FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15931

FusionGeneSummary for HDAC1_SERINC2

check button Fusion gene summary
Fusion gene informationFusion gene name: HDAC1_SERINC2
Fusion gene ID: 15931
HgeneTgene
Gene symbol

HDAC1

SERINC2

Gene ID

3065

347735

Gene namehistone deacetylase 1serine incorporator 2
SynonymsGON-10|HD1|RPD3|RPD3L1FKSG84|PRO0899|TDE2|TDE2L
Cytomap

1p35.2-p35.1

1p35.2

Type of geneprotein-codingprotein-coding
Descriptionhistone deacetylase 1reduced potassium dependency, yeast homolog-like 1serine incorporator 2tumor differentially expressed protein 2
Modification date2018052320180523
UniProtAcc

Q13547

Q96SA4

Ensembl transtripts involved in fusion geneENST00000373548, ENST00000373541, 
ENST00000490081, 
ENST00000373710, 
ENST00000536859, ENST00000373709, 
ENST00000536384, ENST00000491976, 
Fusion gene scores* DoF score9 X 6 X 7=37810 X 4 X 9=360
# samples 910
** MAII scorelog2(9/378*10)=-2.0703893278914
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/360*10)=-1.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: HDAC1 [Title/Abstract] AND SERINC2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneHDAC1

GO:0000122

negative regulation of transcription by RNA polymerase II

18854353

HgeneHDAC1

GO:0006476

protein deacetylation

17172643|23629966

HgeneHDAC1

GO:0045893

positive regulation of transcription, DNA-templated

16762839

HgeneHDAC1

GO:0045944

positive regulation of transcription by RNA polymerase II

16762839

HgeneHDAC1

GO:0060766

negative regulation of androgen receptor signaling pathway

15919722

HgeneHDAC1

GO:0070932

histone H3 deacetylation

12590135

HgeneHDAC1

GO:0070933

histone H4 deacetylation

12590135


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVGBMTCGA-27-2519-01AHDAC1chr1

32768334

+SERINC2chr1

31883232

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000373548ENST00000373710HDAC1chr1

32768334

+SERINC2chr1

31883232

+
Frame-shiftENST00000373548ENST00000536859HDAC1chr1

32768334

+SERINC2chr1

31883232

+
5CDS-intronENST00000373548ENST00000373709HDAC1chr1

32768334

+SERINC2chr1

31883232

+
5CDS-intronENST00000373548ENST00000536384HDAC1chr1

32768334

+SERINC2chr1

31883232

+
5CDS-intronENST00000373548ENST00000491976HDAC1chr1

32768334

+SERINC2chr1

31883232

+
5UTR-3CDSENST00000373541ENST00000373710HDAC1chr1

32768334

+SERINC2chr1

31883232

+
5UTR-3CDSENST00000373541ENST00000536859HDAC1chr1

32768334

+SERINC2chr1

31883232

+
5UTR-intronENST00000373541ENST00000373709HDAC1chr1

32768334

+SERINC2chr1

31883232

+
5UTR-intronENST00000373541ENST00000536384HDAC1chr1

32768334

+SERINC2chr1

31883232

+
5UTR-intronENST00000373541ENST00000491976HDAC1chr1

32768334

+SERINC2chr1

31883232

+
intron-3CDSENST00000490081ENST00000373710HDAC1chr1

32768334

+SERINC2chr1

31883232

+
intron-3CDSENST00000490081ENST00000536859HDAC1chr1

32768334

+SERINC2chr1

31883232

+
intron-intronENST00000490081ENST00000373709HDAC1chr1

32768334

+SERINC2chr1

31883232

+
intron-intronENST00000490081ENST00000536384HDAC1chr1

32768334

+SERINC2chr1

31883232

+
intron-intronENST00000490081ENST00000491976HDAC1chr1

32768334

+SERINC2chr1

31883232

+

Top

FusionProtFeatures for HDAC1_SERINC2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
HDAC1

