FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15727

FusionGeneSummary for GXYLT2_PRICKLE2

check button Fusion gene summary
Fusion gene informationFusion gene name: GXYLT2_PRICKLE2
Fusion gene ID: 15727
HgeneTgene
Gene symbol

GXYLT2

PRICKLE2

Gene ID

727936

166336

Gene nameglucoside xylosyltransferase 2prickle planar cell polarity protein 2
SynonymsGLT8D4EPM5
Cytomap

3p13

3p14.1

Type of geneprotein-codingprotein-coding
Descriptionglucoside xylosyltransferase 2glycosyltransferase 8 domain containing 4glycosyltransferase 8 domain-containing protein 4prickle-like protein 2prickle homolog 2
Modification date2018051920180519
UniProtAcc

A0PJZ3

Q7Z3G6

Ensembl transtripts involved in fusion geneENST00000389617, ENST00000295902, 
ENST00000564377, 
Fusion gene scores* DoF score3 X 2 X 2=124 X 3 X 2=24
# samples 33
** MAII scorelog2(3/12*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(3/24*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: GXYLT2 [Title/Abstract] AND PRICKLE2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneGXYLT2

GO:0016266

O-glycan processing

19940119


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-D3-A2JG-06AGXYLT2chr3

72957710

+PRICKLE2chr3

64148805

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000389617ENST00000295902GXYLT2chr3

72957710

+PRICKLE2chr3

64148805

-
In-frameENST00000389617ENST00000564377GXYLT2chr3

72957710

+PRICKLE2chr3

64148805

-

Top

FusionProtFeatures for GXYLT2_PRICKLE2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GXYLT2

A0PJZ3

PRICKLE2

Q7Z3G6

Glycosyltransferase which elongates the O-linked glucoseattached to EGF-like repeats in the extracellular domain of Notchproteins by catalyzing the addition of xylose.{ECO:0000269|PubMed:19940119}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGXYLT2chr3:72957710chr3:64148805ENST00000389617+2768_98156444Compositional biasNote=Arg-rich
HgeneGXYLT2chr3:72957710chr3:64148805ENST00000389617+271_4156444Topological domainCytoplasmic
HgeneGXYLT2chr3:72957710chr3:64148805ENST00000389617+275_25156444TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgenePRICKLE2chr3:72957710chr3:64148805ENST00000295902-18504_51048845Compositional biasNote=Poly-Glu
TgenePRICKLE2chr3:72957710chr3:64148805ENST00000295902-18668_73048845Compositional biasNote=Arg-rich
TgenePRICKLE2chr3:72957710chr3:64148805ENST00000295902-18779_78448845Compositional biasNote=Poly-Ser
TgenePRICKLE2chr3:72957710chr3:64148805ENST00000295902-18128_19348845DomainLIM zinc-binding 1
TgenePRICKLE2chr3:72957710chr3:64148805ENST00000295902-18193_25348845DomainLIM zinc-binding 2
TgenePRICKLE2chr3:72957710chr3:64148805ENST00000295902-18253_31748845DomainLIM zinc-binding 3

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGXYLT2chr3:72957710chr3:64148805ENST00000389617+2726_443156444Topological domainLumenal
TgenePRICKLE2chr3:72957710chr3:64148805ENST00000295902-1818_12648845DomainPET


Top

FusionGeneSequence for GXYLT2_PRICKLE2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GXYLT2_ENST00000389617_chr3_72957710_+_PRICKLE2_ENST00000295902_chr3_64148805_-_953aa
MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRRRPPRPRPRAGRRGAARLEKL
ARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQVHQYTSCLPEEKVPTVNSPGEKLR
IKQLLHQLPPHDNEVRTCNSLDEEEKRELKLFSSQRKRENLGRGNVRPFPVTMTGAICEQCGGQINGGDIAVFASRAGHGVCWHPPCFVC
TVCNELLVDLIYFYQDGKIYCGRHHAECLKPRCAACDEIIFADECTEAEGRHWHMKHFCCFECETVLGGQRYIMKEGRPYCCHCFESLTA
ETCDTCAQHIGIDQGQMTTDGQHWHATETCFCCAHCKKSLLGRPFLPKQGQIFCSRACSAGEDPNGSDSSDSAFQNARAKESRRSAKIGK
NKGKTEEPMLNQHSQLQVSSNRLSADVDPLSLQMDMLSLSSQTPSLNRDPIWRSREEPYHTGNKMEQNQTQSPLQLLSQCNIRTSYSPGG
QGAGAQPEMWGKHFSNPKRSSSLAMTGHAGSFIKECREDTYPGRLRSQESYSDMSSQSFSETRGSIQVPKTEEEEEEEGGLSTQQCRTRH
PISSLKYTEDMTPTEQTPRGSMESLALSNATGLSADGGAKRQEHLSRFSMPDLSKDSGMNVSEKLSNMGTLNSSMQFRSAESVRSLLSAQ
QYQEMEGNLHQLSNPIGYRDLQSHGRMHQSFDFDGGMAGSKLPGQEGVRIQPMSERTRRRATSRDDNRRFRPHRSRRSRRSRSDNALHLA
SEREAISRLKDRPPLRAREDTDQFMRQRSFQESMGHGSRRDLYGQCPRTVSDLALQNAFGDRWGPYFAETDWCSTCSSSSESDNEGTFLG

