCCGCCCCTTCCTGGCTTCACCGTTTCATCATTGGCAAGAAAGGGCAGAACCTGGCCAAAATC
ACTCAGCAGATGCCAAAGGTTCACATCGAGTTCACAGAGGGCGAAGACAAGATCACCCTGGAGGGCCCTACAGAGGATGTCAATGTGGCC
CAGGAACAGATAGAAGGCATGGTCAAAGATTTGATTAACCGGATGGACTATGTGGAGATCAACATCGACCACAAGTTCCACAGGCACCTC
ATTGGGAAGAGCGGTGCCAACATAAACAGAATCAAAGACCAGTACAAGGTGTCCGTGCGCATCCCTCCTGACAGTGAGAAGAGCAATTTG
ATCCGCATCGAGGGGGACCCACAGGGCGTGCAGCAGGCCAAGCGAGAGCTGCTGGAGCTTGCATCTCGCATGGAAAATGAGCGTACCAAG
GATCTAATCATTGAGCAAAGATTTCATCGCACAATCATTGGGCAGAAGGGTGAACGGATCCGTGAAATTCGTGACAAATTCCCAGAGGTC
ATCATTAACTTTCCAGACCCAGCACAAAAAAGTGACATTGTCCAGCTCAGAGGACCTAAGAATGAGGTGGAAAAATGCACAAAATACATG
CAGAAGATGGTGGCAGATCTGGTGGAAAATAGCTATTCAATTTCTGTTCCGATCTTCAAACAGTTTCACAAGAATATCATTGGGAAAGGA
GGCGCAAACATTAAAAAGATTCGTGAAGAAAGCAACACCAAAATCGACCTTCCAGCAGAGAATAGCAATTCAGAGACCATTATCATCACA
GGCAAGCGAGCCAACTGCGAAGCTGCCCGGAGCAGGATTCTGTCTATTCAGAAAGACCTGGCCAACATAGCCGAGGTAGAGGTCTCCATC
CCTGCCAAGCTGCACAACTCCCTCATTGGCACCAAGGGCCGTCTGATCCGCTCCATCATGGAGGAGTGCGGCGGGGTCCACATTCACTTT
CCCGTGGAAGGTTCAGGAAGCGACACCGTTGTTATCAGGGGCCCTTCCTCGGATGTGGAGAAGGCCAAGAAGCAGCTCCTGCATCTGGCG
GAGGAGAAGCAAACCAAGAGTTTCACTGTTGACATCCGCGCCAAGCCAGAATACCACAAATTCCTCATCGGCAAGGGGGGCGGCAAAATT
CGCAAGGTGCGCGACAGCACTGGAGCACGTGTCATCTTCCCTGCGGCTGAGGACAAGGACCAGGACCTGATCACCATCATTGGAAAGGAG
GACGCCGTCCGAGAGGCACAGAAGGAGCTGGAGGCCTTGATCCAAAACCTGGATAATGTGGTGGAAGACTCCATGCTGGTGGACCCCAAG
CACCACCGCCACTTCGTCATCCGCAGAGGCCAGGTCTTGCGGGAGATTGCTGAAGAGTATGGCGGGGTGATGGTCAGCTTCCCACGCTCT
GGCACACAGAGCGACAAAGTCACCCTCAAGGGCGCCAAGGACTGTGTGGAGGCAGCCAAGAAACGCATTCAGGAGATCATTGAGGACCTG
GAAGCTCAGGTGACATTAGAATGTGCTATACCCCAGAAATTCCATCGATCTGTCATGGGCCCCAAAGGTTCCAGAATCCAGCAGATTACT
CGGGATTTCAGTGTTCAAATTAAATTCCCAGACAGAGAGGAGAACGCAGTTCACAGTACAGAGCCAGTTGTCCAGGAGAATGGGGACGAA
GCTGGGGAGGGGAGAGAGGCTAAAGATTGTGACCCCGGCTCTCCAAGGAGGTGTGACATCATCATCATCTCTGGCCGGAAAGAAAAGTGT
GAGGCTGCCAAGGAAGCTCTGGAGGCATTGGTTCCTGTCACCATTGAAGTAGAGGTGCCCTTTGACCTTCACCGTTACGTTATTGGGCAG
AAAGGAAGTGGGATCCGCAAGATGATGGATGAGTTTGAGGTGAACATACATGTCCCGGCACCTGAGCTGCAGTCTGACATCATCGCCATC
ACGGGCCTCGCTGCAAATTTGGACCGGGCCAAGGCTGGACTGCTGGAGCGTGTGAAGGAGCTACAGGCCGAGCAGGAGGACCGGGCTTTA
AGGAGTTTTAAGCTGAGTGTCACTGTAGACCCCAAATACCATCCCAAGATTATCGGGAGAAAGGGGGCAGTAATTACCCAAATCCGGTTG
GAGCATGACGTGAACATCCAGTTTCCTGATAAGGACGATGGGAACCAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTG
TGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCA
CCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGAC
AATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTG
CGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAAC
AGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGA
CACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTT
GCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCA

>In-frame_HDLBP_ENST00000391975_chr2_242173235_-_TMPRSS2_ENST00000398585_chr21_42845423_-_4040nt
ATGAGTTCCGTTGCAGTTTTGACCCAAGAGAGTTTTGCTGAACACCGAAGTGGGCTGGTTCCGCAACAAATCAAAGTTGCCACTCTAAAT
TCAGAAGAGGAGAGCGACCCTCCAACCTACAAGGATGCCTTCCCTCCACTTCCTGAGAAAGCTGCTTGCCTGGAAAGTGCCCAGGAACCC
TCTGGAGCCTGGGGGAACAAGATCCGACCCATCAAGGCTTCTGTCATCACTCAGGTGTTCCATGTACCCCTGGAGGAGAGAAAATACAAG
GATATGAACCAGTTTGGAGAAGGTGAACAAGCAAAAATCTGCCTTGAGATCATGCAGAGAACTGGTGCTCACTTGGAGCTGTCTTTGGCC
AAAGACCAAGGCCTCTCCATCATGGTGTCAGGAAAGCTGGATGCTGTCATGAAAGCTCGGAAGGACATTGTTGCTAGACTGCAGACTCAG
GCCTCAGCAACTGTTGCCATTCCCAAAGAACACCATCGCTTTGTTATTGGCAAAAATGGAGAGAAACTGCAAGACTTGGAGCTAAAAACT
GCAACCAAAATCCAGATCCCACGCCCAGATGACCCCAGCAATCAGATCAAGATCACTGGCACCAAAGAGGGCATCGAGAAAGCTCGCCAT