Q13547

SERINC2

Q96SA4

Responsible for the deacetylation of lysine residues onthe N-terminal part of the core histones (H2A, H2B, H3 and H4).Histone deacetylation gives a tag for epigenetic repression andplays an important role in transcriptional regulation, cell cycleprogression and developmental events. Histone deacetylases act viathe formation of large multiprotein complexes. Deacetylates SPproteins, SP1 and SP3, and regulates their function. Component ofthe BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calciumstimulation, HDAC1 is released from the complex and CREBBP isrecruited, which facilitates transcriptional activation.Deacetylates TSHZ3 and regulates its transcriptional repressoractivity. Deacetylates 'Lys-310' in RELA and thereby inhibits thetranscriptional activity of NF-kappa-B. Deacetylates NR1D2 andabrogates the effect of KAT5-mediated relieving of NR1D2transcription repression activity. Component of aRCOR/GFI/KDM1A/HDAC complex that suppresses, via histonedeacetylase (HDAC) recruitment, a number of genes implicated inmultilineage blood cell development. Involved in CIART-mediatedtranscriptional repression of the circadian transcriptionalactivator: CLOCK-ARNTL/BMAL1 heterodimer. Required for thetranscriptional repression of circadian target genes, such asPER1, mediated by the large PER complex or CRY1 through histonedeacetylation. {ECO:0000269|PubMed:12837748,ECO:0000269|PubMed:16478997, ECO:0000269|PubMed:17000776,ECO:0000269|PubMed:17704056, ECO:0000269|PubMed:17996965,ECO:0000269|PubMed:19081374, ECO:0000269|PubMed:19343227}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373709+010131_150-50456TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373709+010160_182-50456TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373709+010202_224-50456TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373709+010239_256-50456TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373709+010268_290-50456TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373709+010317_339-50456TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373709+010385_407-50456TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373709+01040_57-50456TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373709+010422_444-50456TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373709+0105_27-50456TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373709+01096_118-50456TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373710+011131_1505465TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373710+011160_1825465TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373710+011202_2245465TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373710+011239_2565465TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373710+011268_2905465TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373710+011317_3395465TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373710+011385_4075465TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373710+01140_575465TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373710+011422_4445465TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373710+0115_275465TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000373710+01196_1185465TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536384+010131_150-67460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536384+010160_182-67460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536384+010202_224-67460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536384+010239_256-67460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536384+010268_290-67460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536384+010317_339-67460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536384+010385_407-67460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536384+01040_57-67460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536384+010422_444-67460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536384+0105_27-67460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536384+01096_118-67460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536859+010131_150-62460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536859+010160_182-62460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536859+010202_224-62460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536859+010239_256-62460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536859+010268_290-62460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536859+010317_339-62460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536859+010385_407-62460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536859+01040_57-62460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536859+010422_444-62460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536859+0105_27-62460TransmembraneHelical
TgeneSERINC2chr1:32768334chr1:31883232ENST00000536859+01096_118-62460TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneHDAC1chr1:32768334chr1:31883232ENST00000373548+2149_32154483RegionNote=Histone deacetylase