>In-frame_GXYLT2_ENST00000389617_chr3_72957710_+_PRICKLE2_ENST00000564377_chr3_64148805_-_953aa
MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGALPGASPGVRRRRPPRPRPRAGRRGAARLEKL
ARRPGEPRSFQAVLPPELWIHLAVVACGNRLEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQVHQYTSCLPEEKVPTVNSPGEKLR
IKQLLHQLPPHDNEVRTCNSLDEEEKRELKLFSSQRKRENLGRGNVRPFPVTMTGAICEQCGGQINGGDIAVFASRAGHGVCWHPPCFVC
TVCNELLVDLIYFYQDGKIYCGRHHAECLKPRCAACDEIIFADECTEAEGRHWHMKHFCCFECETVLGGQRYIMKEGRPYCCHCFESLTA
ETCDTCAQHIGIDQGQMTTDGQHWHATETCFCCAHCKKSLLGRPFLPKQGQIFCSRACSAGEDPNGSDSSDSAFQNARAKESRRSAKIGK
NKGKTEEPMLNQHSQLQVSSNRLSADVDPLSLQMDMLSLSSQTPSLNRDPIWRSREEPYHTGNKMEQNQTQSPLQLLSQCNIRTSYSPGG
QGAGAQPEMWGKHFSNPKRSSSLAMTGHAGSFIKECREDTYPGRLRSQESYSDMSSQSFSETRGSIQVPKTEEEEEEEGGLSTQQCRTRH
PISSLKYTEDMTPTEQTPRGSMESLALSNATGLSADGGAKRQEHLSRFSMPDLSKDSGMNVSEKLSNMGTLNSSMQFRSAESVRSLLSAQ
QYQEMEGNLHQLSNPIGYRDLQSHGRMHQSFDFDGGMAGSKLPGQEGVRIQPMSERTRRRATSRDDNRRFRPHRSRRSRRSRSDNALHLA
SEREAISRLKDRPPLRAREDTDQFMRQRSFQESMGHGSRRDLYGQCPRTVSDLALQNAFGDRWGPYFAETDWCSTCSSSSESDNEGTFLG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GXYLT2_ENST00000389617_chr3_72957710_+_PRICKLE2_ENST00000295902_chr3_64148805_-_2859nt
ATGAAGCTCCGCAGCAAGGCGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCT
GAGCCCCCAGCGCTGCCCGCGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTC
CCCGGGGCCAGCCCGGGAGTTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTG
GCGAGGAGGCCTGGAGAACCCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGG
CTGGAGGAGACGCTGGTCATGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAG
CCCGAGTTTGATAAGCAGGTACACCAGTACTATAGCTGTCTCCCAGAAGAGAAAGTCCCTTATGTCAACAGTCCTGGAGAGAAACTGCGA
ATCAAGCAGCTACTACACCAGCTGCCGCCACATGACAATGAGGTTCGATATTGCAACTCCCTGGATGAGGAAGAGAAGAGGGAGCTGAAG
CTTTTCAGCAGCCAGAGGAAACGCGAAAACTTGGGCCGCGGGAATGTCAGGCCTTTCCCAGTCACCATGACAGGAGCTATTTGTGAACAG
TGCGGAGGCCAGATCAATGGTGGAGACATCGCTGTGTTTGCGTCACGCGCTGGCCACGGCGTTTGCTGGCACCCGCCGTGCTTCGTATGC
ACTGTCTGCAATGAGCTCCTGGTGGATCTGATCTACTTTTACCAAGATGGGAAGATATACTGTGGCAGGCACCATGCTGAGTGCCTGAAG
CCGCGCTGTGCTGCCTGCGATGAGATCATCTTTGCAGATGAATGCACAGAAGCTGAGGGGCGACACTGGCACATGAAACACTTTTGCTGC
TTCGAGTGTGAGACAGTGCTGGGCGGCCAGCGCTACATCATGAAGGAGGGAAGACCCTACTGTTGCCACTGCTTCGAGTCCTTGTATGCA
GAATATTGTGACACCTGTGCCCAACATATAGGTATCGACCAAGGTCAAATGACCTATGATGGCCAACACTGGCATGCCACTGAGACCTGT
TTCTGCTGTGCTCACTGCAAGAAATCCCTCCTGGGGCGGCCATTCCTCCCGAAGCAGGGCCAGATATTCTGCTCACGGGCCTGCAGTGCT
GGGGAAGACCCCAATGGTTCTGACTCCTCTGATTCCGCCTTCCAGAACGCCAGGGCCAAGGAGTCCCGGCGCAGTGCCAAAATTGGCAAG
AACAAGGGCAAGACGGAGGAGCCCATGCTGAACCAGCACAGCCAGCTGCAAGTGAGTTCTAACCGGCTGTCAGCCGACGTAGACCCCCTG
TCACTGCAGATGGACATGCTCAGCCTGTCCAGCCAGACACCCAGCCTCAACCGGGACCCCATCTGGAGGAGCCGGGAAGAGCCCTACCAT
TATGGGAACAAGATGGAGCAGAACCAGACCCAGAGCCCTCTGCAGCTCCTCAGCCAGTGCAACATCAGAACTTCCTACAGTCCAGGAGGG
CAAGGGGCTGGGGCCCAGCCCGAAATGTGGGGCAAGCACTTCAGCAACCCCAAAAGGAGCTCGTCACTGGCCATGACAGGACATGCTGGC
AGCTTCATCAAGGAATGCCGAGAAGACTATTACCCGGGGAGGCTGAGATCTCAGGAGAGCTACAGTGATATGTCTAGTCAGAGTTTCAGT
GAGACCCGAGGCAGCATCCAAGTCCCCAAATATGAGGAGGAAGAGGAAGAGGAAGGGGGCTTGTCCACTCAGCAGTGTCGGACCCGTCAT
CCCATCAGTTCCCTGAAATACACAGAGGACATGACGCCCACAGAGCAGACCCCTCGGGGCTCCATGGAATCCCTGGCCCTGTCTAATGCA
ACAGGCCTCTCTGCTGATGGTGGTGCCAAGCGCCAGGAGCACCTATCCCGATTTTCCATGCCTGACCTCAGCAAAGACTCTGGAATGAAT
GTGTCTGAGAAGCTGAGCAACATGGGCACTCTTAACTCGTCCATGCAGTTCCGGAGCGCAGAGTCAGTTCGCAGCCTGCTCTCTGCCCAG
CAGTACCAGGAGATGGAGGGAAACCTCCACCAGCTCAGCAACCCCATTGGCTACAGAGACCTGCAGTCCCACGGAAGGATGCATCAGAGC
TTTGATTTTGATGGAGGGATGGCGGGCAGCAAGCTGCCAGGGCAGGAGGGCGTGAGGATCCAGCCCATGAGTGAACGCACCCGGAGAAGA
GCTACTTCACGCGACGACAACCGCCGTTTCCGACCTCACAGGTCCAGGCGTTCCCGACGCTCTCGCTCCGACAACGCCCTCCACCTGGCC
AGCGAACGCGAGGCCATCTCCCGGTTAAAAGATAGGCCCCCTCTGAGAGCCAGGGAGGACTATGACCAATTTATGCGCCAGCGGAGCTTC
CAGGAGAGCATGGGGCATGGGTCCCGGAGGGACCTGTACGGCCAGTGCCCTAGGACTGTGTCGGACCTGGCTTTGCAGAATGCCTTTGGG
GACCGCTGGGGACCCTACTTCGCCGAGTATGATTGGTGTTCCACCTGCTCCTCCTCTTCAGAGTCTGACAACGAGGGCTATTTCCTAGGA
GAACCCATCCCCCAGCCAGCGCGCCTGCGATACGTCACAAGCGATGAGCTGCTGCACAAATACAGCTCCTACGGCCTCCCCAAATCTTCC