GAAGTCTTACTCATCTCTGCCGAGCAGGACAAACGTGCTGTGGAGAGGCTAGAAGTAGAAAAGGCATTCCACCCCTTCATCGCTGGGCCG
TATAATAGACTGGTTGGCGAGATCATGCAGGAGACAGGCACGCGCATCAACATCCCCCCACCCAGCGTGAACCGGACAGAGATTGTCTTC
ACTGGAGAGAAGGAACAGTTGGCTCAGGCTGTGGCTCGCATCAAGAAGATTTATGAGGAGAAGAAAAAGAAGACTACAACCATTGCAGTG
GAAGTGAAGAAATCCCAACACAAGTATGTCATTGGGCCCAAGGGCAATTCATTGCAGGAGATCCTTGAGAGAACTGGAGTTTCCGTTGAG
ATCCCACCCTCAGACAGCATCTCTGAGACTGTAATACTTCGAGGCGAACCTGAAAAGTTAGGTCAGGCGTTGACTGAAGTCTATGCCAAG
GCCAATAGCTTCACCGTCTCCTCTGTCGCCGCCCCTTCCTGGCTTCACCGTTTCATCATTGGCAAGAAAGGGCAGAACCTGGCCAAAATC
ACTCAGCAGATGCCAAAGGTTCACATCGAGTTCACAGAGGGCGAAGACAAGATCACCCTGGAGGGCCCTACAGAGGATGTCAATGTGGCC
CAGGAACAGATAGAAGGCATGGTCAAAGATTTGATTAACCGGATGGACTATGTGGAGATCAACATCGACCACAAGTTCCACAGGCACCTC
ATTGGGAAGAGCGGTGCCAACATAAACAGAATCAAAGACCAGTACAAGGTGTCCGTGCGCATCCCTCCTGACAGTGAGAAGAGCAATTTG
ATCCGCATCGAGGGGGACCCACAGGGCGTGCAGCAGGCCAAGCGAGAGCTGCTGGAGCTTGCATCTCGCATGGAAAATGAGCGTACCAAG
GATCTAATCATTGAGCAAAGATTTCATCGCACAATCATTGGGCAGAAGGGTGAACGGATCCGTGAAATTCGTGACAAATTCCCAGAGGTC
ATCATTAACTTTCCAGACCCAGCACAAAAAAGTGACATTGTCCAGCTCAGAGGACCTAAGAATGAGGTGGAAAAATGCACAAAATACATG
CAGAAGATGGTGGCAGATCTGGTGGAAAATAGCTATTCAATTTCTGTTCCGATCTTCAAACAGTTTCACAAGAATATCATTGGGAAAGGA
GGCGCAAACATTAAAAAGATTCGTGAAGAAAGCAACACCAAAATCGACCTTCCAGCAGAGAATAGCAATTCAGAGACCATTATCATCACA
GGCAAGCGAGCCAACTGCGAAGCTGCCCGGAGCAGGATTCTGTCTATTCAGAAAGACCTGGCCAACATAGCCGAGGTAGAGGTCTCCATC
CCTGCCAAGCTGCACAACTCCCTCATTGGCACCAAGGGCCGTCTGATCCGCTCCATCATGGAGGAGTGCGGCGGGGTCCACATTCACTTT
CCCGTGGAAGGTTCAGGAAGCGACACCGTTGTTATCAGGGGCCCTTCCTCGGATGTGGAGAAGGCCAAGAAGCAGCTCCTGCATCTGGCG
GAGGAGAAGCAAACCAAGAGTTTCACTGTTGACATCCGCGCCAAGCCAGAATACCACAAATTCCTCATCGGCAAGGGGGGCGGCAAAATT
CGCAAGGTGCGCGACAGCACTGGAGCACGTGTCATCTTCCCTGCGGCTGAGGACAAGGACCAGGACCTGATCACCATCATTGGAAAGGAG
GACGCCGTCCGAGAGGCACAGAAGGAGCTGGAGGCCTTGATCCAAAACCTGGATAATGTGGTGGAAGACTCCATGCTGGTGGACCCCAAG
CACCACCGCCACTTCGTCATCCGCAGAGGCCAGGTCTTGCGGGAGATTGCTGAAGAGTATGGCGGGGTGATGGTCAGCTTCCCACGCTCT
GGCACACAGAGCGACAAAGTCACCCTCAAGGGCGCCAAGGACTGTGTGGAGGCAGCCAAGAAACGCATTCAGGAGATCATTGAGGACCTG
GAAGCTCAGGTGACATTAGAATGTGCTATACCCCAGAAATTCCATCGATCTGTCATGGGCCCCAAAGGTTCCAGAATCCAGCAGATTACT
CGGGATTTCAGTGTTCAAATTAAATTCCCAGACAGAGAGGAGAACGCAGTTCACAGTACAGAGCCAGTTGTCCAGGAGAATGGGGACGAA
GCTGGGGAGGGGAGAGAGGCTAAAGATTGTGACCCCGGCTCTCCAAGGAGGTGTGACATCATCATCATCTCTGGCCGGAAAGAAAAGTGT
GAGGCTGCCAAGGAAGCTCTGGAGGCATTGGTTCCTGTCACCATTGAAGTAGAGGTGCCCTTTGACCTTCACCGTTACGTTATTGGGCAG
AAAGGAAGTGGGATCCGCAAGATGATGGATGAGTTTGAGGTGAACATACATGTCCCGGCACCTGAGCTGCAGTCTGACATCATCGCCATC
ACGGGCCTCGCTGCAAATTTGGACCGGGCCAAGGCTGGACTGCTGGAGCGTGTGAAGGAGCTACAGGCCGAGCAGGAGGACCGGGCTTTA
AGGAGTTTTAAGCTGAGTGTCACTGTAGACCCCAAATACCATCCCAAGATTATCGGGAGAAAGGGGGCAGTAATTACCCAAATCCGGTTG
GAGCATGACGTGAACATCCAGTTTCCTGATAAGGACGATGGGAACCAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTG
TGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCA
CCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGAC
AATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTG
CGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAAC
AGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGA
CACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTT
GCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCA

>In-frame_HDLBP_ENST00000391975_chr2_242173235_-_TMPRSS2_ENST00000458356_chr21_42845423_-_4040nt
ATGAGTTCCGTTGCAGTTTTGACCCAAGAGAGTTTTGCTGAACACCGAAGTGGGCTGGTTCCGCAACAAATCAAAGTTGCCACTCTAAAT
TCAGAAGAGGAGAGCGACCCTCCAACCTACAAGGATGCCTTCCCTCCACTTCCTGAGAAAGCTGCTTGCCTGGAAAGTGCCCAGGAACCC