Top

FusionGeneSequence for HDAC1_SERINC2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_HDAC1_ENST00000373548_chr1_32768334_+_SERINC2_ENST00000373710_chr1_31883232_+_514aa
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYMRSMRLREEESPGPSHTASCLCGSAPCILCSCCPAS
RNSTVSRLIFTFFLFLGVLVSIIMLSPGVESQLYKLPWVCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSSSR
DPRAAIQNGFWFFKFLILVGLTVGAFYIPDGSFTNIWFYFGVVGSFLFILIQLVLLIDFAHSWNQRWLGKAEECDSRAWYAGLFFFTLLF
YLLSIAAVALMFMYYTEPSGCHEGKVFISLNLTFCVCVSIAAVLPKVQDAQPNSGLLQASVITLYTMFVTWSALSSIPEQKCNPHLPTQL
GNETVVAGPEGYETQWWDAPSIVGLIIFLLCTLFISLRSSDHRQVNSLMQTEECPPMLDATQQQQQVAACEGRAFDNEQDGVTYSYSFFH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_HDAC1_ENST00000373548_chr1_32768334_+_SERINC2_ENST00000373710_chr1_31883232_+_1542nt
ATGGCGCAGACGCAGGGCACCCGGAGGAAAGTCTGTTACTACTACGACGGGGATGTTGGAAATTACTATTATGGACAAGGCCACCCAATG
AAGCCTCACCGAATCCGCATGACTCATAATTTGCTGCTCAACTATGGTCTCTACCGAAAAATGGAAATCTATATGAGAAGCATGAGGCTG
AGAGAGGAGGAGTCACCCGGACCCAGCCACACAGCGTCCTGCCTCTGCGGCTCTGCCCCCTGCATCCTGTGCAGCTGCTGCCCCGCCAGC
CGCAACTCCACCGTGAGCCGCCTCATCTTCACGTTCTTCCTCTTCCTGGGGGTGCTGGTGTCCATCATTATGCTGAGCCCGGGCGTGGAG
AGTCAGCTCTACAAGCTGCCCTGGGTGTGTGAGGAGGGGGCCGGGATCCCCACCGTCCTGCAGGGCCACATCGACTGTGGCTCCCTGCTT
GGCTACCGCGCTGTCTACCGCATGTGCTTCGCCACGGCGGCCTTCTTCTTCTTTTTCACCCTGCTCATGCTCTGCGTGAGCAGCAGCCGG
GACCCCCGGGCTGCCATCCAGAATGGGTTTTGGTTCTTTAAGTTCCTGATCCTGGTGGGCCTCACCGTGGGTGCCTTCTACATTCCTGAC
GGCTCCTTCACCAACATCTGGTTCTACTTCGGCGTCGTGGGCTCCTTCCTCTTCATCCTCATCCAGCTGGTGCTGCTCATCGACTTTGCG
CACTCCTGGAACCAGCGGTGGCTGGGCAAGGCCGAGGAGTGCGATTCCCGTGCCTGGTACGCAGGCCTCTTCTTCTTCACTCTCCTCTTC
TACTTGCTGTCGATCGCGGCCGTGGCGCTGATGTTCATGTACTACACTGAGCCCAGCGGCTGCCACGAGGGCAAGGTCTTCATCAGCCTC
AACCTCACCTTCTGTGTCTGCGTGTCCATCGCTGCTGTCCTGCCCAAGGTCCAGGACGCCCAGCCCAACTCGGGTCTGCTGCAGGCCTCG
GTCATCACCCTCTACACCATGTTTGTCACCTGGTCAGCCCTATCCAGTATCCCTGAACAGAAATGCAACCCCCATTTGCCAACCCAGCTG
GGCAACGAGACAGTTGTGGCAGGCCCCGAGGGCTATGAGACCCAGTGGTGGGATGCCCCGAGCATTGTGGGCCTCATCATCTTCCTCCTG
TGCACCCTCTTCATCAGTCTGCGCTCCTCAGACCACCGGCAGGTGAACAGCCTGATGCAGACCGAGGAGTGCCCACCTATGCTAGACGCC
ACACAGCAGCAGCAGCAGGTGGCAGCCTGTGAGGGCCGGGCCTTTGACAACGAGCAGGACGGCGTCACCTACAGCTACTCCTTCTTCCAC
TTCTGCCTGGTGCTGGCCTCACTGCACGTCATGATGACGCTCACCAACTGGTACAAGCCCGGTGAGACCCGGAAGATGATCAGCACGTGG