>In-frame_GXYLT2_ENST00000389617_chr3_72957710_+_PRICKLE2_ENST00000564377_chr3_64148805_-_2859nt
ATGAAGCTCCGCAGCAAGGCGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCT
GAGCCCCCAGCGCTGCCCGCGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTC
CCCGGGGCCAGCCCGGGAGTTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTG
GCGAGGAGGCCTGGAGAACCCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGG
CTGGAGGAGACGCTGGTCATGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAG
CCCGAGTTTGATAAGCAGGTACACCAGTACTATAGCTGTCTCCCAGAAGAGAAAGTCCCTTATGTCAACAGTCCTGGAGAGAAACTGCGA
ATCAAGCAGCTACTACACCAGCTGCCGCCACATGACAATGAGGTTCGATATTGCAACTCCCTGGATGAGGAAGAGAAGAGGGAGCTGAAG
CTTTTCAGCAGCCAGAGGAAACGCGAAAACTTGGGCCGCGGGAATGTCAGGCCTTTCCCAGTCACCATGACAGGAGCTATTTGTGAACAG
TGCGGAGGCCAGATCAATGGTGGAGACATCGCTGTGTTTGCGTCACGCGCTGGCCACGGCGTTTGCTGGCACCCGCCGTGCTTCGTATGC
ACTGTCTGCAATGAGCTCCTGGTGGATCTGATCTACTTTTACCAAGATGGGAAGATATACTGTGGCAGGCACCATGCTGAGTGCCTGAAG
CCGCGCTGTGCTGCCTGCGATGAGATCATCTTTGCAGATGAATGCACAGAAGCTGAGGGGCGACACTGGCACATGAAACACTTTTGCTGC
TTCGAGTGTGAGACAGTGCTGGGCGGCCAGCGCTACATCATGAAGGAGGGAAGACCCTACTGTTGCCACTGCTTCGAGTCCTTGTATGCA
GAATATTGTGACACCTGTGCCCAACATATAGGTATCGACCAAGGTCAAATGACCTATGATGGCCAACACTGGCATGCCACTGAGACCTGT
TTCTGCTGTGCTCACTGCAAGAAATCCCTCCTGGGGCGGCCATTCCTCCCGAAGCAGGGCCAGATATTCTGCTCACGGGCCTGCAGTGCT
GGGGAAGACCCCAATGGTTCTGACTCCTCTGATTCCGCCTTCCAGAACGCCAGGGCCAAGGAGTCCCGGCGCAGTGCCAAAATTGGCAAG
AACAAGGGCAAGACGGAGGAGCCCATGCTGAACCAGCACAGCCAGCTGCAAGTGAGTTCTAACCGGCTGTCAGCCGACGTAGACCCCCTG
TCACTGCAGATGGACATGCTCAGCCTGTCCAGCCAGACACCCAGCCTCAACCGGGACCCCATCTGGAGGAGCCGGGAAGAGCCCTACCAT
TATGGGAACAAGATGGAGCAGAACCAGACCCAGAGCCCTCTGCAGCTCCTCAGCCAGTGCAACATCAGAACTTCCTACAGTCCAGGAGGG
CAAGGGGCTGGGGCCCAGCCCGAAATGTGGGGCAAGCACTTCAGCAACCCCAAAAGGAGCTCGTCACTGGCCATGACAGGACATGCTGGC
AGCTTCATCAAGGAATGCCGAGAAGACTATTACCCGGGGAGGCTGAGATCTCAGGAGAGCTACAGTGATATGTCTAGTCAGAGTTTCAGT
GAGACCCGAGGCAGCATCCAAGTCCCCAAATATGAGGAGGAAGAGGAAGAGGAAGGGGGCTTGTCCACTCAGCAGTGTCGGACCCGTCAT
CCCATCAGTTCCCTGAAATACACAGAGGACATGACGCCCACAGAGCAGACCCCTCGGGGCTCCATGGAATCCCTGGCCCTGTCTAATGCA
ACAGGCCTCTCTGCTGATGGTGGTGCCAAGCGCCAGGAGCACCTATCCCGATTTTCCATGCCTGACCTCAGCAAAGACTCTGGAATGAAT
GTGTCTGAGAAGCTGAGCAACATGGGCACTCTTAACTCGTCCATGCAGTTCCGGAGCGCAGAGTCAGTTCGCAGCCTGCTCTCTGCCCAG
CAGTACCAGGAGATGGAGGGAAACCTCCACCAGCTCAGCAACCCCATTGGCTACAGAGACCTGCAGTCCCACGGAAGGATGCATCAGAGC
TTTGATTTTGATGGAGGGATGGCGGGCAGCAAGCTGCCAGGGCAGGAGGGCGTGAGGATCCAGCCCATGAGTGAACGCACCCGGAGAAGA
GCTACTTCACGCGACGACAACCGCCGTTTCCGACCTCACAGGTCCAGGCGTTCCCGACGCTCTCGCTCCGACAACGCCCTCCACCTGGCC
AGCGAACGCGAGGCCATCTCCCGGTTAAAAGATAGGCCCCCTCTGAGAGCCAGGGAGGACTATGACCAATTTATGCGCCAGCGGAGCTTC
CAGGAGAGCATGGGGCATGGGTCCCGGAGGGACCTGTACGGCCAGTGCCCTAGGACTGTGTCGGACCTGGCTTTGCAGAATGCCTTTGGG
GACCGCTGGGGACCCTACTTCGCCGAGTATGATTGGTGTTCCACCTGCTCCTCCTCTTCAGAGTCTGACAACGAGGGCTATTTCCTAGGA