TCTGGAGCCTGGGGGAACAAGATCCGACCCATCAAGGCTTCTGTCATCACTCAGGTGTTCCATGTACCCCTGGAGGAGAGAAAATACAAG
GATATGAACCAGTTTGGAGAAGGTGAACAAGCAAAAATCTGCCTTGAGATCATGCAGAGAACTGGTGCTCACTTGGAGCTGTCTTTGGCC
AAAGACCAAGGCCTCTCCATCATGGTGTCAGGAAAGCTGGATGCTGTCATGAAAGCTCGGAAGGACATTGTTGCTAGACTGCAGACTCAG
GCCTCAGCAACTGTTGCCATTCCCAAAGAACACCATCGCTTTGTTATTGGCAAAAATGGAGAGAAACTGCAAGACTTGGAGCTAAAAACT
GCAACCAAAATCCAGATCCCACGCCCAGATGACCCCAGCAATCAGATCAAGATCACTGGCACCAAAGAGGGCATCGAGAAAGCTCGCCAT
GAAGTCTTACTCATCTCTGCCGAGCAGGACAAACGTGCTGTGGAGAGGCTAGAAGTAGAAAAGGCATTCCACCCCTTCATCGCTGGGCCG
TATAATAGACTGGTTGGCGAGATCATGCAGGAGACAGGCACGCGCATCAACATCCCCCCACCCAGCGTGAACCGGACAGAGATTGTCTTC
ACTGGAGAGAAGGAACAGTTGGCTCAGGCTGTGGCTCGCATCAAGAAGATTTATGAGGAGAAGAAAAAGAAGACTACAACCATTGCAGTG
GAAGTGAAGAAATCCCAACACAAGTATGTCATTGGGCCCAAGGGCAATTCATTGCAGGAGATCCTTGAGAGAACTGGAGTTTCCGTTGAG
ATCCCACCCTCAGACAGCATCTCTGAGACTGTAATACTTCGAGGCGAACCTGAAAAGTTAGGTCAGGCGTTGACTGAAGTCTATGCCAAG
GCCAATAGCTTCACCGTCTCCTCTGTCGCCGCCCCTTCCTGGCTTCACCGTTTCATCATTGGCAAGAAAGGGCAGAACCTGGCCAAAATC
ACTCAGCAGATGCCAAAGGTTCACATCGAGTTCACAGAGGGCGAAGACAAGATCACCCTGGAGGGCCCTACAGAGGATGTCAATGTGGCC
CAGGAACAGATAGAAGGCATGGTCAAAGATTTGATTAACCGGATGGACTATGTGGAGATCAACATCGACCACAAGTTCCACAGGCACCTC
ATTGGGAAGAGCGGTGCCAACATAAACAGAATCAAAGACCAGTACAAGGTGTCCGTGCGCATCCCTCCTGACAGTGAGAAGAGCAATTTG
ATCCGCATCGAGGGGGACCCACAGGGCGTGCAGCAGGCCAAGCGAGAGCTGCTGGAGCTTGCATCTCGCATGGAAAATGAGCGTACCAAG
GATCTAATCATTGAGCAAAGATTTCATCGCACAATCATTGGGCAGAAGGGTGAACGGATCCGTGAAATTCGTGACAAATTCCCAGAGGTC
ATCATTAACTTTCCAGACCCAGCACAAAAAAGTGACATTGTCCAGCTCAGAGGACCTAAGAATGAGGTGGAAAAATGCACAAAATACATG
CAGAAGATGGTGGCAGATCTGGTGGAAAATAGCTATTCAATTTCTGTTCCGATCTTCAAACAGTTTCACAAGAATATCATTGGGAAAGGA
GGCGCAAACATTAAAAAGATTCGTGAAGAAAGCAACACCAAAATCGACCTTCCAGCAGAGAATAGCAATTCAGAGACCATTATCATCACA
GGCAAGCGAGCCAACTGCGAAGCTGCCCGGAGCAGGATTCTGTCTATTCAGAAAGACCTGGCCAACATAGCCGAGGTAGAGGTCTCCATC
CCTGCCAAGCTGCACAACTCCCTCATTGGCACCAAGGGCCGTCTGATCCGCTCCATCATGGAGGAGTGCGGCGGGGTCCACATTCACTTT
CCCGTGGAAGGTTCAGGAAGCGACACCGTTGTTATCAGGGGCCCTTCCTCGGATGTGGAGAAGGCCAAGAAGCAGCTCCTGCATCTGGCG
GAGGAGAAGCAAACCAAGAGTTTCACTGTTGACATCCGCGCCAAGCCAGAATACCACAAATTCCTCATCGGCAAGGGGGGCGGCAAAATT
CGCAAGGTGCGCGACAGCACTGGAGCACGTGTCATCTTCCCTGCGGCTGAGGACAAGGACCAGGACCTGATCACCATCATTGGAAAGGAG
GACGCCGTCCGAGAGGCACAGAAGGAGCTGGAGGCCTTGATCCAAAACCTGGATAATGTGGTGGAAGACTCCATGCTGGTGGACCCCAAG
CACCACCGCCACTTCGTCATCCGCAGAGGCCAGGTCTTGCGGGAGATTGCTGAAGAGTATGGCGGGGTGATGGTCAGCTTCCCACGCTCT
GGCACACAGAGCGACAAAGTCACCCTCAAGGGCGCCAAGGACTGTGTGGAGGCAGCCAAGAAACGCATTCAGGAGATCATTGAGGACCTG
GAAGCTCAGGTGACATTAGAATGTGCTATACCCCAGAAATTCCATCGATCTGTCATGGGCCCCAAAGGTTCCAGAATCCAGCAGATTACT
CGGGATTTCAGTGTTCAAATTAAATTCCCAGACAGAGAGGAGAACGCAGTTCACAGTACAGAGCCAGTTGTCCAGGAGAATGGGGACGAA
GCTGGGGAGGGGAGAGAGGCTAAAGATTGTGACCCCGGCTCTCCAAGGAGGTGTGACATCATCATCATCTCTGGCCGGAAAGAAAAGTGT
GAGGCTGCCAAGGAAGCTCTGGAGGCATTGGTTCCTGTCACCATTGAAGTAGAGGTGCCCTTTGACCTTCACCGTTACGTTATTGGGCAG
AAAGGAAGTGGGATCCGCAAGATGATGGATGAGTTTGAGGTGAACATACATGTCCCGGCACCTGAGCTGCAGTCTGACATCATCGCCATC
ACGGGCCTCGCTGCAAATTTGGACCGGGCCAAGGCTGGACTGCTGGAGCGTGTGAAGGAGCTACAGGCCGAGCAGGAGGACCGGGCTTTA
AGGAGTTTTAAGCTGAGTGTCACTGTAGACCCCAAATACCATCCCAAGATTATCGGGAGAAAGGGGGCAGTAATTACCCAAATCCGGTTG
GAGCATGACGTGAACATCCAGTTTCCTGATAAGGACGATGGGAACCAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTG
TGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCA
CCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGAC
AATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTG
CGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAAC
AGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGA
CACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTT
GCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_HDLBP_ENST00000391975_chr2_242173235_-_TMPRSS2_ENST00000332149_chr21_42845423_-_5859nt
AGGCGGGATTGGGCCGCCGCCCTATATAGCAGCCGGGGCCCGGGCGCCGCGCCTCGGAGCGTCCCGGCTTCTCCCGCGCGGGGGGCGAGT
AAGCCAGCGGCAGGACCAGCGGGCGGGGGCCCACGACAAAAGCTGGCAGGCTGACAGAGGCGGCCTCAGGACGGACCTTCTGGCTACTGA
CCGTTTTGCTGTGGTTTTCCCGGATTGTGTGTAGGTGTGAGATCAACCATGAGTTCCGTTGCAGTTTTGACCCAAGAGAGTTTTGCTGAA
CACCGAAGTGGGCTGGTTCCGCAACAAATCAAAGTTGCCACTCTAAATTCAGAAGAGGAGAGCGACCCTCCAACCTACAAGGATGCCTTC
CCTCCACTTCCTGAGAAAGCTGCTTGCCTGGAAAGTGCCCAGGAACCCTCTGGAGCCTGGGGGAACAAGATCCGACCCATCAAGGCTTCT
GTCATCACTCAGGTGTTCCATGTACCCCTGGAGGAGAGAAAATACAAGGATATGAACCAGTTTGGAGAAGGTGAACAAGCAAAAATCTGC
CTTGAGATCATGCAGAGAACTGGTGCTCACTTGGAGCTGTCTTTGGCCAAAGACCAAGGCCTCTCCATCATGGTGTCAGGAAAGCTGGAT
GCTGTCATGAAAGCTCGGAAGGACATTGTTGCTAGACTGCAGACTCAGGCCTCAGCAACTGTTGCCATTCCCAAAGAACACCATCGCTTT
GTTATTGGCAAAAATGGAGAGAAACTGCAAGACTTGGAGCTAAAAACTGCAACCAAAATCCAGATCCCACGCCCAGATGACCCCAGCAAT
CAGATCAAGATCACTGGCACCAAAGAGGGCATCGAGAAAGCTCGCCATGAAGTCTTACTCATCTCTGCCGAGCAGGACAAACGTGCTGTG
GAGAGGCTAGAAGTAGAAAAGGCATTCCACCCCTTCATCGCTGGGCCGTATAATAGACTGGTTGGCGAGATCATGCAGGAGACAGGCACG
CGCATCAACATCCCCCCACCCAGCGTGAACCGGACAGAGATTGTCTTCACTGGAGAGAAGGAACAGTTGGCTCAGGCTGTGGCTCGCATC
AAGAAGATTTATGAGGAGAAGAAAAAGAAGACTACAACCATTGCAGTGGAAGTGAAGAAATCCCAACACAAGTATGTCATTGGGCCCAAG
GGCAATTCATTGCAGGAGATCCTTGAGAGAACTGGAGTTTCCGTTGAGATCCCACCCTCAGACAGCATCTCTGAGACTGTAATACTTCGA
GGCGAACCTGAAAAGTTAGGTCAGGCGTTGACTGAAGTCTATGCCAAGGCCAATAGCTTCACCGTCTCCTCTGTCGCCGCCCCTTCCTGG
CTTCACCGTTTCATCATTGGCAAGAAAGGGCAGAACCTGGCCAAAATCACTCAGCAGATGCCAAAGGTTCACATCGAGTTCACAGAGGGC
GAAGACAAGATCACCCTGGAGGGCCCTACAGAGGATGTCAATGTGGCCCAGGAACAGATAGAAGGCATGGTCAAAGATTTGATTAACCGG
ATGGACTATGTGGAGATCAACATCGACCACAAGTTCCACAGGCACCTCATTGGGAAGAGCGGTGCCAACATAAACAGAATCAAAGACCAG
TACAAGGTGTCCGTGCGCATCCCTCCTGACAGTGAGAAGAGCAATTTGATCCGCATCGAGGGGGACCCACAGGGCGTGCAGCAGGCCAAG
CGAGAGCTGCTGGAGCTTGCATCTCGCATGGAAAATGAGCGTACCAAGGATCTAATCATTGAGCAAAGATTTCATCGCACAATCATTGGG
CAGAAGGGTGAACGGATCCGTGAAATTCGTGACAAATTCCCAGAGGTCATCATTAACTTTCCAGACCCAGCACAAAAAAGTGACATTGTC
CAGCTCAGAGGACCTAAGAATGAGGTGGAAAAATGCACAAAATACATGCAGAAGATGGTGGCAGATCTGGTGGAAAATAGCTATTCAATT
TCTGTTCCGATCTTCAAACAGTTTCACAAGAATATCATTGGGAAAGGAGGCGCAAACATTAAAAAGATTCGTGAAGAAAGCAACACCAAA
ATCGACCTTCCAGCAGAGAATAGCAATTCAGAGACCATTATCATCACAGGCAAGCGAGCCAACTGCGAAGCTGCCCGGAGCAGGATTCTG
TCTATTCAGAAAGACCTGGCCAACATAGCCGAGGTAGAGGTCTCCATCCCTGCCAAGCTGCACAACTCCCTCATTGGCACCAAGGGCCGT
CTGATCCGCTCCATCATGGAGGAGTGCGGCGGGGTCCACATTCACTTTCCCGTGGAAGGTTCAGGAAGCGACACCGTTGTTATCAGGGGC
CCTTCCTCGGATGTGGAGAAGGCCAAGAAGCAGCTCCTGCATCTGGCGGAGGAGAAGCAAACCAAGAGTTTCACTGTTGACATCCGCGCC
AAGCCAGAATACCACAAATTCCTCATCGGCAAGGGGGGCGGCAAAATTCGCAAGGTGCGCGACAGCACTGGAGCACGTGTCATCTTCCCT
GCGGCTGAGGACAAGGACCAGGACCTGATCACCATCATTGGAAAGGAGGACGCCGTCCGAGAGGCACAGAAGGAGCTGGAGGCCTTGATC
CAAAACCTGGATAATGTGGTGGAAGACTCCATGCTGGTGGACCCCAAGCACCACCGCCACTTCGTCATCCGCAGAGGCCAGGTCTTGCGG
GAGATTGCTGAAGAGTATGGCGGGGTGATGGTCAGCTTCCCACGCTCTGGCACACAGAGCGACAAAGTCACCCTCAAGGGCGCCAAGGAC
TGTGTGGAGGCAGCCAAGAAACGCATTCAGGAGATCATTGAGGACCTGGAAGCTCAGGTGACATTAGAATGTGCTATACCCCAGAAATTC
CATCGATCTGTCATGGGCCCCAAAGGTTCCAGAATCCAGCAGATTACTCGGGATTTCAGTGTTCAAATTAAATTCCCAGACAGAGAGGAG
AACGCAGTTCACAGTACAGAGCCAGTTGTCCAGGAGAATGGGGACGAAGCTGGGGAGGGGAGAGAGGCTAAAGATTGTGACCCCGGCTCT
