FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15728

FusionGeneSummary for GXYLT2_VAV1

check button Fusion gene summary
Fusion gene informationFusion gene name: GXYLT2_VAV1
Fusion gene ID: 15728
HgeneTgene
Gene symbol

GXYLT2

VAV1

Gene ID

727936

7409

Gene nameglucoside xylosyltransferase 2vav guanine nucleotide exchange factor 1
SynonymsGLT8D4VAV
Cytomap

3p13

19p13.3

Type of geneprotein-codingprotein-coding
Descriptionglucoside xylosyltransferase 2glycosyltransferase 8 domain containing 4glycosyltransferase 8 domain-containing protein 4proto-oncogene vavvav 1 guanine nucleotide exchange factorvav 1 oncogene
Modification date2018051920180519
UniProtAcc

A0PJZ3

P15498

Ensembl transtripts involved in fusion geneENST00000389617, ENST00000304076, 
ENST00000602142, ENST00000596764, 
ENST00000539284, ENST00000599806, 
Fusion gene scores* DoF score3 X 2 X 2=126 X 5 X 5=150
# samples 36
** MAII scorelog2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(6/150*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: GXYLT2 [Title/Abstract] AND VAV1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneGXYLT2

GO:0016266

O-glycan processing

19940119


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-97-A4M5-01AGXYLT2chr3

72971486

+VAV1chr19

6821633

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000389617ENST00000304076GXYLT2chr3

72971486

+VAV1chr19

6821633

+
In-frameENST00000389617ENST00000602142GXYLT2chr3

72971486

+VAV1chr19

6821633

+
In-frameENST00000389617ENST00000596764GXYLT2chr3

72971486

+VAV1chr19

6821633

+
In-frameENST00000389617ENST00000539284GXYLT2chr3

72971486

+VAV1chr19

6821633

+
In-frameENST00000389617ENST00000599806GXYLT2chr3

72971486

+VAV1chr19

6821633

+

Top

FusionProtFeatures for GXYLT2_VAV1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GXYLT2

A0PJZ3

VAV1

P15498

Glycosyltransferase which elongates the O-linked glucoseattached to EGF-like repeats in the extracellular domain of Notchproteins by catalyzing the addition of xylose.{ECO:0000269|PubMed:19940119}. Couples tyrosine kinase signals with the activation ofthe Rho/Rac GTPases, thus leading to cell differentiation and/orproliferation.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGXYLT2chr3:72971486chr19:6821633ENST00000389617+3768_98200444Compositional biasNote=Arg-rich
HgeneGXYLT2chr3:72971486chr19:6821633ENST00000389617+371_4200444Topological domainCytoplasmic
HgeneGXYLT2chr3:72971486chr19:6821633ENST00000389617+375_25200444TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneVAV1chr3:72971486chr19:6821633ENST00000596764+126194_373107814DomainDH
TgeneVAV1chr3:72971486chr19:6821633ENST00000596764+126402_504107814DomainPH
TgeneVAV1chr3:72971486chr19:6821633ENST00000596764+126592_660107814DomainSH3 1
TgeneVAV1chr3:72971486chr19:6821633ENST00000596764+126671_765107814DomainSH2
TgeneVAV1chr3:72971486chr19:6821633ENST00000596764+126782_842107814DomainSH3 2
TgeneVAV1chr3:72971486chr19:6821633ENST00000602142+127194_373107846DomainDH
TgeneVAV1chr3:72971486chr19:6821633ENST00000602142+127402_504107846DomainPH
TgeneVAV1chr3:72971486chr19:6821633ENST00000602142+127592_660107846DomainSH3 1
TgeneVAV1chr3:72971486chr19:6821633ENST00000602142+127671_765107846DomainSH2
TgeneVAV1chr3:72971486chr19:6821633ENST00000602142+127782_842107846DomainSH3 2
TgeneVAV1chr3:72971486chr19:6821633ENST00000596764+126515_564107814Zinc fingerPhorbol-ester/DAG-type
TgeneVAV1chr3:72971486chr19:6821633ENST00000602142+127515_564107846Zinc fingerPhorbol-ester/DAG-type

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGXYLT2chr3:72971486chr19:6821633ENST00000389617+3726_443200444Topological domainLumenal
TgeneVAV1chr3:72971486chr19:6821633ENST00000596764+12633_99107814Compositional biasNote=Leu-rich
TgeneVAV1chr3:72971486chr19:6821633ENST00000602142+12733_99107846Compositional biasNote=Leu-rich
TgeneVAV1chr3:72971486chr19:6821633ENST00000596764+1261_119107814DomainCalponin-homology (CH)
TgeneVAV1chr3:72971486chr19:6821633ENST00000602142+1271_119107846DomainCalponin-homology (CH)


Top

FusionGeneSequence for GXYLT2_VAV1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000304076_chr19_6821633_+_917aa
MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRRRPPRPRPRAGRRGAARLEKL
ARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSTTKKFEHRIYPITFSVG
NPQEWKKLFKPCAAQRLFLPVIYTLSALSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLTDCVENEEAEGDEITEDL
MRSEPVSMPPKMTETDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEALGTPGAANLY
QVFIKYKERFLVTGRYCSQVESASKHLDRVAAAREDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKTHLLLQELVKHTQEAMEKENLR
LALDAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHTGRPKIDGELKITSVERRSKMDRTAFLLDKALLICKRRGDSTDLKDFV
NLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQGTELFFKTRELKKKWMEQFEMAISNITPENATANGHDFQMFSFEETTSCKACQMLLR
GTFTQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVEL
TKAEAEQNWWEGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKTNVEVKHIKIMTAEGLYRITEKKAFRGLT
ELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKTFGTAKARTDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEITGRV

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000602142_chr19_6821633_+_939aa
MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRRRPPRPRPRAGRRGAARLEKL
ARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSTTKKFEHRIYPITFSVG
NPQEWKKLFKPCAAQRLFLPVIYTLSALSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLTDCVENEEAEGDEITEDL
MRSEPVSMPPKMTETDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEALGTPGAANLY
QVFIKYKERFLVTGRYCSQVESASKHLDRVAAAREDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKTHLLLQELVKHTQEAMEKENLR
LALDAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHTGRPKIDGELKITSVERRSKMDRTAFLLDKALLICKRRGDSTDLKDFV
NLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQGTELFFKTRELKKKWMEQFEMAISNITPENATANGHDFQMFSFEETTSCKACQMLLR
GTFTQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVEL
TKAEAEQNWWEGRNTSTNEIGWFPCNRVKPTVHGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKTNVEVKH
IKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKTFGTAKARTDFCARDRSELSLKEGD

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000596764_chr19_6821633_+_907aa
MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRRRPPRPRPRAGRRGAARLEKL
ARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSTTKKFEHRIYPITFSVG
NPQEWKKLFKPCAAQRLFLPVIYTLSALSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLTDCVENEEAEGDEITEDL
MRSEPVSMPHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVTGRYCSQVESASKHLDRVAA
AREDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKTHLLLQELVKHTQEAMEKENLRLALDAMRDLAQCVNEVKRDNETLRQITNFQLS
IENLDQSLAHTGRPKIDGELKITSVERRSKMDRTAFLLDKALLICKRRGDSTDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGA
QGTELFFKTRELKKKWMEQFEMAISNITPENATANGHDFQMFSFEETTSCKACQMLLRGTFTQGYRCHRCRASAHKECLGRVPPCGRHGQ
DFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPTV
HGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKTNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNS
LKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKTFGTAKARTDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEITGRVGWFPANYVEE

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000539284_chr19_6821633_+_907aa
MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRRRPPRPRPRAGRRGAARLEKL
ARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSTTKKFEHRIYPITFSVG
NPQEWKKLFKPCAAQRLFLPVIYTLSALSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLTDCVENEEAEGDEITEDL
MRSEPVSMPHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVTGRYCSQVESASKHLDRVAA
AREDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKTHLLLQELVKHTQEAMEKENLRLALDAMRDLAQCVNEVKRDNETLRQITNFQLS
IENLDQSLAHTGRPKIDGELKITSVERRSKMDRTAFLLDKALLICKRRGDSTDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGA
QGTELFFKTRELKKKWMEQFEMAISNITPENATANGHDFQMFSFEETTSCKACQMLLRGTFTQGYRCHRCRASAHKECLGRVPPCGRHGQ
DFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPTV
HGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKTNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNS
LKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKTFGTAKARTDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEITGRVGWFPANYVEE

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000599806_chr19_6821633_+_939aa
MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRRRPPRPRPRAGRRGAARLEKL
ARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSTTKKFEHRIYPITFSVG
NPQEWKKLFKPCAAQRLFLPVIYTLSALSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLTDCVENEEAEGDEITEDL
MRSEPVSMPPKMTETDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEALGTPGAANLY
QVFIKYKERFLVTGRYCSQVESASKHLDRVAAAREDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKTHLLLQELVKHTQEAMEKENLR
LALDAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHTGRPKIDGELKITSVERRSKMDRTAFLLDKALLICKRRGDSTDLKDFV
NLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQGTELFFKTRELKKKWMEQFEMAISNITPENATANGHDFQMFSFEETTSCKACQMLLR
GTFTQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVFQEYYGLPPPPGAIGPFLRLNPGDIVEL
TKAEAEQNWWEGRNTSTNEIGWFPCNRVKPTVHGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKTNVEVKH
IKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKTFGTAKARTDFCARDRSELSLKEGD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000304076_chr19_6821633_+_2751nt
ATGAAGCTCCGCAGCAAGGCGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCT
GAGCCCCCAGCGCTGCCCGCGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTC
CCCGGGGCCAGCCCGGGAGTTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTG
GCGAGGAGGCCTGGAGAACCCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGG
CTGGAGGAGACGCTGGTCATGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAG
CCCGAGTTTGATAAGCAGTTACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGA
AACCCTCAGGAGTGGAAGAAATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGGTCATCTACACCCTGTCTGCTCTGTCCTGG
ACCCCGATCGCCCAGAACAGGGGGATCATGCCCTTCCCCACCGAGGAGGAGAGTGTAGGTGATGAAGACATCTACAGTGGCCTGTCCGAC
CAGATCGACGACACGGTGGAGGAGGATGAGGACCTGTATGACTGCGTGGAGAATGAGGAGGCGGAAGGCGACGAGATCTATGAGGACCTC
ATGCGCTCGGAGCCCGTGTCCATGCCGCCCAAGATGACAGAGTATGACAAGCGCTGCTGCTGCCTGCGGGAGATCCAGCAGACGGAGGAG
AAGTACACTGACACGCTGGGCTCCATCCAGCAGCATTTCTTGAAGCCCCTGCAACGGTTCCTGAAACCTCAAGACATTGAGATCATCTTT
ATCAACATTGAGGACCTGCTTCGTGTTCATACTCACTTCCTAAAGGAGATGAAGGAAGCCCTGGGCACCCCTGGCGCAGCCAATCTCTAC
CAGGTCTTCATCAAATACAAGGAGAGGTTCCTCGTCTATGGCCGCTACTGCAGCCAGGTGGAGTCAGCCAGCAAACACCTGGACCGTGTG
GCCGCAGCCCGGGAGGACGTGCAGATGAAGCTGGAGGAATGTTCTCAGAGAGCCAACAACGGGAGGTTCACCCTGCGGGACCTGCTGATG
GTGCCTATGCAGCGAGTTCTCAAATATCACCTCCTTCTCCAGGAGCTGGTGAAACACACGCAGGAGGCGATGGAGAAGGAGAACCTGCGG
CTGGCCCTGGATGCCATGAGGGACCTGGCTCAGTGCGTGAACGAGGTCAAGCGAGACAACGAGACACTGCGACAGATCACCAATTTCCAG
CTGTCCATTGAGAACCTGGACCAGTCTCTGGCTCACTATGGCCGGCCCAAGATCGACGGGGAACTCAAGATCACCTCGGTGGAACGGCGC
TCCAAGATGGACAGGTATGCCTTCCTGCTCGACAAAGCTCTACTCATCTGTAAGCGCAGGGGAGACTCCTATGACCTCAAGGACTTTGTA
AACCTGCACAGCTTCCAGGTTCGGGATGACTCTTCAGGAGACCGAGACAACAAGAAGTGGAGCCACATGTTCCTCCTGATCGAGGACCAA
GGTGCCCAGGGCTATGAGCTGTTCTTCAAGACAAGAGAATTGAAGAAGAAGTGGATGGAGCAGTTTGAGATGGCCATCTCCAACATCTAT
CCGGAGAATGCCACCGCCAACGGGCATGACTTCCAGATGTTCTCCTTTGAGGAGACCACATCCTGCAAGGCCTGTCAGATGCTGCTTAGA
GGTACCTTCTATCAGGGCTACCGCTGCCATCGGTGCCGGGCATCTGCACACAAGGAGTGTCTGGGGAGGGTCCCTCCATGTGGCCGACAT
GGGCAAGATTTCCCAGGAACTATGAAGAAGGACAAACTACATCGCAGGGCTCAGGACAAAAAGAGGAATGAGCTGGGTCTGCCCAAGATG
GAGGTGTTTCAGGAATACTACGGGCTTCCTCCACCCCCTGGAGCCATTGGACCCTTTCTACGGCTCAACCCTGGAGACATTGTGGAGCTC
ACGAAGGCTGAGGCTGAACAGAACTGGTGGGAGGGCCCTCCTCAGGACCTGTCTGTTCATCTCTGGTACGCAGGCCCCATGGAGCGGGCA
GGGGCAGAGAGCATCCTGGCCAACCGCTCGGACGGGACTTTCTTGGTGCGGCAGAGGGTGAAGGATGCAGCAGAATTTGCCATCAGCATT
AAATATAACGTCGAGGTCAAGCACATTAAAATCATGACAGCAGAAGGACTGTACCGGATCACAGAGAAAAAGGCTTTCCGGGGGCTTACG
GAGCTGGTGGAGTTTTACCAGCAGAACTCTCTAAAGGATTGCTTCAAGTCTCTGGACACCACCTTGCAGTTCCCCTTCAAGGAGCCTGAA
AAGAGAACCATCAGCAGGCCAGCAGTGGGAAGCACAAAGTATTTTGGCACAGCCAAAGCCCGCTATGACTTCTGCGCCCGAGACCGATCA
GAGCTGTCGCTCAAGGAGGGTGACATCATCAAGATCCTTAACAAGAAGGGACAGCAAGGCTGGTGGCGAGGGGAGATCTATGGCCGGGTT