GAACCCATCCCCCAGCCAGCGCGCCTGCGATACGTCACAAGCGATGAGCTGCTGCACAAATACAGCTCCTACGGCCTCCCCAAATCTTCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_GXYLT2_ENST00000389617_chr3_72957710_+_PRICKLE2_ENST00000295902_chr3_64148805_-_8204nt
GTCGCCGCCGCCGCCGGCCGCCCGCCGGCCGCCACGACCCCAGTCCCCGGCGGGCGGGCGGAGGAGGCGACCGCCGCGCGCTGCTGCACT
CATCCTGCCGCCGCCGCGATGCGCAGAGGGGCCGAGCCGCCTGGGGGCCGCCGCCGCCGCCGCGCCGCACCATGAAGCTCCGCAGCAAGG
CGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCTGAGCCCCCAGCGCTGCCCG
CGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTCCCCGGGGCCAGCCCGGGAG
TTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTGGCGAGGAGGCCTGGAGAAC
CCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGGCTGGAGGAGACGCTGGTCA
TGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAGCCCGAGTTTGATAAGCAGG
TACACCAGTACTATAGCTGTCTCCCAGAAGAGAAAGTCCCTTATGTCAACAGTCCTGGAGAGAAACTGCGAATCAAGCAGCTACTACACC
AGCTGCCGCCACATGACAATGAGGTTCGATATTGCAACTCCCTGGATGAGGAAGAGAAGAGGGAGCTGAAGCTTTTCAGCAGCCAGAGGA
AACGCGAAAACTTGGGCCGCGGGAATGTCAGGCCTTTCCCAGTCACCATGACAGGAGCTATTTGTGAACAGTGCGGAGGCCAGATCAATG
GTGGAGACATCGCTGTGTTTGCGTCACGCGCTGGCCACGGCGTTTGCTGGCACCCGCCGTGCTTCGTATGCACTGTCTGCAATGAGCTCC
TGGTGGATCTGATCTACTTTTACCAAGATGGGAAGATATACTGTGGCAGGCACCATGCTGAGTGCCTGAAGCCGCGCTGTGCTGCCTGCG
ATGAGATCATCTTTGCAGATGAATGCACAGAAGCTGAGGGGCGACACTGGCACATGAAACACTTTTGCTGCTTCGAGTGTGAGACAGTGC
TGGGCGGCCAGCGCTACATCATGAAGGAGGGAAGACCCTACTGTTGCCACTGCTTCGAGTCCTTGTATGCAGAATATTGTGACACCTGTG
CCCAACATATAGGTATCGACCAAGGTCAAATGACCTATGATGGCCAACACTGGCATGCCACTGAGACCTGTTTCTGCTGTGCTCACTGCA
AGAAATCCCTCCTGGGGCGGCCATTCCTCCCGAAGCAGGGCCAGATATTCTGCTCACGGGCCTGCAGTGCTGGGGAAGACCCCAATGGTT
CTGACTCCTCTGATTCCGCCTTCCAGAACGCCAGGGCCAAGGAGTCCCGGCGCAGTGCCAAAATTGGCAAGAACAAGGGCAAGACGGAGG
AGCCCATGCTGAACCAGCACAGCCAGCTGCAAGTGAGTTCTAACCGGCTGTCAGCCGACGTAGACCCCCTGTCACTGCAGATGGACATGC
TCAGCCTGTCCAGCCAGACACCCAGCCTCAACCGGGACCCCATCTGGAGGAGCCGGGAAGAGCCCTACCATTATGGGAACAAGATGGAGC
AGAACCAGACCCAGAGCCCTCTGCAGCTCCTCAGCCAGTGCAACATCAGAACTTCCTACAGTCCAGGAGGGCAAGGGGCTGGGGCCCAGC
CCGAAATGTGGGGCAAGCACTTCAGCAACCCCAAAAGGAGCTCGTCACTGGCCATGACAGGACATGCTGGCAGCTTCATCAAGGAATGCC
GAGAAGACTATTACCCGGGGAGGCTGAGATCTCAGGAGAGCTACAGTGATATGTCTAGTCAGAGTTTCAGTGAGACCCGAGGCAGCATCC
AAGTCCCCAAATATGAGGAGGAAGAGGAAGAGGAAGGGGGCTTGTCCACTCAGCAGTGTCGGACCCGTCATCCCATCAGTTCCCTGAAAT
ACACAGAGGACATGACGCCCACAGAGCAGACCCCTCGGGGCTCCATGGAATCCCTGGCCCTGTCTAATGCAACAGGCCTCTCTGCTGATG
GTGGTGCCAAGCGCCAGGAGCACCTATCCCGATTTTCCATGCCTGACCTCAGCAAAGACTCTGGAATGAATGTGTCTGAGAAGCTGAGCA
ACATGGGCACTCTTAACTCGTCCATGCAGTTCCGGAGCGCAGAGTCAGTTCGCAGCCTGCTCTCTGCCCAGCAGTACCAGGAGATGGAGG
GAAACCTCCACCAGCTCAGCAACCCCATTGGCTACAGAGACCTGCAGTCCCACGGAAGGATGCATCAGAGCTTTGATTTTGATGGAGGGA
TGGCGGGCAGCAAGCTGCCAGGGCAGGAGGGCGTGAGGATCCAGCCCATGAGTGAACGCACCCGGAGAAGAGCTACTTCACGCGACGACA
ACCGCCGTTTCCGACCTCACAGGTCCAGGCGTTCCCGACGCTCTCGCTCCGACAACGCCCTCCACCTGGCCAGCGAACGCGAGGCCATCT