CCAAGGAGGTGTGACATCATCATCATCTCTGGCCGGAAAGAAAAGTGTGAGGCTGCCAAGGAAGCTCTGGAGGCATTGGTTCCTGTCACC
ATTGAAGTAGAGGTGCCCTTTGACCTTCACCGTTACGTTATTGGGCAGAAAGGAAGTGGGATCCGCAAGATGATGGATGAGTTTGAGGTG
AACATACATGTCCCGGCACCTGAGCTGCAGTCTGACATCATCGCCATCACGGGCCTCGCTGCAAATTTGGACCGGGCCAAGGCTGGACTG
CTGGAGCGTGTGAAGGAGCTACAGGCCGAGCAGGAGGACCGGGCTTTAAGGAGTTTTAAGCTGAGTGTCACTGTAGACCCCAAATACCAT
CCCAAGATTATCGGGAGAAAGGGGGCAGTAATTACCCAAATCCGGTTGGAGCATGACGTGAACATCCAGTTTCCTGATAAGGACGATGGG
AACCAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGG
TCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAAC
CTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAG
TGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAG
TGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAG
GGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCA
CACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACA
ATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCA
CGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAAACAATGGGGCTGG
TTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCAGAGGTCACTTCATTTTTATTAAACAGTGAACTTGTCTGGCTTTGGCACT
CTCTGCCATTCTGTGCAGGCTGCAGTGGCTCCCCTGCCCAGCCTGCTCTCCCTAACCCCTTGTCCGCAAGGGGTGATGGCCGGCTGGTTG
TGGGCACTGGCGGTCAAGTGTGGAGGAGAGGGGTGGAGGCTGCCCCATTGAGATCTTCCTGCTGAGTCCTTTCCAGGGGCCAATTTTGGA
TGAGCATGGAGCTGTCACCTCTCAGCTGCTGGATGACTTGAGATGAAAAAGGAGAGACATGGAAAGGGAGACAGCCAGGTGGCACCTGCA
GCGGCTGCCCTCTGGGGCCACTTGGTAGTGTCCCCAGCCTACCTCTCCACAAGGGGATTTTGCTGATGGGTTCTTAGAGCCTTAGCAGCC
CTGGATGGTGGCCAGAAATAAAGGGACCAGCCCTTCATGGGTGGTGACGTGGTAGTCACTTGTAAGGGGAACAGAAACATTTTTGTTCTT
ATGGGGTGAGAATATAGACAGTGCCCTTGGTGCGAGGGAAGCAATTGAAAAGGAACTTGCCCTGAGCACTCCTGGTGCAGGTCTCCACCT
GCACATTGGGTGGGGCTCCTGGGAGGGAGACTCAGCCTTCCTCCTCATCCTCCCTGACCCTGCTCCTAGCACCCTGGAGAGTGCACATGC
CCCTTGGTCCTGGCAGGGCGCCAAGTCTGGCACCATGTTGGCCTCTTCAGGCCTGCTAGTCACTGGAAATTGAGGTCCATGGGGGAAATC
AAGGATGCTCAGTTTAAGGTACACTGTTTCCATGTTATGTTTCTACACATTGCTACCTCAGTGCTCCTGGAAACTTAGCTTTTGATGTCT
CCAAGTAGTCCACCTTCATTTAACTCTTTGAAACTGTATCATCTTTGCCAAGTAAGAGTGGTGGCCTATTTCAGCTGCTTTGACAAAATG
ACTGGCTCCTGACTTAACGTTCTATAAATGAATGTGCTGAAGCAAAGTGCCCATGGTGGCGGCGAAGAAGAGAAAGATGTGTTTTGTTTT
GGACTCTCTGTGGTCCCTTCCAATGCTGTGGGTTTCCAACCAGGGGAAGGGTCCCTTTTGCATTGCCAAGTGCCATAACCATGAGCACTA
CTCTACCATGGTTCTGCCTCCTGGCCAAGCAGGCTGGTTTGCAAGAATGAAATGAATGATTCTACAGCTAGGACTTAACCTTGAAATGGA
AAGTCATGCAATCCCATTTGCAGGATCTGTCTGTGCACATGCCTCTGTAGAGAGCAGCATTCCCAGGGACCTTGGAAACAGTTGGCACTG
TAAGGTGCTTGCTCCCCAAGACACATCCTAAAAGGTGTTGTAATGGTGAAAACGTCTTCCTTCTTTATTGCCCCTTCTTATTTATGTGAA
CAACTGTTTGTCTTTTTTTGTATCTTTTTTAAACTGTAAAGTTCAATTGTGAAAATGAATATCATGCAAATAAATTATGCAATTTTTTTT

>In-frame_HDLBP_ENST00000391975_chr2_242173235_-_TMPRSS2_ENST00000398585_chr21_42845423_-_5857nt
AGGCGGGATTGGGCCGCCGCCCTATATAGCAGCCGGGGCCCGGGCGCCGCGCCTCGGAGCGTCCCGGCTTCTCCCGCGCGGGGGGCGAGT
AAGCCAGCGGCAGGACCAGCGGGCGGGGGCCCACGACAAAAGCTGGCAGGCTGACAGAGGCGGCCTCAGGACGGACCTTCTGGCTACTGA
CCGTTTTGCTGTGGTTTTCCCGGATTGTGTGTAGGTGTGAGATCAACCATGAGTTCCGTTGCAGTTTTGACCCAAGAGAGTTTTGCTGAA
CACCGAAGTGGGCTGGTTCCGCAACAAATCAAAGTTGCCACTCTAAATTCAGAAGAGGAGAGCGACCCTCCAACCTACAAGGATGCCTTC
CCTCCACTTCCTGAGAAAGCTGCTTGCCTGGAAAGTGCCCAGGAACCCTCTGGAGCCTGGGGGAACAAGATCCGACCCATCAAGGCTTCT
GTCATCACTCAGGTGTTCCATGTACCCCTGGAGGAGAGAAAATACAAGGATATGAACCAGTTTGGAGAAGGTGAACAAGCAAAAATCTGC
CTTGAGATCATGCAGAGAACTGGTGCTCACTTGGAGCTGTCTTTGGCCAAAGACCAAGGCCTCTCCATCATGGTGTCAGGAAAGCTGGAT
GCTGTCATGAAAGCTCGGAAGGACATTGTTGCTAGACTGCAGACTCAGGCCTCAGCAACTGTTGCCATTCCCAAAGAACACCATCGCTTT