ACCGCCGTGTGGGTGAAGATCTGTGCCAGCTGGGCAGGGCTGCTCCTCTACCTGTGGACCCTGGTAGCCCCACTCCTCCTGCGCAACCGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_HDAC1_ENST00000373548_chr1_32768334_+_SERINC2_ENST00000373710_chr1_31883232_+_2104nt
CTCCCCCCTGGGTCGGACGCTGAGCGGAGCCGCGGGCGGGAGGGCGGACGGACCGACTGACGGTAGGGACGGGAGGCGAGCAAGATGGCG
CAGACGCAGGGCACCCGGAGGAAAGTCTGTTACTACTACGACGGGGATGTTGGAAATTACTATTATGGACAAGGCCACCCAATGAAGCCT
CACCGAATCCGCATGACTCATAATTTGCTGCTCAACTATGGTCTCTACCGAAAAATGGAAATCTATATGAGAAGCATGAGGCTGAGAGAG
GAGGAGTCACCCGGACCCAGCCACACAGCGTCCTGCCTCTGCGGCTCTGCCCCCTGCATCCTGTGCAGCTGCTGCCCCGCCAGCCGCAAC
TCCACCGTGAGCCGCCTCATCTTCACGTTCTTCCTCTTCCTGGGGGTGCTGGTGTCCATCATTATGCTGAGCCCGGGCGTGGAGAGTCAG
CTCTACAAGCTGCCCTGGGTGTGTGAGGAGGGGGCCGGGATCCCCACCGTCCTGCAGGGCCACATCGACTGTGGCTCCCTGCTTGGCTAC
CGCGCTGTCTACCGCATGTGCTTCGCCACGGCGGCCTTCTTCTTCTTTTTCACCCTGCTCATGCTCTGCGTGAGCAGCAGCCGGGACCCC
CGGGCTGCCATCCAGAATGGGTTTTGGTTCTTTAAGTTCCTGATCCTGGTGGGCCTCACCGTGGGTGCCTTCTACATTCCTGACGGCTCC
TTCACCAACATCTGGTTCTACTTCGGCGTCGTGGGCTCCTTCCTCTTCATCCTCATCCAGCTGGTGCTGCTCATCGACTTTGCGCACTCC
TGGAACCAGCGGTGGCTGGGCAAGGCCGAGGAGTGCGATTCCCGTGCCTGGTACGCAGGCCTCTTCTTCTTCACTCTCCTCTTCTACTTG
CTGTCGATCGCGGCCGTGGCGCTGATGTTCATGTACTACACTGAGCCCAGCGGCTGCCACGAGGGCAAGGTCTTCATCAGCCTCAACCTC
ACCTTCTGTGTCTGCGTGTCCATCGCTGCTGTCCTGCCCAAGGTCCAGGACGCCCAGCCCAACTCGGGTCTGCTGCAGGCCTCGGTCATC
ACCCTCTACACCATGTTTGTCACCTGGTCAGCCCTATCCAGTATCCCTGAACAGAAATGCAACCCCCATTTGCCAACCCAGCTGGGCAAC
GAGACAGTTGTGGCAGGCCCCGAGGGCTATGAGACCCAGTGGTGGGATGCCCCGAGCATTGTGGGCCTCATCATCTTCCTCCTGTGCACC
CTCTTCATCAGTCTGCGCTCCTCAGACCACCGGCAGGTGAACAGCCTGATGCAGACCGAGGAGTGCCCACCTATGCTAGACGCCACACAG
CAGCAGCAGCAGGTGGCAGCCTGTGAGGGCCGGGCCTTTGACAACGAGCAGGACGGCGTCACCTACAGCTACTCCTTCTTCCACTTCTGC
CTGGTGCTGGCCTCACTGCACGTCATGATGACGCTCACCAACTGGTACAAGCCCGGTGAGACCCGGAAGATGATCAGCACGTGGACCGCC
GTGTGGGTGAAGATCTGTGCCAGCTGGGCAGGGCTGCTCCTCTACCTGTGGACCCTGGTAGCCCCACTCCTCCTGCGCAACCGCGACTTC
AGCTGAGGCAGCCTCACAGCCTGCCATCTGGTGCCTCCTGCCACCTGGTGCCTCTCGGCTCAGTGACAGCCAACCTGCCCCCTCCCCACA
CCAATCAGCCAGGCTGAGCCCCCACCCCTGCCCCAGCTCCAGGACCTGCCCCTGAGCCGGGCCTTCTAGTCGTAGTGCCTTCAGGGTCCG
AGGAGCATCAGGCTCCTGCAGAGCCCCATCCCCCCGCCACACCCACACGGTGGAGCTGCCTCTTCCTTCCCCTCCTCCCTGTTGCCCATA
CTCAGCATCTCGGATGAAAGGGCTCCCTTGTCCTCAGGCTCCACGGGAGCGGGGCTGCTGGAGAGAGCGGGGAACTCCCACCACAGTGGG
GCATCCGGCACTGAAGCCCTGGTGTTCCTGGTCACGTCCCCCAGGGGACCCTGCCCACTTCCTGGACTTCGTGCCTTACTGAGTCTCTAA