CCCGGTTAAAAGATAGGCCCCCTCTGAGAGCCAGGGAGGACTATGACCAATTTATGCGCCAGCGGAGCTTCCAGGAGAGCATGGGGCATG
GGTCCCGGAGGGACCTGTACGGCCAGTGCCCTAGGACTGTGTCGGACCTGGCTTTGCAGAATGCCTTTGGGGACCGCTGGGGACCCTACT
TCGCCGAGTATGATTGGTGTTCCACCTGCTCCTCCTCTTCAGAGTCTGACAACGAGGGCTATTTCCTAGGAGAACCCATCCCCCAGCCAG
CGCGCCTGCGATACGTCACAAGCGATGAGCTGCTGCACAAATACAGCTCCTACGGCCTCCCCAAATCTTCCACATTAGGTGGCAGAGGAC
AGTTGCACAGCAGGAAAAGACAGAAGAGCAAAAACTGTATCATTTCTTAATATGATTGGGATCAGGGAATGGGAGAAGATGGGAGCTAAG
AATGTAAAGTCAGAAACTTGCACTGTTTTAAATGTTAAAGCGCTTTTGGGGGTGGCTTATGGGGGAGAAAAGGGAAAATGCTGTCAGTAG
ATGGAGGCAAGGTTACAGGTTGACTCAATAGGTAGTCACAGTTCTTGGCATGTTGAATATTATTTGCACATTTCACTTTGGAAACACAGT
AGACTCTATCGAGGCCAGGCTTGGTCACTTCCTTCCCATCAGTTCTGTGTTGAGTTGCCATCTCTCAAGATGGTAAATTGTTTCCTGCTC
GCTTTTATCCTCTCTGGTTCTCTTACTTTTAGGACCCTTTTTTCAGTAAGTAATTTGTTTATTAGCCAGGACCCAAGACTAAGTTATTTA
CATGTCCATTGTAAATGCAATGTAAATGAGAGTTCTGATAAAATATTTTTGTATTTTGTAATATCAAAGGAATTTCTATATCGTAGGACT
CAGTGGGGACTTGCATGCACATCCACCATTGTCTCTGAGTAGTATTGAAATGTGGCCCGGTACCACCTTTTTTTTTTTTTTTTTTTTTTC
TATACAAATTTGTTACATGTCAGTGAGACCTTTTTCAAAGGAACATATTCAATTTGGCTTTTTGTGGCTGAAAAAACATAACTGTTAGAC
CCAAAGCATTTTATGCTCCGTTCCATCTTAAGGAGCCATCCTTAAGTCTGCTCCCACCCTCAGTAGAATTTATTTTCTACAAAGTGGTAG
TAATTTTTTTTTAAATTGCAAATGTAATTTTTGCCAATTAGAGAAACCAACCGGTGTCAGTAAAATTCTGTGAGAAATGCCATCCCTGCT
GGGAATGTTGAAGTTACTTAATGTTGATCTATCCCTTGGGGAAAGTAAAAGTGACTGTGAGTGGTGCCATTGTGTGATGTCAGCATGACG
TTGTTTTGAATGTGGCATTATGTTCTGGTGCTCATGTTTCCTGGATTGTATTATCTGCTTTCCTTTACCAAGGCAGACAGAACTGCTGCC
TTAGCCTGACAACCGGTTGTCCTCAAAGCAAATGAACTTAAGCATTTGGGATTGAGGGACAGAAGGATTCTGAGGGGGCTCTGCGAGGGA
CGGTGTGTGACATGTCATGCCTGGAGAAGGAACAAGGCTATTTGAAAACAGAAGGCAGGTCAAGGGTAGAAGTTAAAGGAGAATCTGAAG
GCAGGTCAGGGAAAAGAAGAACTGGAAATGAAACAGAGGACAGGTGACAACCACCTCGAAGAGCTCCCAGAGATTGTAGAAAGAGTCCAG
TGTAACCAGCTTAGTAACCAGAGTATCTGGATTACCCAGGAAGGTTGAGCTGCTGAGATTTCAGTGGTGCAATGTCTTTAAAAAAACAGG
CTTTGTTGGGAGGGTATTTCCATTTTGAACTTTGAGGACTGTTGGTCAGAAAATGGGCTCAAAAGTGAGTTTGCTTAATGAAGACATTTA
ACGGTTGTGCTGTTTATAGTAAAATAAAACTCCCTACCTTGCTTCAGTTAAAAATGAAGCACTTGGTTTCTTCCATCCTCCTCCTCCCCT
TAATGGATTGTGGCAGTTGAAATAATCCATCGGATGACCCACCTGTAGTGAGATGTACTGTCGATGTAGTGCCCGGTGTATCTCAGTGGC
CATCTGCCATGGTGAGGTGAGCGTGATCTCTTTTCAGTATAGTAGTTAACATTTTCTAGTATTTTTTATGGAGAGAATGTCAAAAGTGGC
ATTTCAGACCCCGTCCCAGATGGGTCTGAGGAAAGGAAGGCTGTAAAGGACATGGTAATGGCACTCCATTCGGGATGTATTAAAATAATT
TGCTTTTCAGGTATTAATATGACATTTGTCATTGTCACTGATTTTTTTAAAAAAGCAATGCACATGTTGGTTGTGGCTGTTTTCCGCATG
CTATCTTCATATCTAAATGCTTCATTAATTATCCGAGCCTCCGGAGAATTAACTCTATTACGTTTGTATAGTAAGTTTGTAAACTGCTTG
GCAAACTGATTAAGAAATAATTTGCAATACCGTGCTACTAAAGTGGCAGGTTTCTGGTAGAAATTGTGCGAGTCCAATTTGGAGTTTTAA
GTTCCTTGATTGATGAAACTAAAAAGGCAATTTTGGAAAAAGAGAGGGGGAAAAGTAGATCACTTATCTTAGCAAACGGTTGAAAATATG
TCTGTCCTCTGTGGCCCCAAATCCAGTGAAAGAAATTCTCCCAGTAAAAGTTGCTTCCTAACTCTGTTTTTCTCAGAATACCTCTTACCT
TTCTCAAAGAAAGCTTCAACCACCATCATCAGAAAGAAGGTGGCCTAAAAACTGACACATGGCCAGTGCCCGGAGGGGTCTGGAGGCATA