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000602142_chr19_6821633_+_2817nt
ATGAAGCTCCGCAGCAAGGCGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCT
GAGCCCCCAGCGCTGCCCGCGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTC
CCCGGGGCCAGCCCGGGAGTTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTG
GCGAGGAGGCCTGGAGAACCCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGG
CTGGAGGAGACGCTGGTCATGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAG
CCCGAGTTTGATAAGCAGTTACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGA
AACCCTCAGGAGTGGAAGAAATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGGTCATCTACACCCTGTCTGCTCTGTCCTGG
ACCCCGATCGCCCAGAACAGGGGGATCATGCCCTTCCCCACCGAGGAGGAGAGTGTAGGTGATGAAGACATCTACAGTGGCCTGTCCGAC
CAGATCGACGACACGGTGGAGGAGGATGAGGACCTGTATGACTGCGTGGAGAATGAGGAGGCGGAAGGCGACGAGATCTATGAGGACCTC
ATGCGCTCGGAGCCCGTGTCCATGCCGCCCAAGATGACAGAGTATGACAAGCGCTGCTGCTGCCTGCGGGAGATCCAGCAGACGGAGGAG
AAGTACACTGACACGCTGGGCTCCATCCAGCAGCATTTCTTGAAGCCCCTGCAACGGTTCCTGAAACCTCAAGACATTGAGATCATCTTT
ATCAACATTGAGGACCTGCTTCGTGTTCATACTCACTTCCTAAAGGAGATGAAGGAAGCCCTGGGCACCCCTGGCGCAGCCAATCTCTAC
CAGGTCTTCATCAAATACAAGGAGAGGTTCCTCGTCTATGGCCGCTACTGCAGCCAGGTGGAGTCAGCCAGCAAACACCTGGACCGTGTG
GCCGCAGCCCGGGAGGACGTGCAGATGAAGCTGGAGGAATGTTCTCAGAGAGCCAACAACGGGAGGTTCACCCTGCGGGACCTGCTGATG
GTGCCTATGCAGCGAGTTCTCAAATATCACCTCCTTCTCCAGGAGCTGGTGAAACACACGCAGGAGGCGATGGAGAAGGAGAACCTGCGG
CTGGCCCTGGATGCCATGAGGGACCTGGCTCAGTGCGTGAACGAGGTCAAGCGAGACAACGAGACACTGCGACAGATCACCAATTTCCAG
CTGTCCATTGAGAACCTGGACCAGTCTCTGGCTCACTATGGCCGGCCCAAGATCGACGGGGAACTCAAGATCACCTCGGTGGAACGGCGC
TCCAAGATGGACAGGTATGCCTTCCTGCTCGACAAAGCTCTACTCATCTGTAAGCGCAGGGGAGACTCCTATGACCTCAAGGACTTTGTA
AACCTGCACAGCTTCCAGGTTCGGGATGACTCTTCAGGAGACCGAGACAACAAGAAGTGGAGCCACATGTTCCTCCTGATCGAGGACCAA
GGTGCCCAGGGCTATGAGCTGTTCTTCAAGACAAGAGAATTGAAGAAGAAGTGGATGGAGCAGTTTGAGATGGCCATCTCCAACATCTAT
CCGGAGAATGCCACCGCCAACGGGCATGACTTCCAGATGTTCTCCTTTGAGGAGACCACATCCTGCAAGGCCTGTCAGATGCTGCTTAGA
GGTACCTTCTATCAGGGCTACCGCTGCCATCGGTGCCGGGCATCTGCACACAAGGAGTGTCTGGGGAGGGTCCCTCCATGTGGCCGACAT
GGGCAAGATTTCCCAGGAACTATGAAGAAGGACAAACTACATCGCAGGGCTCAGGACAAAAAGAGGAATGAGCTGGGTCTGCCCAAGATG
GAGGTGTTTCAGGAATACTACGGGCTTCCTCCACCCCCTGGAGCCATTGGACCCTTTCTACGGCTCAACCCTGGAGACATTGTGGAGCTC
ACGAAGGCTGAGGCTGAACAGAACTGGTGGGAGGGCAGAAATACATCTACTAATGAAATTGGCTGGTTTCCTTGTAACAGGGTGAAGCCC
TATGTCCATGGCCCTCCTCAGGACCTGTCTGTTCATCTCTGGTACGCAGGCCCCATGGAGCGGGCAGGGGCAGAGAGCATCCTGGCCAAC
CGCTCGGACGGGACTTTCTTGGTGCGGCAGAGGGTGAAGGATGCAGCAGAATTTGCCATCAGCATTAAATATAACGTCGAGGTCAAGCAC
ATTAAAATCATGACAGCAGAAGGACTGTACCGGATCACAGAGAAAAAGGCTTTCCGGGGGCTTACGGAGCTGGTGGAGTTTTACCAGCAG
AACTCTCTAAAGGATTGCTTCAAGTCTCTGGACACCACCTTGCAGTTCCCCTTCAAGGAGCCTGAAAAGAGAACCATCAGCAGGCCAGCA
GTGGGAAGCACAAAGTATTTTGGCACAGCCAAAGCCCGCTATGACTTCTGCGCCCGAGACCGATCAGAGCTGTCGCTCAAGGAGGGTGAC
ATCATCAAGATCCTTAACAAGAAGGGACAGCAAGGCTGGTGGCGAGGGGAGATCTATGGCCGGGTTGGCTGGTTCCCTGCCAACTACGTG

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000596764_chr19_6821633_+_2721nt
ATGAAGCTCCGCAGCAAGGCGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCT
GAGCCCCCAGCGCTGCCCGCGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTC
CCCGGGGCCAGCCCGGGAGTTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTG
GCGAGGAGGCCTGGAGAACCCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGG
CTGGAGGAGACGCTGGTCATGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAG
CCCGAGTTTGATAAGCAGTTACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGA
AACCCTCAGGAGTGGAAGAAATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGGTCATCTACACCCTGTCTGCTCTGTCCTGG
ACCCCGATCGCCCAGAACAGGGGGATCATGCCCTTCCCCACCGAGGAGGAGAGTGTAGGTGATGAAGACATCTACAGTGGCCTGTCCGAC
CAGATCGACGACACGGTGGAGGAGGATGAGGACCTGTATGACTGCGTGGAGAATGAGGAGGCGGAAGGCGACGAGATCTATGAGGACCTC
ATGCGCTCGGAGCCCGTGTCCATGCCGCATTTCTTGAAGCCCCTGCAACGGTTCCTGAAACCTCAAGACATTGAGATCATCTTTATCAAC
ATTGAGGACCTGCTTCGTGTTCATACTCACTTCCTAAAGGAGATGAAGGAAGCCCTGGGCACCCCTGGCGCAGCCAATCTCTACCAGGTC
TTCATCAAATACAAGGAGAGGTTCCTCGTCTATGGCCGCTACTGCAGCCAGGTGGAGTCAGCCAGCAAACACCTGGACCGTGTGGCCGCA
GCCCGGGAGGACGTGCAGATGAAGCTGGAGGAATGTTCTCAGAGAGCCAACAACGGGAGGTTCACCCTGCGGGACCTGCTGATGGTGCCT
ATGCAGCGAGTTCTCAAATATCACCTCCTTCTCCAGGAGCTGGTGAAACACACGCAGGAGGCGATGGAGAAGGAGAACCTGCGGCTGGCC
CTGGATGCCATGAGGGACCTGGCTCAGTGCGTGAACGAGGTCAAGCGAGACAACGAGACACTGCGACAGATCACCAATTTCCAGCTGTCC
ATTGAGAACCTGGACCAGTCTCTGGCTCACTATGGCCGGCCCAAGATCGACGGGGAACTCAAGATCACCTCGGTGGAACGGCGCTCCAAG
ATGGACAGGTATGCCTTCCTGCTCGACAAAGCTCTACTCATCTGTAAGCGCAGGGGAGACTCCTATGACCTCAAGGACTTTGTAAACCTG
CACAGCTTCCAGGTTCGGGATGACTCTTCAGGAGACCGAGACAACAAGAAGTGGAGCCACATGTTCCTCCTGATCGAGGACCAAGGTGCC
CAGGGCTATGAGCTGTTCTTCAAGACAAGAGAATTGAAGAAGAAGTGGATGGAGCAGTTTGAGATGGCCATCTCCAACATCTATCCGGAG
AATGCCACCGCCAACGGGCATGACTTCCAGATGTTCTCCTTTGAGGAGACCACATCCTGCAAGGCCTGTCAGATGCTGCTTAGAGGTACC
TTCTATCAGGGCTACCGCTGCCATCGGTGCCGGGCATCTGCACACAAGGAGTGTCTGGGGAGGGTCCCTCCATGTGGCCGACATGGGCAA
GATTTCCCAGGAACTATGAAGAAGGACAAACTACATCGCAGGGCTCAGGACAAAAAGAGGAATGAGCTGGGTCTGCCCAAGATGGAGGTG
TTTCAGGAATACTACGGGCTTCCTCCACCCCCTGGAGCCATTGGACCCTTTCTACGGCTCAACCCTGGAGACATTGTGGAGCTCACGAAG
GCTGAGGCTGAACAGAACTGGTGGGAGGGCAGAAATACATCTACTAATGAAATTGGCTGGTTTCCTTGTAACAGGGTGAAGCCCTATGTC
CATGGCCCTCCTCAGGACCTGTCTGTTCATCTCTGGTACGCAGGCCCCATGGAGCGGGCAGGGGCAGAGAGCATCCTGGCCAACCGCTCG
GACGGGACTTTCTTGGTGCGGCAGAGGGTGAAGGATGCAGCAGAATTTGCCATCAGCATTAAATATAACGTCGAGGTCAAGCACATTAAA
ATCATGACAGCAGAAGGACTGTACCGGATCACAGAGAAAAAGGCTTTCCGGGGGCTTACGGAGCTGGTGGAGTTTTACCAGCAGAACTCT
CTAAAGGATTGCTTCAAGTCTCTGGACACCACCTTGCAGTTCCCCTTCAAGGAGCCTGAAAAGAGAACCATCAGCAGGCCAGCAGTGGGA
AGCACAAAGTATTTTGGCACAGCCAAAGCCCGCTATGACTTCTGCGCCCGAGACCGATCAGAGCTGTCGCTCAAGGAGGGTGACATCATC
AAGATCCTTAACAAGAAGGGACAGCAAGGCTGGTGGCGAGGGGAGATCTATGGCCGGGTTGGCTGGTTCCCTGCCAACTACGTGGAGGAA