Top

FusionGenePPI for HDAC1_SERINC2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
HDAC1ZBTB16, MBD3L1, BUB1, BUB1B, BUB3, CDC20, CDH1, MAD1L1, KDM1A, HMG20B, RCOR1, PHF21A, HDAC2, RB1, CTBP1, TGIF1, DDX5, DDX17, DNMT3B, GATA1, PHB, CDYL, SIN3A, RBBP4, MTA1, MTA2, HDAC1, CHD4, RBBP7, CHD1, SP1, KMT2A, TXNIP, SAP30, SAP130, ARID4B, SUDS3, HCFC1, PTMA, EFCAB6, AR, YY1, GTF2I, MBD3, MBD2, TAB2, GATAD2B, HDAC9, HSPD1, HSPA4, TOP2B, TOP2A, RELA, NCOR2, ATR, PML, RFC1, BRCA1, MYOD1, NFKB1, MDM2, TP53, SMARCB1, SMARCA2, PCNA, DNMT1, RBL1, FKBP3, NFIX, PPARD, RBL2, E2F4, BCOR, MIER1, TGIF2, DAXX, CBFA2T3, SIN3B, HBP1, E2F1, IKZF1, CHD3, MECOM, KLF11, SMAD2, DNMT3L, BCL6, CABIN1, VHL, HIF1AN, HIF1A, DNMT3A, SATB1, HUS1, RAD9A, PHF12, ING1, RUNX1T1, SP3, SUV39H1, EED, EZH2, TPD52L1, TAL1, NR2F2, SPEN, TLE4, HR, HEY2, IFRD1, MXD1, DZIP3, UHRF1, PADI4, MECP2, SPI1, MBD4, WHSC1, ING2, ZMYND11, H2AFY, KDM5C, ETHE1, ZMYM2, REST, PRDM1, FRA10F, CDKN1A, GLI1, GLI2, KCTD11, APBB1, BNIP3, SFPQ, ZBTB7A, MKX, CHFR, TLE1, CDK5R1, SMARCA4, PPP1CC, DACH1, NUDT21, PAPOLA, HSF1, BANF1, ZFP36, MBTPS1, CEBPB, APPL1, BACH1, ADD1, POU2F1, CREM, JUN, SMAD7, HELLS, DACT1, NKX2-5, BRMS1, SERPINB5, HOXA11, FOSL1, SAP30L, EP300, PAX3, CREBBP, NR3C1, GATAD2A, RUNX2, RUVBL2, NKX3-1, RUNX1, NUP98, NUP54, GRIP1, PLAGL1, NFE4, MAPK8, MAPK9, MAPK10, INSM1, CEBPD, REPIN1, GCM1, RERE, RFX1, TRIM27, NFYC, SNAI1, SNAI2, SNAI3, NKX3-2, MEN1, ESR1, BCL3, LMO4, SYK, GFI1, CRYAB, ESCO2, CTNNB1, PARP1, E4F1, MTA3, CIITA, HES1, BCL6B, STAT5A, CREB1, LCOR, PITX2, TAF6, GLI3, SMARCE1, SMARCC2, HSD11B2, BCL11B, BCL11A, BAZ2A, TFCP2, HIST1H3A, MYT1, KDM4A, STAT3, NR0B2, CCND1, CEBPA, MBD3L2, NKX2-2, KLF5, CSNK2A1, PFDN5, HNRNPD, NR2E1, KLF4, KLF1, NFKBIA, SATB2, MNT, MYC, TBX3, MAFK, PRKACA, TBP, SMAD3, ARID4A, ELK1, HDAC7, TP73, UHRF2, ACTA1, PBX1, LEF1, SENP1, ATM, ENO1, PHB2, TAF1B, ZEB2, SKIL, ZFPM2, UBASH3B, PIAS4, NR1D2, BHLHE41, NONO, SOX6, ZNF395, SMAD1, SMAD5, SMAD4, SMEK1, ZNF148, NPM1, PRDM5, EMD, CCDC6, OVOL1, SAMSN1, GABPA, MORF4L1, MORF4L2, DMAP1, ATF3, PPARG, MEF2D, MEF2A, SMC4, CCT8, TCP1, VIM, TRIM21, ESCO1, PARK7, TSC22D3, CDK2AP1, TADA2A, BANP, NFYB, IRF5, DEC1, HIST2H2AA3, PPP6R3, PPP2R1B, PPP2R1A, HDAC5, KAT5, BRINP1, HIST1H4A, HIST3H3, THAP11, PRKG1, NFYA, DDIT3, SMARCAD1, SOX2, KDM5B, HDGF, FOXP3, WISP2, PRDM4, GPS2, UBTF, PCGF6, RNF2, HIST3H2BB, CDKN2A, NR2C1, NR2C2, POLD3, TRIM28, KDM4C, NFATC1, TFAP4, BAHD1, VPRBP, AIRE, BRMS1L, MAGEA1, JDP2, ZNF76, SMARCC1, SMARCA5, SMARCD1, NOTCH1, FN1, SS18, SSX2, DNTTIP1, GSE1, HMG20A, RCOR3, ELMSAN1, TRERF1, E2F3, TMEM54, EID3, STAT1, BHLHE40, ADNP, ADH5, ARID5B, BEND3, CSNK2B, TBL1XR1, GATAD1, EHMT2, BBX, KPNA1, KPNA3, KPNA4, KPNA6, IDH2, KDM5A, ACADM, MIER2, MIER3, PFDN2, VBP1, PFDN6, C11orf30, FAM60A, ZMYND8, PWWP2A, RREB1, RCOR2, ESD, TNRC18, TRMT61A, C16orf87, WDR5, ZBTB2, ZMYM3, ZNF217, ZNF512B, ZNF516, ZNF521, ZNF592, ZNF609, ZNF687, ZNF827, IKZF2, PRRG4, HEXIM1, UBE2I, ZGPAT, BRCC3, SF3A1, HNRNPR, LARP7, PAAF1, RABEP2, NACC2, RARA, FEZF2, HAUS2, PRDM6, NFE2L2, DDB1, CUL4B, APEX1, PHF6, LOXL2, SUZ12, SUMO2, SIRT6, MAP1LC3B, HIST1H2AA, HIST1H2BA, ZNF219, PHF20L1, C22orf31, DDB2, PHF1, CHD5, EP400, MAPK11, MAPK14, POLR3A, PIN1, TLE3, PPP1CA, RAP1A, NRIP1, RUNX3, HIST1H3E, ALDH1B1, CCT6A, E2F6, ERCC6, H3F3A, IPO5, AFF1, PEX10, PIK3CA, RING1, SRPR, TCF20, CCT3, TRPS1, CDC42BPA, NOLC1, PHF14, DNAJC6, PARP2, CCT7, CCT4, CCT2, ZNF273, RALBP1, TRAK1, CCT5, EXOSC7, PHLPP1, MGA, COG4, TIMM13, DESI1, SNX9, TRPM7, BCAS3, ZFP64, BAHCC1, GPAM, EHMT1, CCNL2, ASCC2, HSDL2, ANKRD13B, C2orf69, FOXK1, PGBD3, STRAP, KMT2E, NF2, USP37, FOXK2, MAGEB2, CCNB1, NFATC2, RNF138, USP19, RORC, CDK4, EGFR, L3MBTL2, CASP8AP2, SFMBT1, CCDC71, PHF21B, TFDP1, PWWP2B, ZNF608, CCT6B, ZNF800, CYBRD1, ZNF639, RYBP, C9orf41, WIZ, RFX3, XYLT2, RTCB, PTOV1, DDX1, TBC1D32, TAF6L, CDK20, FOXJ1, HSD17B10, RNF157, YAP1SERINC2ATP6V0A2, ATP6V0A1, GHITM, ATP6V0D1, STOM, TMBIM6, LGALS3, GPR89B