AGTCTAGATGCCCAGAGAGCATCCAGGCACTGAACTGCTCAGAGCTTGAGATGAAATGACATACAAGCTTCAGGGTAAAACTGTCTACTA
GCAAGATTACCTCCCTCAATTCTACCATTGCAGATTTCTTCTGACCCCAAATGCAACCTTACAGAGAATGCTGAATGAGGAAGGCCAATT
CCTTACAATGATGGCAGAACCCCCAAGCGAATGCCCTATTGAGGAGAAGGACATCACTGTATTTGGAATTCTGCCTGCTAGTGATAGCTC
ACACATCACATCCCAGAATCCCACTCCCAATGCATTATTTCCTGAGGCAAGAACTTAAGGTCCTCACCTAATTCCTCCATCACAACCATT
AACTCTTATTGGACAAGCTCCTCCTGTGAGTAGGGCCTGTACTCACTTCCTCTTAGATCATAATTCCATCTTCAAGAGACTGATTTCCAG
AATAGTAATCTTTTTCCAGCGTTCTCTCTTCTCCAATGCCCTGGTTGTTATTTTTCCCACCTCTCCTAATATTGATCTTCTTGTCTTTTG
GTTAGAACTGCAACTTCGGAGTTGAGTTCATTTCCTATTGCTGCTCAATTCAGTAGCAACATAGCTGGCTTGTTCCCAGACCCAGGAAGT
ATAAGTCATTGACAGTTTCCTGAGTGGCTCTGCCAATCCATACCACCCTTGGTACTGTGAAAAGGCTTCTTGGCAGCCAGGTGGCATTGA
GGATGGTATTCAGGGCGCTTTCCTTCTGTCATATAGTTGTGGGATCTCTACCAAGTGTGAAGGTGAATGAGGTAAGGGAGATCAGAACCA
TGCTTCCTGGTTTTTCATACATCCAAGGAAGAAGTCCTGGTGTGGGTTGTTTGACACCTTCTTTCCACTTTCACCTTTTATTTTTTATTC
CTTCCTTTCTACCCCCAACCAGTCGAGCAAATGAGCAATTTTGTGTTTCTAATACAGGATCTGGAAGTAGTGCTTTCTAATCCTCATTTC
CTGTAGGATGTTCCTGCACTATAACAAGATTATGTTTTCTTCCTTCTGCAGCAGCTTTCTGCTTCTTGGGTACTACTAGCTATTGTTCAA
TTCAGGTGAGGCCTGTGATGACATATATGTAGCATGTGCTCTGCGCTCCCTGCAAGCTGAGCAGATACAACCAATGCATCACTGTATACT
CTTGCTGAGAATGTGGATGCAGCCTCACAGATCTTTGCAACACTCCAACCAGCCAGGACCAGTTGATCAGAACTGATCTTATTGGTCTGA
TAACCAATCTTATTTGTGAACTGATTCATATCTGTCTTTCCACTCTTGGTTCTCTTGCCGTAGAACAAAAACAGTTTAGGAAGCATAATT
ACGAACATTTAGGAACCAATATGTATAAGTAATTCGGAGACTCCAATTCACCTGCCCCTCCCCCATCCCAGGTTGTGGAGGCTCGAGGAA
GCTGACTTCTTAGGCTAAAGGACAAAAAAATCTCTTTACCTCCTTGGCCATTTTCATGTTCTCTGCCAATTACTATAGGCAGTCTTCATT
TTGCAGAGGTGAGGTAAGACTTCATCTTATTCTTCATGTAATCCCACCTTCTAACAAAAAATAAATAAATATTTAAATTCCAAGGAGAAG
TGTTCTTTGTGTATTTCTAGCAGAAAACAGATGCTTAAGCCTAAGAAGGAAGATCCGTCCATGACAAAGGAAAGTGGAAAACTGAACCAG
TTATCTGAATACTTCATGCCAGGACAGTTGCTATTAGCAACTGTTTTGCACCTTCAGGGCTTTAAAATGGGCTCTGCAGACAGCATTTGC
ATATGCAAGACTCAGTAGCCAAGCCTCCACTGCCAATTGTTGAAGGCAGTTTCAGATCGCCACCTTTTGAGGTACATTTCTTTAAGCACA
AGAGAAGTAGAAATGGCCTTTGCCTTGTCTCCAGTGGTTTGTCCCTCTGGTGCCTCAGCAGATACCAGAGCTTATTCTTATGACCATTTG
GAAGTAGTCCTCAAAGTAAAGATCAAGAAAAAATTGGATTCTTTTTCCATTTTCTCATAATAGTAGCCTAGTCAACACAAGACTCCCATA
AAATATGACTCACTATTGGGAGCCATACTATTTTATAAGCTTACTTCCTGCTGACAAAACTAGCTTTCCTCAAGGAAATATAAAGGAGGG
GAAAGTCACATAGTGTTAGGAAAACATTCCTGTGTTTTGAATACGATGAATCCATAGGATAGAGAAAAATCTGCTTGTTCTATTCTGAGA
GTTCTCTGAGATATCCCTTCACTCTGCTTGGCATTTGGCCATTGATATTCAACAGGTCACTGACCAAGCTTTTCTAAATTTTTCAGAGAG
AGTTACTTACCAGTAAGGTCTGTTCTTAAACCTACCTAGTTGATTTTCATATCTTTCCATAAAGTGTCATGATTCTGTCATAGACCCTGA
CTTAACATTGTAAGGACTATGAGTCCTCCATTTTTTAATTAATTTTTTTTTAGCAAATTAGGACTTCGGCAGGTTTTCCTCTCCTAAACT
CATTCTTTCCTCCACAGGATTGCTTTGTCCATCTCCTGCTTTCATTTCAAGTGCATAAACAAAACCTCAAAGGGCCTGGGAAGGTGAGGC
AGGCCAGAGTCTGTGTTCTGTGTTGAGTGTCAAGCTATTTGTTAAGAAGGTCTGCAACAGGCCTTTGGTGTGGGCTCTGCCAGAGACTGT
TCTGAACACTTTGCTTGAGATCCGTGCCCTGTAAAATGGATATGATGTTTTACTGATGTCTGTAATACATTTGTAAACTTCCAATAAAAT