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000539284_chr19_6821633_+_2721nt
ATGAAGCTCCGCAGCAAGGCGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCT
GAGCCCCCAGCGCTGCCCGCGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTC
CCCGGGGCCAGCCCGGGAGTTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTG
GCGAGGAGGCCTGGAGAACCCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGG
CTGGAGGAGACGCTGGTCATGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAG
CCCGAGTTTGATAAGCAGTTACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGA
AACCCTCAGGAGTGGAAGAAATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGGTCATCTACACCCTGTCTGCTCTGTCCTGG
ACCCCGATCGCCCAGAACAGGGGGATCATGCCCTTCCCCACCGAGGAGGAGAGTGTAGGTGATGAAGACATCTACAGTGGCCTGTCCGAC
CAGATCGACGACACGGTGGAGGAGGATGAGGACCTGTATGACTGCGTGGAGAATGAGGAGGCGGAAGGCGACGAGATCTATGAGGACCTC
ATGCGCTCGGAGCCCGTGTCCATGCCGCATTTCTTGAAGCCCCTGCAACGGTTCCTGAAACCTCAAGACATTGAGATCATCTTTATCAAC
ATTGAGGACCTGCTTCGTGTTCATACTCACTTCCTAAAGGAGATGAAGGAAGCCCTGGGCACCCCTGGCGCAGCCAATCTCTACCAGGTC
TTCATCAAATACAAGGAGAGGTTCCTCGTCTATGGCCGCTACTGCAGCCAGGTGGAGTCAGCCAGCAAACACCTGGACCGTGTGGCCGCA
GCCCGGGAGGACGTGCAGATGAAGCTGGAGGAATGTTCTCAGAGAGCCAACAACGGGAGGTTCACCCTGCGGGACCTGCTGATGGTGCCT
ATGCAGCGAGTTCTCAAATATCACCTCCTTCTCCAGGAGCTGGTGAAACACACGCAGGAGGCGATGGAGAAGGAGAACCTGCGGCTGGCC
CTGGATGCCATGAGGGACCTGGCTCAGTGCGTGAACGAGGTCAAGCGAGACAACGAGACACTGCGACAGATCACCAATTTCCAGCTGTCC
ATTGAGAACCTGGACCAGTCTCTGGCTCACTATGGCCGGCCCAAGATCGACGGGGAACTCAAGATCACCTCGGTGGAACGGCGCTCCAAG
ATGGACAGGTATGCCTTCCTGCTCGACAAAGCTCTACTCATCTGTAAGCGCAGGGGAGACTCCTATGACCTCAAGGACTTTGTAAACCTG
CACAGCTTCCAGGTTCGGGATGACTCTTCAGGAGACCGAGACAACAAGAAGTGGAGCCACATGTTCCTCCTGATCGAGGACCAAGGTGCC
CAGGGCTATGAGCTGTTCTTCAAGACAAGAGAATTGAAGAAGAAGTGGATGGAGCAGTTTGAGATGGCCATCTCCAACATCTATCCGGAG
AATGCCACCGCCAACGGGCATGACTTCCAGATGTTCTCCTTTGAGGAGACCACATCCTGCAAGGCCTGTCAGATGCTGCTTAGAGGTACC
TTCTATCAGGGCTACCGCTGCCATCGGTGCCGGGCATCTGCACACAAGGAGTGTCTGGGGAGGGTCCCTCCATGTGGCCGACATGGGCAA
GATTTCCCAGGAACTATGAAGAAGGACAAACTACATCGCAGGGCTCAGGACAAAAAGAGGAATGAGCTGGGTCTGCCCAAGATGGAGGTG
TTTCAGGAATACTACGGGCTTCCTCCACCCCCTGGAGCCATTGGACCCTTTCTACGGCTCAACCCTGGAGACATTGTGGAGCTCACGAAG
GCTGAGGCTGAACAGAACTGGTGGGAGGGCAGAAATACATCTACTAATGAAATTGGCTGGTTTCCTTGTAACAGGGTGAAGCCCTATGTC
CATGGCCCTCCTCAGGACCTGTCTGTTCATCTCTGGTACGCAGGCCCCATGGAGCGGGCAGGGGCAGAGAGCATCCTGGCCAACCGCTCG
GACGGGACTTTCTTGGTGCGGCAGAGGGTGAAGGATGCAGCAGAATTTGCCATCAGCATTAAATATAACGTCGAGGTCAAGCACATTAAA
ATCATGACAGCAGAAGGACTGTACCGGATCACAGAGAAAAAGGCTTTCCGGGGGCTTACGGAGCTGGTGGAGTTTTACCAGCAGAACTCT
CTAAAGGATTGCTTCAAGTCTCTGGACACCACCTTGCAGTTCCCCTTCAAGGAGCCTGAAAAGAGAACCATCAGCAGGCCAGCAGTGGGA
AGCACAAAGTATTTTGGCACAGCCAAAGCCCGCTATGACTTCTGCGCCCGAGACCGATCAGAGCTGTCGCTCAAGGAGGGTGACATCATC
AAGATCCTTAACAAGAAGGGACAGCAAGGCTGGTGGCGAGGGGAGATCTATGGCCGGGTTGGCTGGTTCCCTGCCAACTACGTGGAGGAA