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for HDAC1_SERINC2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneHDAC1Q13547DB01169Arsenic trioxideHistone deacetylase 1small moleculeapproved|investigational
HgeneHDAC1Q13547DB01593ZincHistone deacetylase 1small moleculeapproved|investigational
HgeneHDAC1Q13547DB02546VorinostatHistone deacetylase 1small moleculeapproved|investigational
HgeneHDAC1Q13547DB05015BelinostatHistone deacetylase 1small moleculeapproved|investigational
HgeneHDAC1Q13547DB06176RomidepsinHistone deacetylase 1small moleculeapproved|investigational
HgeneHDAC1Q13547DB06603PanobinostatHistone deacetylase 1small moleculeapproved|investigational
HgeneHDAC1Q13547DB08868FingolimodHistone deacetylase 1small moleculeapproved|investigational

Top

RelatedDiseases for HDAC1_SERINC2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneHDAC1C0036341Schizophrenia2PSYGENET
HgeneHDAC1C0007137Squamous cell carcinoma1CTD_human
HgeneHDAC1C0014175Endometriosis1CTD_human
HgeneHDAC1C0018799Heart Diseases1CTD_human
HgeneHDAC1C0340543Familial primary pulmonary hypertension1CTD_human
HgeneHDAC1C0525045Mood Disorders1PSYGENET
TgeneSERINC2C0001973Alcoholic Intoxication, Chronic1PSYGENET