>In-frame_GXYLT2_ENST00000389617_chr3_72957710_+_PRICKLE2_ENST00000564377_chr3_64148805_-_4549nt
GTCGCCGCCGCCGCCGGCCGCCCGCCGGCCGCCACGACCCCAGTCCCCGGCGGGCGGGCGGAGGAGGCGACCGCCGCGCGCTGCTGCACT
CATCCTGCCGCCGCCGCGATGCGCAGAGGGGCCGAGCCGCCTGGGGGCCGCCGCCGCCGCCGCGCCGCACCATGAAGCTCCGCAGCAAGG
CGGCGGCGCTGCTCTTGCTCGCGCTGGCCGCGCTGCTGCTGGCGCTGCTGTCCCTGCGCGCTGGCCGCGCTGAGCCCCCAGCGCTGCCCG
CGCGCCCCGCGTCCGCCCCGCAGCGCCACCCCGCGCCTGTCCCCGCGCGCTGGCCGGGGCCGGGCGCCCTCCCCGGGGCCAGCCCGGGAG
TTCGGAGGCGCCGGCCCCCGCGTCCGCGCCCCCGAGCGGGCCGCCGGGGCGCTGCGAGACTGGAGAAGTTGGCGAGGAGGCCTGGAGAAC
CCAGGAGTTTCCAAGCTGTGCTGCCACCCGAGCTCTGGATCCACCTGGCTGTGGTGGCCTGTGGCAATCGGCTGGAGGAGACGCTGGTCA
TGCTCAAATCAGCTGTGCTTTTTAGCCACAGGAAGATCCAATTCCACATCTTCACTGAAGACTCTCTGAAGCCCGAGTTTGATAAGCAGG
TACACCAGTACTATAGCTGTCTCCCAGAAGAGAAAGTCCCTTATGTCAACAGTCCTGGAGAGAAACTGCGAATCAAGCAGCTACTACACC
AGCTGCCGCCACATGACAATGAGGTTCGATATTGCAACTCCCTGGATGAGGAAGAGAAGAGGGAGCTGAAGCTTTTCAGCAGCCAGAGGA
AACGCGAAAACTTGGGCCGCGGGAATGTCAGGCCTTTCCCAGTCACCATGACAGGAGCTATTTGTGAACAGTGCGGAGGCCAGATCAATG
GTGGAGACATCGCTGTGTTTGCGTCACGCGCTGGCCACGGCGTTTGCTGGCACCCGCCGTGCTTCGTATGCACTGTCTGCAATGAGCTCC
TGGTGGATCTGATCTACTTTTACCAAGATGGGAAGATATACTGTGGCAGGCACCATGCTGAGTGCCTGAAGCCGCGCTGTGCTGCCTGCG
ATGAGATCATCTTTGCAGATGAATGCACAGAAGCTGAGGGGCGACACTGGCACATGAAACACTTTTGCTGCTTCGAGTGTGAGACAGTGC
TGGGCGGCCAGCGCTACATCATGAAGGAGGGAAGACCCTACTGTTGCCACTGCTTCGAGTCCTTGTATGCAGAATATTGTGACACCTGTG
CCCAACATATAGGTATCGACCAAGGTCAAATGACCTATGATGGCCAACACTGGCATGCCACTGAGACCTGTTTCTGCTGTGCTCACTGCA
AGAAATCCCTCCTGGGGCGGCCATTCCTCCCGAAGCAGGGCCAGATATTCTGCTCACGGGCCTGCAGTGCTGGGGAAGACCCCAATGGTT
CTGACTCCTCTGATTCCGCCTTCCAGAACGCCAGGGCCAAGGAGTCCCGGCGCAGTGCCAAAATTGGCAAGAACAAGGGCAAGACGGAGG
AGCCCATGCTGAACCAGCACAGCCAGCTGCAAGTGAGTTCTAACCGGCTGTCAGCCGACGTAGACCCCCTGTCACTGCAGATGGACATGC
TCAGCCTGTCCAGCCAGACACCCAGCCTCAACCGGGACCCCATCTGGAGGAGCCGGGAAGAGCCCTACCATTATGGGAACAAGATGGAGC
AGAACCAGACCCAGAGCCCTCTGCAGCTCCTCAGCCAGTGCAACATCAGAACTTCCTACAGTCCAGGAGGGCAAGGGGCTGGGGCCCAGC
CCGAAATGTGGGGCAAGCACTTCAGCAACCCCAAAAGGAGCTCGTCACTGGCCATGACAGGACATGCTGGCAGCTTCATCAAGGAATGCC
GAGAAGACTATTACCCGGGGAGGCTGAGATCTCAGGAGAGCTACAGTGATATGTCTAGTCAGAGTTTCAGTGAGACCCGAGGCAGCATCC
AAGTCCCCAAATATGAGGAGGAAGAGGAAGAGGAAGGGGGCTTGTCCACTCAGCAGTGTCGGACCCGTCATCCCATCAGTTCCCTGAAAT
ACACAGAGGACATGACGCCCACAGAGCAGACCCCTCGGGGCTCCATGGAATCCCTGGCCCTGTCTAATGCAACAGGCCTCTCTGCTGATG
GTGGTGCCAAGCGCCAGGAGCACCTATCCCGATTTTCCATGCCTGACCTCAGCAAAGACTCTGGAATGAATGTGTCTGAGAAGCTGAGCA