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000599806_chr19_6821633_+_2817nt
ATGAAGCTCCGCAGCAAGGCGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCT
GAGCCCCCAGCGCTGCCCGCGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTC
CCCGGGGCCAGCCCGGGAGTTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTG
GCGAGGAGGCCTGGAGAACCCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGG
CTGGAGGAGACGCTGGTCATGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAG
CCCGAGTTTGATAAGCAGTTACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGA
AACCCTCAGGAGTGGAAGAAATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGGTCATCTACACCCTGTCTGCTCTGTCCTGG
ACCCCGATCGCCCAGAACAGGGGGATCATGCCCTTCCCCACCGAGGAGGAGAGTGTAGGTGATGAAGACATCTACAGTGGCCTGTCCGAC
CAGATCGACGACACGGTGGAGGAGGATGAGGACCTGTATGACTGCGTGGAGAATGAGGAGGCGGAAGGCGACGAGATCTATGAGGACCTC
ATGCGCTCGGAGCCCGTGTCCATGCCGCCCAAGATGACAGAGTATGACAAGCGCTGCTGCTGCCTGCGGGAGATCCAGCAGACGGAGGAG
AAGTACACTGACACGCTGGGCTCCATCCAGCAGCATTTCTTGAAGCCCCTGCAACGGTTCCTGAAACCTCAAGACATTGAGATCATCTTT
ATCAACATTGAGGACCTGCTTCGTGTTCATACTCACTTCCTAAAGGAGATGAAGGAAGCCCTGGGCACCCCTGGCGCAGCCAATCTCTAC
CAGGTCTTCATCAAATACAAGGAGAGGTTCCTCGTCTATGGCCGCTACTGCAGCCAGGTGGAGTCAGCCAGCAAACACCTGGACCGTGTG
GCCGCAGCCCGGGAGGACGTGCAGATGAAGCTGGAGGAATGTTCTCAGAGAGCCAACAACGGGAGGTTCACCCTGCGGGACCTGCTGATG
GTGCCTATGCAGCGAGTTCTCAAATATCACCTCCTTCTCCAGGAGCTGGTGAAACACACGCAGGAGGCGATGGAGAAGGAGAACCTGCGG
CTGGCCCTGGATGCCATGAGGGACCTGGCTCAGTGCGTGAACGAGGTCAAGCGAGACAACGAGACACTGCGACAGATCACCAATTTCCAG
CTGTCCATTGAGAACCTGGACCAGTCTCTGGCTCACTATGGCCGGCCCAAGATCGACGGGGAACTCAAGATCACCTCGGTGGAACGGCGC
TCCAAGATGGACAGGTATGCCTTCCTGCTCGACAAAGCTCTACTCATCTGTAAGCGCAGGGGAGACTCCTATGACCTCAAGGACTTTGTA
AACCTGCACAGCTTCCAGGTTCGGGATGACTCTTCAGGAGACCGAGACAACAAGAAGTGGAGCCACATGTTCCTCCTGATCGAGGACCAA
GGTGCCCAGGGCTATGAGCTGTTCTTCAAGACAAGAGAATTGAAGAAGAAGTGGATGGAGCAGTTTGAGATGGCCATCTCCAACATCTAT
CCGGAGAATGCCACCGCCAACGGGCATGACTTCCAGATGTTCTCCTTTGAGGAGACCACATCCTGCAAGGCCTGTCAGATGCTGCTTAGA
GGTACCTTCTATCAGGGCTACCGCTGCCATCGGTGCCGGGCATCTGCACACAAGGAGTGTCTGGGGAGGGTCCCTCCATGTGGCCGACAT
GGGCAAGATTTCCCAGGAACTATGAAGAAGGACAAACTACATCGCAGGGCTCAGGACAAAAAGAGGAATGAGCTGGGTCTGCCCAAGATG
GAGGTGTTTCAGGAATACTACGGGCTTCCTCCACCCCCTGGAGCCATTGGACCCTTTCTACGGCTCAACCCTGGAGACATTGTGGAGCTC
ACGAAGGCTGAGGCTGAACAGAACTGGTGGGAGGGCAGAAATACATCTACTAATGAAATTGGCTGGTTTCCTTGTAACAGGGTGAAGCCC
TATGTCCATGGCCCTCCTCAGGACCTGTCTGTTCATCTCTGGTACGCAGGCCCCATGGAGCGGGCAGGGGCAGAGAGCATCCTGGCCAAC
CGCTCGGACGGGACTTTCTTGGTGCGGCAGAGGGTGAAGGATGCAGCAGAATTTGCCATCAGCATTAAATATAACGTCGAGGTCAAGCAC
ATTAAAATCATGACAGCAGAAGGACTGTACCGGATCACAGAGAAAAAGGCTTTCCGGGGGCTTACGGAGCTGGTGGAGTTTTACCAGCAG
AACTCTCTAAAGGATTGCTTCAAGTCTCTGGACACCACCTTGCAGTTCCCCTTCAAGGAGCCTGAAAAGAGAACCATCAGCAGGCCAGCA
GTGGGAAGCACAAAGTATTTTGGCACAGCCAAAGCCCGCTATGACTTCTGCGCCCGAGACCGATCAGAGCTGTCGCTCAAGGAGGGTGAC
ATCATCAAGATCCTTAACAAGAAGGGACAGCAAGGCTGGTGGCGAGGGGAGATCTATGGCCGGGTTGGCTGGTTCCCTGCCAACTACGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000304076_chr19_6821633_+_3171nt
GTCGCCGCCGCCGCCGGCCGCCCGCCGGCCGCCACGACCCCAGTCCCCGGCGGGCGGGCGGAGGAGGCGACCGCCGCGCGCTGCTGCACT
CATCCTGCCGCCGCCGCGATGCGCAGAGGGGCCGAGCCGCCTGGGGGCCGCCGCCGCCGCCGCGCCGCACCATGAAGCTCCGCAGCAAGG
CGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCTGAGCCCCCAGCGCTGCCCG
CGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTCCCCGGGGCCAGCCCGGGAG
TTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTGGCGAGGAGGCCTGGAGAAC
CCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGGCTGGAGGAGACGCTGGTCA
TGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAGCCCGAGTTTGATAAGCAGT
TACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGAAACCCTCAGGAGTGGAAGA
AATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGGTCATCTACACCCTGTCTGCTCTGTCCTGGACCCCGATCGCCCAGAACA
GGGGGATCATGCCCTTCCCCACCGAGGAGGAGAGTGTAGGTGATGAAGACATCTACAGTGGCCTGTCCGACCAGATCGACGACACGGTGG
AGGAGGATGAGGACCTGTATGACTGCGTGGAGAATGAGGAGGCGGAAGGCGACGAGATCTATGAGGACCTCATGCGCTCGGAGCCCGTGT
CCATGCCGCCCAAGATGACAGAGTATGACAAGCGCTGCTGCTGCCTGCGGGAGATCCAGCAGACGGAGGAGAAGTACACTGACACGCTGG
GCTCCATCCAGCAGCATTTCTTGAAGCCCCTGCAACGGTTCCTGAAACCTCAAGACATTGAGATCATCTTTATCAACATTGAGGACCTGC
TTCGTGTTCATACTCACTTCCTAAAGGAGATGAAGGAAGCCCTGGGCACCCCTGGCGCAGCCAATCTCTACCAGGTCTTCATCAAATACA
AGGAGAGGTTCCTCGTCTATGGCCGCTACTGCAGCCAGGTGGAGTCAGCCAGCAAACACCTGGACCGTGTGGCCGCAGCCCGGGAGGACG
TGCAGATGAAGCTGGAGGAATGTTCTCAGAGAGCCAACAACGGGAGGTTCACCCTGCGGGACCTGCTGATGGTGCCTATGCAGCGAGTTC
TCAAATATCACCTCCTTCTCCAGGAGCTGGTGAAACACACGCAGGAGGCGATGGAGAAGGAGAACCTGCGGCTGGCCCTGGATGCCATGA
GGGACCTGGCTCAGTGCGTGAACGAGGTCAAGCGAGACAACGAGACACTGCGACAGATCACCAATTTCCAGCTGTCCATTGAGAACCTGG
ACCAGTCTCTGGCTCACTATGGCCGGCCCAAGATCGACGGGGAACTCAAGATCACCTCGGTGGAACGGCGCTCCAAGATGGACAGGTATG
CCTTCCTGCTCGACAAAGCTCTACTCATCTGTAAGCGCAGGGGAGACTCCTATGACCTCAAGGACTTTGTAAACCTGCACAGCTTCCAGG
TTCGGGATGACTCTTCAGGAGACCGAGACAACAAGAAGTGGAGCCACATGTTCCTCCTGATCGAGGACCAAGGTGCCCAGGGCTATGAGC
TGTTCTTCAAGACAAGAGAATTGAAGAAGAAGTGGATGGAGCAGTTTGAGATGGCCATCTCCAACATCTATCCGGAGAATGCCACCGCCA
ACGGGCATGACTTCCAGATGTTCTCCTTTGAGGAGACCACATCCTGCAAGGCCTGTCAGATGCTGCTTAGAGGTACCTTCTATCAGGGCT
ACCGCTGCCATCGGTGCCGGGCATCTGCACACAAGGAGTGTCTGGGGAGGGTCCCTCCATGTGGCCGACATGGGCAAGATTTCCCAGGAA
CTATGAAGAAGGACAAACTACATCGCAGGGCTCAGGACAAAAAGAGGAATGAGCTGGGTCTGCCCAAGATGGAGGTGTTTCAGGAATACT
ACGGGCTTCCTCCACCCCCTGGAGCCATTGGACCCTTTCTACGGCTCAACCCTGGAGACATTGTGGAGCTCACGAAGGCTGAGGCTGAAC
AGAACTGGTGGGAGGGCCCTCCTCAGGACCTGTCTGTTCATCTCTGGTACGCAGGCCCCATGGAGCGGGCAGGGGCAGAGAGCATCCTGG
CCAACCGCTCGGACGGGACTTTCTTGGTGCGGCAGAGGGTGAAGGATGCAGCAGAATTTGCCATCAGCATTAAATATAACGTCGAGGTCA
AGCACATTAAAATCATGACAGCAGAAGGACTGTACCGGATCACAGAGAAAAAGGCTTTCCGGGGGCTTACGGAGCTGGTGGAGTTTTACC
AGCAGAACTCTCTAAAGGATTGCTTCAAGTCTCTGGACACCACCTTGCAGTTCCCCTTCAAGGAGCCTGAAAAGAGAACCATCAGCAGGC
CAGCAGTGGGAAGCACAAAGTATTTTGGCACAGCCAAAGCCCGCTATGACTTCTGCGCCCGAGACCGATCAGAGCTGTCGCTCAAGGAGG
GTGACATCATCAAGATCCTTAACAAGAAGGGACAGCAAGGCTGGTGGCGAGGGGAGATCTATGGCCGGGTTGGCTGGTTCCCTGCCAACT
ACGTGGAGGAAGATTATTCTGAATACTGCTGAGCCCTGGTGCCTTGGCAGAGAGACGAGAAACTCCAGGCTCTGAGCCCGGCGTGGGCAG
GCAGCGGAGCCAGGGGCTGTGACAGCTCCCGGCGGGTGGAGACTTTGGGATGGACTGGAGGAGGCCAGCGTCCAGCTGGCGGTGCTCCCG
GGATGTGCCCTGACATGGTTAATTTATAACACCCCGATTTCCTCTTGGGTCCCCTCAAGCAGACGGGGCTCAAGGGGGTTACATTTAATA