GTTATTGGCAAAAATGGAGAGAAACTGCAAGACTTGGAGCTAAAAACTGCAACCAAAATCCAGATCCCACGCCCAGATGACCCCAGCAAT
CAGATCAAGATCACTGGCACCAAAGAGGGCATCGAGAAAGCTCGCCATGAAGTCTTACTCATCTCTGCCGAGCAGGACAAACGTGCTGTG
GAGAGGCTAGAAGTAGAAAAGGCATTCCACCCCTTCATCGCTGGGCCGTATAATAGACTGGTTGGCGAGATCATGCAGGAGACAGGCACG
CGCATCAACATCCCCCCACCCAGCGTGAACCGGACAGAGATTGTCTTCACTGGAGAGAAGGAACAGTTGGCTCAGGCTGTGGCTCGCATC
AAGAAGATTTATGAGGAGAAGAAAAAGAAGACTACAACCATTGCAGTGGAAGTGAAGAAATCCCAACACAAGTATGTCATTGGGCCCAAG
GGCAATTCATTGCAGGAGATCCTTGAGAGAACTGGAGTTTCCGTTGAGATCCCACCCTCAGACAGCATCTCTGAGACTGTAATACTTCGA
GGCGAACCTGAAAAGTTAGGTCAGGCGTTGACTGAAGTCTATGCCAAGGCCAATAGCTTCACCGTCTCCTCTGTCGCCGCCCCTTCCTGG
CTTCACCGTTTCATCATTGGCAAGAAAGGGCAGAACCTGGCCAAAATCACTCAGCAGATGCCAAAGGTTCACATCGAGTTCACAGAGGGC
GAAGACAAGATCACCCTGGAGGGCCCTACAGAGGATGTCAATGTGGCCCAGGAACAGATAGAAGGCATGGTCAAAGATTTGATTAACCGG
ATGGACTATGTGGAGATCAACATCGACCACAAGTTCCACAGGCACCTCATTGGGAAGAGCGGTGCCAACATAAACAGAATCAAAGACCAG
TACAAGGTGTCCGTGCGCATCCCTCCTGACAGTGAGAAGAGCAATTTGATCCGCATCGAGGGGGACCCACAGGGCGTGCAGCAGGCCAAG
CGAGAGCTGCTGGAGCTTGCATCTCGCATGGAAAATGAGCGTACCAAGGATCTAATCATTGAGCAAAGATTTCATCGCACAATCATTGGG
CAGAAGGGTGAACGGATCCGTGAAATTCGTGACAAATTCCCAGAGGTCATCATTAACTTTCCAGACCCAGCACAAAAAAGTGACATTGTC
CAGCTCAGAGGACCTAAGAATGAGGTGGAAAAATGCACAAAATACATGCAGAAGATGGTGGCAGATCTGGTGGAAAATAGCTATTCAATT
TCTGTTCCGATCTTCAAACAGTTTCACAAGAATATCATTGGGAAAGGAGGCGCAAACATTAAAAAGATTCGTGAAGAAAGCAACACCAAA
ATCGACCTTCCAGCAGAGAATAGCAATTCAGAGACCATTATCATCACAGGCAAGCGAGCCAACTGCGAAGCTGCCCGGAGCAGGATTCTG
TCTATTCAGAAAGACCTGGCCAACATAGCCGAGGTAGAGGTCTCCATCCCTGCCAAGCTGCACAACTCCCTCATTGGCACCAAGGGCCGT
CTGATCCGCTCCATCATGGAGGAGTGCGGCGGGGTCCACATTCACTTTCCCGTGGAAGGTTCAGGAAGCGACACCGTTGTTATCAGGGGC
CCTTCCTCGGATGTGGAGAAGGCCAAGAAGCAGCTCCTGCATCTGGCGGAGGAGAAGCAAACCAAGAGTTTCACTGTTGACATCCGCGCC
AAGCCAGAATACCACAAATTCCTCATCGGCAAGGGGGGCGGCAAAATTCGCAAGGTGCGCGACAGCACTGGAGCACGTGTCATCTTCCCT
GCGGCTGAGGACAAGGACCAGGACCTGATCACCATCATTGGAAAGGAGGACGCCGTCCGAGAGGCACAGAAGGAGCTGGAGGCCTTGATC
CAAAACCTGGATAATGTGGTGGAAGACTCCATGCTGGTGGACCCCAAGCACCACCGCCACTTCGTCATCCGCAGAGGCCAGGTCTTGCGG
GAGATTGCTGAAGAGTATGGCGGGGTGATGGTCAGCTTCCCACGCTCTGGCACACAGAGCGACAAAGTCACCCTCAAGGGCGCCAAGGAC
TGTGTGGAGGCAGCCAAGAAACGCATTCAGGAGATCATTGAGGACCTGGAAGCTCAGGTGACATTAGAATGTGCTATACCCCAGAAATTC
CATCGATCTGTCATGGGCCCCAAAGGTTCCAGAATCCAGCAGATTACTCGGGATTTCAGTGTTCAAATTAAATTCCCAGACAGAGAGGAG
AACGCAGTTCACAGTACAGAGCCAGTTGTCCAGGAGAATGGGGACGAAGCTGGGGAGGGGAGAGAGGCTAAAGATTGTGACCCCGGCTCT
CCAAGGAGGTGTGACATCATCATCATCTCTGGCCGGAAAGAAAAGTGTGAGGCTGCCAAGGAAGCTCTGGAGGCATTGGTTCCTGTCACC
ATTGAAGTAGAGGTGCCCTTTGACCTTCACCGTTACGTTATTGGGCAGAAAGGAAGTGGGATCCGCAAGATGATGGATGAGTTTGAGGTG
AACATACATGTCCCGGCACCTGAGCTGCAGTCTGACATCATCGCCATCACGGGCCTCGCTGCAAATTTGGACCGGGCCAAGGCTGGACTG
CTGGAGCGTGTGAAGGAGCTACAGGCCGAGCAGGAGGACCGGGCTTTAAGGAGTTTTAAGCTGAGTGTCACTGTAGACCCCAAATACCAT
CCCAAGATTATCGGGAGAAAGGGGGCAGTAATTACCCAAATCCGGTTGGAGCATGACGTGAACATCCAGTTTCCTGATAAGGACGATGGG
AACCAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGG
TCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAAC
CTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAG
TGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAG
TGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAG
GGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCA
CACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACA
ATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCA
CGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAAACAATGGGGCTGG
TTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCAGAGGTCACTTCATTTTTATTAAACAGTGAACTTGTCTGGCTTTGGCACT
CTCTGCCATTCTGTGCAGGCTGCAGTGGCTCCCCTGCCCAGCCTGCTCTCCCTAACCCCTTGTCCGCAAGGGGTGATGGCCGGCTGGTTG
TGGGCACTGGCGGTCAAGTGTGGAGGAGAGGGGTGGAGGCTGCCCCATTGAGATCTTCCTGCTGAGTCCTTTCCAGGGGCCAATTTTGGA
TGAGCATGGAGCTGTCACCTCTCAGCTGCTGGATGACTTGAGATGAAAAAGGAGAGACATGGAAAGGGAGACAGCCAGGTGGCACCTGCA
GCGGCTGCCCTCTGGGGCCACTTGGTAGTGTCCCCAGCCTACCTCTCCACAAGGGGATTTTGCTGATGGGTTCTTAGAGCCTTAGCAGCC
CTGGATGGTGGCCAGAAATAAAGGGACCAGCCCTTCATGGGTGGTGACGTGGTAGTCACTTGTAAGGGGAACAGAAACATTTTTGTTCTT
ATGGGGTGAGAATATAGACAGTGCCCTTGGTGCGAGGGAAGCAATTGAAAAGGAACTTGCCCTGAGCACTCCTGGTGCAGGTCTCCACCT
GCACATTGGGTGGGGCTCCTGGGAGGGAGACTCAGCCTTCCTCCTCATCCTCCCTGACCCTGCTCCTAGCACCCTGGAGAGTGCACATGC
CCCTTGGTCCTGGCAGGGCGCCAAGTCTGGCACCATGTTGGCCTCTTCAGGCCTGCTAGTCACTGGAAATTGAGGTCCATGGGGGAAATC
AAGGATGCTCAGTTTAAGGTACACTGTTTCCATGTTATGTTTCTACACATTGCTACCTCAGTGCTCCTGGAAACTTAGCTTTTGATGTCT
CCAAGTAGTCCACCTTCATTTAACTCTTTGAAACTGTATCATCTTTGCCAAGTAAGAGTGGTGGCCTATTTCAGCTGCTTTGACAAAATG
ACTGGCTCCTGACTTAACGTTCTATAAATGAATGTGCTGAAGCAAAGTGCCCATGGTGGCGGCGAAGAAGAGAAAGATGTGTTTTGTTTT
GGACTCTCTGTGGTCCCTTCCAATGCTGTGGGTTTCCAACCAGGGGAAGGGTCCCTTTTGCATTGCCAAGTGCCATAACCATGAGCACTA
CTCTACCATGGTTCTGCCTCCTGGCCAAGCAGGCTGGTTTGCAAGAATGAAATGAATGATTCTACAGCTAGGACTTAACCTTGAAATGGA
AAGTCATGCAATCCCATTTGCAGGATCTGTCTGTGCACATGCCTCTGTAGAGAGCAGCATTCCCAGGGACCTTGGAAACAGTTGGCACTG
TAAGGTGCTTGCTCCCCAAGACACATCCTAAAAGGTGTTGTAATGGTGAAAACGTCTTCCTTCTTTATTGCCCCTTCTTATTTATGTGAA
CAACTGTTTGTCTTTTTTTGTATCTTTTTTAAACTGTAAAGTTCAATTGTGAAAATGAATATCATGCAAATAAATTATGCAATTTTTTTT

>In-frame_HDLBP_ENST00000391975_chr2_242173235_-_TMPRSS2_ENST00000458356_chr21_42845423_-_4401nt
AGGCGGGATTGGGCCGCCGCCCTATATAGCAGCCGGGGCCCGGGCGCCGCGCCTCGGAGCGTCCCGGCTTCTCCCGCGCGGGGGGCGAGT
AAGCCAGCGGCAGGACCAGCGGGCGGGGGCCCACGACAAAAGCTGGCAGGCTGACAGAGGCGGCCTCAGGACGGACCTTCTGGCTACTGA
CCGTTTTGCTGTGGTTTTCCCGGATTGTGTGTAGGTGTGAGATCAACCATGAGTTCCGTTGCAGTTTTGACCCAAGAGAGTTTTGCTGAA
CACCGAAGTGGGCTGGTTCCGCAACAAATCAAAGTTGCCACTCTAAATTCAGAAGAGGAGAGCGACCCTCCAACCTACAAGGATGCCTTC
CCTCCACTTCCTGAGAAAGCTGCTTGCCTGGAAAGTGCCCAGGAACCCTCTGGAGCCTGGGGGAACAAGATCCGACCCATCAAGGCTTCT
GTCATCACTCAGGTGTTCCATGTACCCCTGGAGGAGAGAAAATACAAGGATATGAACCAGTTTGGAGAAGGTGAACAAGCAAAAATCTGC
CTTGAGATCATGCAGAGAACTGGTGCTCACTTGGAGCTGTCTTTGGCCAAAGACCAAGGCCTCTCCATCATGGTGTCAGGAAAGCTGGAT
GCTGTCATGAAAGCTCGGAAGGACATTGTTGCTAGACTGCAGACTCAGGCCTCAGCAACTGTTGCCATTCCCAAAGAACACCATCGCTTT
GTTATTGGCAAAAATGGAGAGAAACTGCAAGACTTGGAGCTAAAAACTGCAACCAAAATCCAGATCCCACGCCCAGATGACCCCAGCAAT
CAGATCAAGATCACTGGCACCAAAGAGGGCATCGAGAAAGCTCGCCATGAAGTCTTACTCATCTCTGCCGAGCAGGACAAACGTGCTGTG
GAGAGGCTAGAAGTAGAAAAGGCATTCCACCCCTTCATCGCTGGGCCGTATAATAGACTGGTTGGCGAGATCATGCAGGAGACAGGCACG
CGCATCAACATCCCCCCACCCAGCGTGAACCGGACAGAGATTGTCTTCACTGGAGAGAAGGAACAGTTGGCTCAGGCTGTGGCTCGCATC
AAGAAGATTTATGAGGAGAAGAAAAAGAAGACTACAACCATTGCAGTGGAAGTGAAGAAATCCCAACACAAGTATGTCATTGGGCCCAAG
GGCAATTCATTGCAGGAGATCCTTGAGAGAACTGGAGTTTCCGTTGAGATCCCACCCTCAGACAGCATCTCTGAGACTGTAATACTTCGA
GGCGAACCTGAAAAGTTAGGTCAGGCGTTGACTGAAGTCTATGCCAAGGCCAATAGCTTCACCGTCTCCTCTGTCGCCGCCCCTTCCTGG
CTTCACCGTTTCATCATTGGCAAGAAAGGGCAGAACCTGGCCAAAATCACTCAGCAGATGCCAAAGGTTCACATCGAGTTCACAGAGGGC
GAAGACAAGATCACCCTGGAGGGCCCTACAGAGGATGTCAATGTGGCCCAGGAACAGATAGAAGGCATGGTCAAAGATTTGATTAACCGG
ATGGACTATGTGGAGATCAACATCGACCACAAGTTCCACAGGCACCTCATTGGGAAGAGCGGTGCCAACATAAACAGAATCAAAGACCAG
TACAAGGTGTCCGTGCGCATCCCTCCTGACAGTGAGAAGAGCAATTTGATCCGCATCGAGGGGGACCCACAGGGCGTGCAGCAGGCCAAG