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000602142_chr19_6821633_+_2978nt
GTCGCCGCCGCCGCCGGCCGCCCGCCGGCCGCCACGACCCCAGTCCCCGGCGGGCGGGCGGAGGAGGCGACCGCCGCGCGCTGCTGCACT
CATCCTGCCGCCGCCGCGATGCGCAGAGGGGCCGAGCCGCCTGGGGGCCGCCGCCGCCGCCGCGCCGCACCATGAAGCTCCGCAGCAAGG
CGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCTGAGCCCCCAGCGCTGCCCG
CGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTCCCCGGGGCCAGCCCGGGAG
TTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTGGCGAGGAGGCCTGGAGAAC
CCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGGCTGGAGGAGACGCTGGTCA
TGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAGCCCGAGTTTGATAAGCAGT
TACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGAAACCCTCAGGAGTGGAAGA
AATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGGTCATCTACACCCTGTCTGCTCTGTCCTGGACCCCGATCGCCCAGAACA
GGGGGATCATGCCCTTCCCCACCGAGGAGGAGAGTGTAGGTGATGAAGACATCTACAGTGGCCTGTCCGACCAGATCGACGACACGGTGG
AGGAGGATGAGGACCTGTATGACTGCGTGGAGAATGAGGAGGCGGAAGGCGACGAGATCTATGAGGACCTCATGCGCTCGGAGCCCGTGT
CCATGCCGCCCAAGATGACAGAGTATGACAAGCGCTGCTGCTGCCTGCGGGAGATCCAGCAGACGGAGGAGAAGTACACTGACACGCTGG
GCTCCATCCAGCAGCATTTCTTGAAGCCCCTGCAACGGTTCCTGAAACCTCAAGACATTGAGATCATCTTTATCAACATTGAGGACCTGC
TTCGTGTTCATACTCACTTCCTAAAGGAGATGAAGGAAGCCCTGGGCACCCCTGGCGCAGCCAATCTCTACCAGGTCTTCATCAAATACA
AGGAGAGGTTCCTCGTCTATGGCCGCTACTGCAGCCAGGTGGAGTCAGCCAGCAAACACCTGGACCGTGTGGCCGCAGCCCGGGAGGACG
TGCAGATGAAGCTGGAGGAATGTTCTCAGAGAGCCAACAACGGGAGGTTCACCCTGCGGGACCTGCTGATGGTGCCTATGCAGCGAGTTC
TCAAATATCACCTCCTTCTCCAGGAGCTGGTGAAACACACGCAGGAGGCGATGGAGAAGGAGAACCTGCGGCTGGCCCTGGATGCCATGA
GGGACCTGGCTCAGTGCGTGAACGAGGTCAAGCGAGACAACGAGACACTGCGACAGATCACCAATTTCCAGCTGTCCATTGAGAACCTGG
ACCAGTCTCTGGCTCACTATGGCCGGCCCAAGATCGACGGGGAACTCAAGATCACCTCGGTGGAACGGCGCTCCAAGATGGACAGGTATG
CCTTCCTGCTCGACAAAGCTCTACTCATCTGTAAGCGCAGGGGAGACTCCTATGACCTCAAGGACTTTGTAAACCTGCACAGCTTCCAGG
TTCGGGATGACTCTTCAGGAGACCGAGACAACAAGAAGTGGAGCCACATGTTCCTCCTGATCGAGGACCAAGGTGCCCAGGGCTATGAGC
TGTTCTTCAAGACAAGAGAATTGAAGAAGAAGTGGATGGAGCAGTTTGAGATGGCCATCTCCAACATCTATCCGGAGAATGCCACCGCCA
ACGGGCATGACTTCCAGATGTTCTCCTTTGAGGAGACCACATCCTGCAAGGCCTGTCAGATGCTGCTTAGAGGTACCTTCTATCAGGGCT
ACCGCTGCCATCGGTGCCGGGCATCTGCACACAAGGAGTGTCTGGGGAGGGTCCCTCCATGTGGCCGACATGGGCAAGATTTCCCAGGAA
CTATGAAGAAGGACAAACTACATCGCAGGGCTCAGGACAAAAAGAGGAATGAGCTGGGTCTGCCCAAGATGGAGGTGTTTCAGGAATACT
ACGGGCTTCCTCCACCCCCTGGAGCCATTGGACCCTTTCTACGGCTCAACCCTGGAGACATTGTGGAGCTCACGAAGGCTGAGGCTGAAC
AGAACTGGTGGGAGGGCAGAAATACATCTACTAATGAAATTGGCTGGTTTCCTTGTAACAGGGTGAAGCCCTATGTCCATGGCCCTCCTC
AGGACCTGTCTGTTCATCTCTGGTACGCAGGCCCCATGGAGCGGGCAGGGGCAGAGAGCATCCTGGCCAACCGCTCGGACGGGACTTTCT
TGGTGCGGCAGAGGGTGAAGGATGCAGCAGAATTTGCCATCAGCATTAAATATAACGTCGAGGTCAAGCACATTAAAATCATGACAGCAG
AAGGACTGTACCGGATCACAGAGAAAAAGGCTTTCCGGGGGCTTACGGAGCTGGTGGAGTTTTACCAGCAGAACTCTCTAAAGGATTGCT
TCAAGTCTCTGGACACCACCTTGCAGTTCCCCTTCAAGGAGCCTGAAAAGAGAACCATCAGCAGGCCAGCAGTGGGAAGCACAAAGTATT
TTGGCACAGCCAAAGCCCGCTATGACTTCTGCGCCCGAGACCGATCAGAGCTGTCGCTCAAGGAGGGTGACATCATCAAGATCCTTAACA
AGAAGGGACAGCAAGGCTGGTGGCGAGGGGAGATCTATGGCCGGGTTGGCTGGTTCCCTGCCAACTACGTGGAGGAAGATTATTCTGAAT

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000596764_chr19_6821633_+_3135nt
GTCGCCGCCGCCGCCGGCCGCCCGCCGGCCGCCACGACCCCAGTCCCCGGCGGGCGGGCGGAGGAGGCGACCGCCGCGCGCTGCTGCACT
CATCCTGCCGCCGCCGCGATGCGCAGAGGGGCCGAGCCGCCTGGGGGCCGCCGCCGCCGCCGCGCCGCACCATGAAGCTCCGCAGCAAGG
CGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCTGAGCCCCCAGCGCTGCCCG
CGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTCCCCGGGGCCAGCCCGGGAG
TTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTGGCGAGGAGGCCTGGAGAAC
CCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGGCTGGAGGAGACGCTGGTCA
TGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAGCCCGAGTTTGATAAGCAGT
TACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGAAACCCTCAGGAGTGGAAGA
AATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGGTCATCTACACCCTGTCTGCTCTGTCCTGGACCCCGATCGCCCAGAACA
GGGGGATCATGCCCTTCCCCACCGAGGAGGAGAGTGTAGGTGATGAAGACATCTACAGTGGCCTGTCCGACCAGATCGACGACACGGTGG
AGGAGGATGAGGACCTGTATGACTGCGTGGAGAATGAGGAGGCGGAAGGCGACGAGATCTATGAGGACCTCATGCGCTCGGAGCCCGTGT
CCATGCCGCATTTCTTGAAGCCCCTGCAACGGTTCCTGAAACCTCAAGACATTGAGATCATCTTTATCAACATTGAGGACCTGCTTCGTG
TTCATACTCACTTCCTAAAGGAGATGAAGGAAGCCCTGGGCACCCCTGGCGCAGCCAATCTCTACCAGGTCTTCATCAAATACAAGGAGA
GGTTCCTCGTCTATGGCCGCTACTGCAGCCAGGTGGAGTCAGCCAGCAAACACCTGGACCGTGTGGCCGCAGCCCGGGAGGACGTGCAGA
TGAAGCTGGAGGAATGTTCTCAGAGAGCCAACAACGGGAGGTTCACCCTGCGGGACCTGCTGATGGTGCCTATGCAGCGAGTTCTCAAAT
ATCACCTCCTTCTCCAGGAGCTGGTGAAACACACGCAGGAGGCGATGGAGAAGGAGAACCTGCGGCTGGCCCTGGATGCCATGAGGGACC
TGGCTCAGTGCGTGAACGAGGTCAAGCGAGACAACGAGACACTGCGACAGATCACCAATTTCCAGCTGTCCATTGAGAACCTGGACCAGT
CTCTGGCTCACTATGGCCGGCCCAAGATCGACGGGGAACTCAAGATCACCTCGGTGGAACGGCGCTCCAAGATGGACAGGTATGCCTTCC
TGCTCGACAAAGCTCTACTCATCTGTAAGCGCAGGGGAGACTCCTATGACCTCAAGGACTTTGTAAACCTGCACAGCTTCCAGGTTCGGG
ATGACTCTTCAGGAGACCGAGACAACAAGAAGTGGAGCCACATGTTCCTCCTGATCGAGGACCAAGGTGCCCAGGGCTATGAGCTGTTCT
TCAAGACAAGAGAATTGAAGAAGAAGTGGATGGAGCAGTTTGAGATGGCCATCTCCAACATCTATCCGGAGAATGCCACCGCCAACGGGC
ATGACTTCCAGATGTTCTCCTTTGAGGAGACCACATCCTGCAAGGCCTGTCAGATGCTGCTTAGAGGTACCTTCTATCAGGGCTACCGCT
GCCATCGGTGCCGGGCATCTGCACACAAGGAGTGTCTGGGGAGGGTCCCTCCATGTGGCCGACATGGGCAAGATTTCCCAGGAACTATGA
AGAAGGACAAACTACATCGCAGGGCTCAGGACAAAAAGAGGAATGAGCTGGGTCTGCCCAAGATGGAGGTGTTTCAGGAATACTACGGGC
TTCCTCCACCCCCTGGAGCCATTGGACCCTTTCTACGGCTCAACCCTGGAGACATTGTGGAGCTCACGAAGGCTGAGGCTGAACAGAACT
GGTGGGAGGGCAGAAATACATCTACTAATGAAATTGGCTGGTTTCCTTGTAACAGGGTGAAGCCCTATGTCCATGGCCCTCCTCAGGACC
TGTCTGTTCATCTCTGGTACGCAGGCCCCATGGAGCGGGCAGGGGCAGAGAGCATCCTGGCCAACCGCTCGGACGGGACTTTCTTGGTGC
GGCAGAGGGTGAAGGATGCAGCAGAATTTGCCATCAGCATTAAATATAACGTCGAGGTCAAGCACATTAAAATCATGACAGCAGAAGGAC
TGTACCGGATCACAGAGAAAAAGGCTTTCCGGGGGCTTACGGAGCTGGTGGAGTTTTACCAGCAGAACTCTCTAAAGGATTGCTTCAAGT
CTCTGGACACCACCTTGCAGTTCCCCTTCAAGGAGCCTGAAAAGAGAACCATCAGCAGGCCAGCAGTGGGAAGCACAAAGTATTTTGGCA
CAGCCAAAGCCCGCTATGACTTCTGCGCCCGAGACCGATCAGAGCTGTCGCTCAAGGAGGGTGACATCATCAAGATCCTTAACAAGAAGG
GACAGCAAGGCTGGTGGCGAGGGGAGATCTATGGCCGGGTTGGCTGGTTCCCTGCCAACTACGTGGAGGAAGATTATTCTGAATACTGCT
GAGCCCTGGTGCCTTGGCAGAGAGACGAGAAACTCCAGGCTCTGAGCCCGGCGTGGGCAGGCAGCGGAGCCAGGGGCTGTGACAGCTCCC
GGCGGGTGGAGACTTTGGGATGGACTGGAGGAGGCCAGCGTCCAGCTGGCGGTGCTCCCGGGATGTGCCCTGACATGGTTAATTTATAAC

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000539284_chr19_6821633_+_3135nt
GTCGCCGCCGCCGCCGGCCGCCCGCCGGCCGCCACGACCCCAGTCCCCGGCGGGCGGGCGGAGGAGGCGACCGCCGCGCGCTGCTGCACT
CATCCTGCCGCCGCCGCGATGCGCAGAGGGGCCGAGCCGCCTGGGGGCCGCCGCCGCCGCCGCGCCGCACCATGAAGCTCCGCAGCAAGG
CGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCTGAGCCCCCAGCGCTGCCCG
CGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTCCCCGGGGCCAGCCCGGGAG
TTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTGGCGAGGAGGCCTGGAGAAC
CCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGGCTGGAGGAGACGCTGGTCA
TGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAGCCCGAGTTTGATAAGCAGT
TACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGAAACCCTCAGGAGTGGAAGA
AATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGGTCATCTACACCCTGTCTGCTCTGTCCTGGACCCCGATCGCCCAGAACA
GGGGGATCATGCCCTTCCCCACCGAGGAGGAGAGTGTAGGTGATGAAGACATCTACAGTGGCCTGTCCGACCAGATCGACGACACGGTGG
AGGAGGATGAGGACCTGTATGACTGCGTGGAGAATGAGGAGGCGGAAGGCGACGAGATCTATGAGGACCTCATGCGCTCGGAGCCCGTGT
CCATGCCGCATTTCTTGAAGCCCCTGCAACGGTTCCTGAAACCTCAAGACATTGAGATCATCTTTATCAACATTGAGGACCTGCTTCGTG
TTCATACTCACTTCCTAAAGGAGATGAAGGAAGCCCTGGGCACCCCTGGCGCAGCCAATCTCTACCAGGTCTTCATCAAATACAAGGAGA
GGTTCCTCGTCTATGGCCGCTACTGCAGCCAGGTGGAGTCAGCCAGCAAACACCTGGACCGTGTGGCCGCAGCCCGGGAGGACGTGCAGA
TGAAGCTGGAGGAATGTTCTCAGAGAGCCAACAACGGGAGGTTCACCCTGCGGGACCTGCTGATGGTGCCTATGCAGCGAGTTCTCAAAT
ATCACCTCCTTCTCCAGGAGCTGGTGAAACACACGCAGGAGGCGATGGAGAAGGAGAACCTGCGGCTGGCCCTGGATGCCATGAGGGACC
TGGCTCAGTGCGTGAACGAGGTCAAGCGAGACAACGAGACACTGCGACAGATCACCAATTTCCAGCTGTCCATTGAGAACCTGGACCAGT
CTCTGGCTCACTATGGCCGGCCCAAGATCGACGGGGAACTCAAGATCACCTCGGTGGAACGGCGCTCCAAGATGGACAGGTATGCCTTCC
TGCTCGACAAAGCTCTACTCATCTGTAAGCGCAGGGGAGACTCCTATGACCTCAAGGACTTTGTAAACCTGCACAGCTTCCAGGTTCGGG
ATGACTCTTCAGGAGACCGAGACAACAAGAAGTGGAGCCACATGTTCCTCCTGATCGAGGACCAAGGTGCCCAGGGCTATGAGCTGTTCT
TCAAGACAAGAGAATTGAAGAAGAAGTGGATGGAGCAGTTTGAGATGGCCATCTCCAACATCTATCCGGAGAATGCCACCGCCAACGGGC
ATGACTTCCAGATGTTCTCCTTTGAGGAGACCACATCCTGCAAGGCCTGTCAGATGCTGCTTAGAGGTACCTTCTATCAGGGCTACCGCT
GCCATCGGTGCCGGGCATCTGCACACAAGGAGTGTCTGGGGAGGGTCCCTCCATGTGGCCGACATGGGCAAGATTTCCCAGGAACTATGA
AGAAGGACAAACTACATCGCAGGGCTCAGGACAAAAAGAGGAATGAGCTGGGTCTGCCCAAGATGGAGGTGTTTCAGGAATACTACGGGC
TTCCTCCACCCCCTGGAGCCATTGGACCCTTTCTACGGCTCAACCCTGGAGACATTGTGGAGCTCACGAAGGCTGAGGCTGAACAGAACT
GGTGGGAGGGCAGAAATACATCTACTAATGAAATTGGCTGGTTTCCTTGTAACAGGGTGAAGCCCTATGTCCATGGCCCTCCTCAGGACC
TGTCTGTTCATCTCTGGTACGCAGGCCCCATGGAGCGGGCAGGGGCAGAGAGCATCCTGGCCAACCGCTCGGACGGGACTTTCTTGGTGC
GGCAGAGGGTGAAGGATGCAGCAGAATTTGCCATCAGCATTAAATATAACGTCGAGGTCAAGCACATTAAAATCATGACAGCAGAAGGAC
TGTACCGGATCACAGAGAAAAAGGCTTTCCGGGGGCTTACGGAGCTGGTGGAGTTTTACCAGCAGAACTCTCTAAAGGATTGCTTCAAGT
CTCTGGACACCACCTTGCAGTTCCCCTTCAAGGAGCCTGAAAAGAGAACCATCAGCAGGCCAGCAGTGGGAAGCACAAAGTATTTTGGCA
CAGCCAAAGCCCGCTATGACTTCTGCGCCCGAGACCGATCAGAGCTGTCGCTCAAGGAGGGTGACATCATCAAGATCCTTAACAAGAAGG
GACAGCAAGGCTGGTGGCGAGGGGAGATCTATGGCCGGGTTGGCTGGTTCCCTGCCAACTACGTGGAGGAAGATTATTCTGAATACTGCT
GAGCCCTGGTGCCTTGGCAGAGAGACGAGAAACTCCAGGCTCTGAGCCCGGCGTGGGCAGGCAGCGGAGCCAGGGGCTGTGACAGCTCCC
GGCGGGTGGAGACTTTGGGATGGACTGGAGGAGGCCAGCGTCCAGCTGGCGGTGCTCCCGGGATGTGCCCTGACATGGTTAATTTATAAC