CGAGAGCTGCTGGAGCTTGCATCTCGCATGGAAAATGAGCGTACCAAGGATCTAATCATTGAGCAAAGATTTCATCGCACAATCATTGGG
CAGAAGGGTGAACGGATCCGTGAAATTCGTGACAAATTCCCAGAGGTCATCATTAACTTTCCAGACCCAGCACAAAAAAGTGACATTGTC
CAGCTCAGAGGACCTAAGAATGAGGTGGAAAAATGCACAAAATACATGCAGAAGATGGTGGCAGATCTGGTGGAAAATAGCTATTCAATT
TCTGTTCCGATCTTCAAACAGTTTCACAAGAATATCATTGGGAAAGGAGGCGCAAACATTAAAAAGATTCGTGAAGAAAGCAACACCAAA
ATCGACCTTCCAGCAGAGAATAGCAATTCAGAGACCATTATCATCACAGGCAAGCGAGCCAACTGCGAAGCTGCCCGGAGCAGGATTCTG
TCTATTCAGAAAGACCTGGCCAACATAGCCGAGGTAGAGGTCTCCATCCCTGCCAAGCTGCACAACTCCCTCATTGGCACCAAGGGCCGT
CTGATCCGCTCCATCATGGAGGAGTGCGGCGGGGTCCACATTCACTTTCCCGTGGAAGGTTCAGGAAGCGACACCGTTGTTATCAGGGGC
CCTTCCTCGGATGTGGAGAAGGCCAAGAAGCAGCTCCTGCATCTGGCGGAGGAGAAGCAAACCAAGAGTTTCACTGTTGACATCCGCGCC
AAGCCAGAATACCACAAATTCCTCATCGGCAAGGGGGGCGGCAAAATTCGCAAGGTGCGCGACAGCACTGGAGCACGTGTCATCTTCCCT
GCGGCTGAGGACAAGGACCAGGACCTGATCACCATCATTGGAAAGGAGGACGCCGTCCGAGAGGCACAGAAGGAGCTGGAGGCCTTGATC
CAAAACCTGGATAATGTGGTGGAAGACTCCATGCTGGTGGACCCCAAGCACCACCGCCACTTCGTCATCCGCAGAGGCCAGGTCTTGCGG
GAGATTGCTGAAGAGTATGGCGGGGTGATGGTCAGCTTCCCACGCTCTGGCACACAGAGCGACAAAGTCACCCTCAAGGGCGCCAAGGAC
TGTGTGGAGGCAGCCAAGAAACGCATTCAGGAGATCATTGAGGACCTGGAAGCTCAGGTGACATTAGAATGTGCTATACCCCAGAAATTC
CATCGATCTGTCATGGGCCCCAAAGGTTCCAGAATCCAGCAGATTACTCGGGATTTCAGTGTTCAAATTAAATTCCCAGACAGAGAGGAG
AACGCAGTTCACAGTACAGAGCCAGTTGTCCAGGAGAATGGGGACGAAGCTGGGGAGGGGAGAGAGGCTAAAGATTGTGACCCCGGCTCT
CCAAGGAGGTGTGACATCATCATCATCTCTGGCCGGAAAGAAAAGTGTGAGGCTGCCAAGGAAGCTCTGGAGGCATTGGTTCCTGTCACC
ATTGAAGTAGAGGTGCCCTTTGACCTTCACCGTTACGTTATTGGGCAGAAAGGAAGTGGGATCCGCAAGATGATGGATGAGTTTGAGGTG
AACATACATGTCCCGGCACCTGAGCTGCAGTCTGACATCATCGCCATCACGGGCCTCGCTGCAAATTTGGACCGGGCCAAGGCTGGACTG
CTGGAGCGTGTGAAGGAGCTACAGGCCGAGCAGGAGGACCGGGCTTTAAGGAGTTTTAAGCTGAGTGTCACTGTAGACCCCAAATACCAT
CCCAAGATTATCGGGAGAAAGGGGGCAGTAATTACCCAAATCCGGTTGGAGCATGACGTGAACATCCAGTTTCCTGATAAGGACGATGGG
AACCAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGG
TCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAAC
CTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAG
TGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAG
TGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAG
GGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCA
CACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACA
ATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCA
CGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAAACAATGGGGCTGG


Top

FusionGenePPI for HDLBP_TMPRSS2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
HDLBPAKTIP, MAGEA6, XPOT, XRCC5, PRKDC, ADAR, DHX9, SOS1, SUV39H1, CBX5, ARRB1, SIRT7, CDK2, COPS5, PSMD12, VPS35, S100A11, VPS29, UPF1, VPS26A, VPS36, UBA6, VPS25, TTC4, TYRO3, UBE2A, PLAUR, TOPBP1, TTK, ATP6V1B2, S100A10, ZW10, UBE4B, ZNF598, VCP, CSNK2A1, SMAD4, FAM46A, DYNLL1, EIF2A, FAU, KCMF1, IKBKG, WWOX, LGR4, OBSL1, CCDC8, ESR1, SERPINB5, BPGM, TMEM171, PTCRA, ZCCHC7, SERPINB3, ACTL6A, CYP1A1, HSPB1, CLUH, DDX43, GLMN, SMS, SAC3D1, NTRK1, SCARNA22, ERBB2, KIF11, MLH1, YBX1, SNW1, CDC5L, CDH1, STYX, WDR59, SERPINB2, CCDC102B, GTF2E2, HDHD2, SNRNP27, FGB, HSPA8, IL20RA, USP47, SYNCRIP, DLD, PDHA1, SDHATMPRSS2CLK1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for HDLBP_TMPRSS2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for HDLBP_TMPRSS2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneHDLBPC0004352Autistic Disorder1CTD_human
HgeneHDLBPC2931817Chromosome 2q37 deletion syndrome1CTD_human
TgeneTMPRSS2C0033578Prostatic Neoplasms2CTD_human