>In-frame_GXYLT2_ENST00000389617_chr3_72971486_+_VAV1_ENST00000599806_chr19_6821633_+_3237nt
GTCGCCGCCGCCGCCGGCCGCCCGCCGGCCGCCACGACCCCAGTCCCCGGCGGGCGGGCGGAGGAGGCGACCGCCGCGCGCTGCTGCACT
CATCCTGCCGCCGCCGCGATGCGCAGAGGGGCCGAGCCGCCTGGGGGCCGCCGCCGCCGCCGCGCCGCACCATGAAGCTCCGCAGCAAGG
CGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCTGAGCCCCCAGCGCTGCCCG
CGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTCCCCGGGGCCAGCCCGGGAG
TTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTGGCGAGGAGGCCTGGAGAAC
CCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGGCTGGAGGAGACGCTGGTCA
TGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAGCCCGAGTTTGATAAGCAGT
TACGCCAGTGGCCTGACTCATATACAAAGAAGTTTGAGCACAGAATCTACCCCATCACATTTTCTGTTGGAAACCCTCAGGAGTGGAAGA
AATTGTTCAAACCCTGTGCTGCCCAGAGACTCTTTCTTCCGGTCATCTACACCCTGTCTGCTCTGTCCTGGACCCCGATCGCCCAGAACA
GGGGGATCATGCCCTTCCCCACCGAGGAGGAGAGTGTAGGTGATGAAGACATCTACAGTGGCCTGTCCGACCAGATCGACGACACGGTGG
AGGAGGATGAGGACCTGTATGACTGCGTGGAGAATGAGGAGGCGGAAGGCGACGAGATCTATGAGGACCTCATGCGCTCGGAGCCCGTGT
CCATGCCGCCCAAGATGACAGAGTATGACAAGCGCTGCTGCTGCCTGCGGGAGATCCAGCAGACGGAGGAGAAGTACACTGACACGCTGG
GCTCCATCCAGCAGCATTTCTTGAAGCCCCTGCAACGGTTCCTGAAACCTCAAGACATTGAGATCATCTTTATCAACATTGAGGACCTGC
TTCGTGTTCATACTCACTTCCTAAAGGAGATGAAGGAAGCCCTGGGCACCCCTGGCGCAGCCAATCTCTACCAGGTCTTCATCAAATACA
AGGAGAGGTTCCTCGTCTATGGCCGCTACTGCAGCCAGGTGGAGTCAGCCAGCAAACACCTGGACCGTGTGGCCGCAGCCCGGGAGGACG
TGCAGATGAAGCTGGAGGAATGTTCTCAGAGAGCCAACAACGGGAGGTTCACCCTGCGGGACCTGCTGATGGTGCCTATGCAGCGAGTTC
TCAAATATCACCTCCTTCTCCAGGAGCTGGTGAAACACACGCAGGAGGCGATGGAGAAGGAGAACCTGCGGCTGGCCCTGGATGCCATGA
GGGACCTGGCTCAGTGCGTGAACGAGGTCAAGCGAGACAACGAGACACTGCGACAGATCACCAATTTCCAGCTGTCCATTGAGAACCTGG
ACCAGTCTCTGGCTCACTATGGCCGGCCCAAGATCGACGGGGAACTCAAGATCACCTCGGTGGAACGGCGCTCCAAGATGGACAGGTATG
CCTTCCTGCTCGACAAAGCTCTACTCATCTGTAAGCGCAGGGGAGACTCCTATGACCTCAAGGACTTTGTAAACCTGCACAGCTTCCAGG
TTCGGGATGACTCTTCAGGAGACCGAGACAACAAGAAGTGGAGCCACATGTTCCTCCTGATCGAGGACCAAGGTGCCCAGGGCTATGAGC
TGTTCTTCAAGACAAGAGAATTGAAGAAGAAGTGGATGGAGCAGTTTGAGATGGCCATCTCCAACATCTATCCGGAGAATGCCACCGCCA
ACGGGCATGACTTCCAGATGTTCTCCTTTGAGGAGACCACATCCTGCAAGGCCTGTCAGATGCTGCTTAGAGGTACCTTCTATCAGGGCT
ACCGCTGCCATCGGTGCCGGGCATCTGCACACAAGGAGTGTCTGGGGAGGGTCCCTCCATGTGGCCGACATGGGCAAGATTTCCCAGGAA
CTATGAAGAAGGACAAACTACATCGCAGGGCTCAGGACAAAAAGAGGAATGAGCTGGGTCTGCCCAAGATGGAGGTGTTTCAGGAATACT
ACGGGCTTCCTCCACCCCCTGGAGCCATTGGACCCTTTCTACGGCTCAACCCTGGAGACATTGTGGAGCTCACGAAGGCTGAGGCTGAAC
AGAACTGGTGGGAGGGCAGAAATACATCTACTAATGAAATTGGCTGGTTTCCTTGTAACAGGGTGAAGCCCTATGTCCATGGCCCTCCTC
AGGACCTGTCTGTTCATCTCTGGTACGCAGGCCCCATGGAGCGGGCAGGGGCAGAGAGCATCCTGGCCAACCGCTCGGACGGGACTTTCT
TGGTGCGGCAGAGGGTGAAGGATGCAGCAGAATTTGCCATCAGCATTAAATATAACGTCGAGGTCAAGCACATTAAAATCATGACAGCAG
AAGGACTGTACCGGATCACAGAGAAAAAGGCTTTCCGGGGGCTTACGGAGCTGGTGGAGTTTTACCAGCAGAACTCTCTAAAGGATTGCT
TCAAGTCTCTGGACACCACCTTGCAGTTCCCCTTCAAGGAGCCTGAAAAGAGAACCATCAGCAGGCCAGCAGTGGGAAGCACAAAGTATT
TTGGCACAGCCAAAGCCCGCTATGACTTCTGCGCCCGAGACCGATCAGAGCTGTCGCTCAAGGAGGGTGACATCATCAAGATCCTTAACA
AGAAGGGACAGCAAGGCTGGTGGCGAGGGGAGATCTATGGCCGGGTTGGCTGGTTCCCTGCCAACTACGTGGAGGAAGATTATTCTGAAT
ACTGCTGAGCCCTGGTGCCTTGGCAGAGAGACGAGAAACTCCAGGCTCTGAGCCCGGCGTGGGCAGGCAGCGGAGCCAGGGGCTGTGACA
GCTCCCGGCGGGTGGAGACTTTGGGATGGACTGGAGGAGGCCAGCGTCCAGCTGGCGGTGCTCCCGGGATGTGCCCTGACATGGTTAATT


Top

FusionGenePPI for GXYLT2_VAV1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GXYLT2FBL, SRPK2, MGAT4C, CD70, NEUROG3, HLA-DPA1, SCGB2A2, KCNC4, KLRG2, TRIM25VAV1XRCC6, EZH2, EMD, PRKCQ, BLNK, PLCG1, PIK3R1, XRCC5, TYK2, TEC, PRLR, RAC1, CDC42, JUN, SOCS1, EPOR, JAK2, BTK, SH3BP2, PDGFRB, EGFR, SLA, SHB, LAT, ABL1, RACGAP1, SYK, RAF1, MAPK1, MAP2K1, GRB2, ARHGDIB, FYN, HNRNPK, PAG1, CBLB, CBL, CD19, LCP2, PTPN6, SIAH2, SIAH1, IL6ST, S100B, ZAP70, PLCG2, PTK2B, DOCK2, INSR, SUZ12, EED, PHAX, TUBA1A, TUBB, KHDRBS1, FGFR1, DOK1, NOTCH1, CD5, SPI1, PTPN22, ERBB2, ERBB3, CD28, MS4A2, KLK7, PLBD1, NUB1, SPECC1L, SERPINA12, PALM2-AKAP2, APLP2, ACTBL2, SDR9C7, SERPINB2, APBB2, CDSN, ACTA2, CST6, DNAJC1, SBSN, DSG1, ATP2B2, CHEK1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GXYLT2_VAV1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GXYLT2_VAV1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneVAV1C0023493Adult T-Cell Lymphoma/Leukemia1CTD_human
TgeneVAV1C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneVAV1C0025149Medulloblastoma1CTD_human
TgeneVAV1C0152013Adenocarcinoma of lung (disorder)1CTD_human