ACATGGGCACTCTTAACTCGTCCATGCAGTTCCGGAGCGCAGAGTCAGTTCGCAGCCTGCTCTCTGCCCAGCAGTACCAGGAGATGGAGG
GAAACCTCCACCAGCTCAGCAACCCCATTGGCTACAGAGACCTGCAGTCCCACGGAAGGATGCATCAGAGCTTTGATTTTGATGGAGGGA
TGGCGGGCAGCAAGCTGCCAGGGCAGGAGGGCGTGAGGATCCAGCCCATGAGTGAACGCACCCGGAGAAGAGCTACTTCACGCGACGACA
ACCGCCGTTTCCGACCTCACAGGTCCAGGCGTTCCCGACGCTCTCGCTCCGACAACGCCCTCCACCTGGCCAGCGAACGCGAGGCCATCT
CCCGGTTAAAAGATAGGCCCCCTCTGAGAGCCAGGGAGGACTATGACCAATTTATGCGCCAGCGGAGCTTCCAGGAGAGCATGGGGCATG
GGTCCCGGAGGGACCTGTACGGCCAGTGCCCTAGGACTGTGTCGGACCTGGCTTTGCAGAATGCCTTTGGGGACCGCTGGGGACCCTACT
TCGCCGAGTATGATTGGTGTTCCACCTGCTCCTCCTCTTCAGAGTCTGACAACGAGGGCTATTTCCTAGGAGAACCCATCCCCCAGCCAG
CGCGCCTGCGATACGTCACAAGCGATGAGCTGCTGCACAAATACAGCTCCTACGGCCTCCCCAAATCTTCCACATTAGGTGGCAGAGGAC
AGTTGCACAGCAGGAAAAGACAGAAGAGCAAAAACTGTATCATTTCTTAATATGATTGGGATCAGGGAATGGGAGAAGATGGGAGCTAAG
AATGTAAAGTCAGAAACTTGCACTGTTTTAAATGTTAAAGCGCTTTTGGGGGTGGCTTATGGGGGAGAAAAGGGAAAATGCTGTCAGTAG
ATGGAGGCAAGGTTACAGGTTGACTCAATAGGTAGTCACAGTTCTTGGCATGTTGAATATTATTTGCACATTTCACTTTGGAAACACAGT
AGACTCTATCGAGGCCAGGCTTGGTCACTTCCTTCCCATCAGTTCTGTGTTGAGTTGCCATCTCTCAAGATGGTAAATTGTTTCCTGCTC
GCTTTTATCCTCTCTGGTTCTCTTACTTTTAGGACCCTTTTTTCAGTAAGTAATTTGTTTATTAGCCAGGACCCAAGACTAAGTTATTTA
CATGTCCATTGTAAATGCAATGTAAATGAGAGTTCTGATAAAATATTTTTGTATTTTGTAATATCAAAGGAATTTCTATATCGTAGGACT
CAGTGGGGACTTGCATGCACATCCACCATTGTCTCTGAGTAGTATTGAAATGTGGCCCGGTACCACCTTTTTTTTTTTTTTTTTTTTTTC
TATACAAATTTGTTACATGTCAGTGAGACCTTTTTCAAAGGAACATATTCAATTTGGCTTTTTGTGGCTGAAAAAACATAACTGTTAGAC
CCAAAGCATTTTATGCTCCGTTCCATCTTAAGGAGCCATCCTTAAGTCTGCTCCCACCCTCAGTAGAATTTATTTTCTACAAAGTGGTAG
TAATTTTTTTTTAAATTGCAAATGTAATTTTTGCCAATTAGAGAAACCAACCGGTGTCAGTAAAATTCTGTGAGAAATGCCATCCCTGCT
GGGAATGTTGAAGTTACTTAATGTTGATCTATCCCTTGGGGAAAGTAAAAGTGACTGTGAGTGGTGCCATTGTGTGATGTCAGCATGACG
TTGTTTTGAATGTGGCATTATGTTCTGGTGCTCATGTTTCCTGGATTGTATTATCTGCTTTCCTTTACCAAGGCAGACAGAACTGCTGCC
TTAGCCTGACAACCGGTTGTCCTCAAAGCAAATGAACTTAAGCATTTGGGATTGAGGGACAGAAGGATTCTGAGGGGGCTCTGCGAGGGA
CGGTGTGTGACATGTCATGCCTGGAGAAGGAACAAGGCTATTTGAAAACAGAAGGCAGGTCAAGGGTAGAAGTTAAAGGAGAATCTGAAG
GCAGGTCAGGGAAAAGAAGAACTGGAAATGAAACAGAGGACAGGTGACAACCACCTCGAAGAGCTCCCAGAGATTGTAGAAAGAGTCCAG
TGTAACCAGCTTAGTAACCAGAGTATCTGGATTACCCAGGAAGGTTGAGCTGCTGAGATTTCAGTGGTGCAATGTCTTTAAAAAAACAGG
CTTTGTTGGGAGGGTATTTCCATTTTGAACTTTGAGGACTGTTGGTCAGAAAATGGGCTCAAAAGTGAGTTTGCTTAATGAAGACATTTA


Top

FusionGenePPI for GXYLT2_PRICKLE2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GXYLT2FBL, SRPK2, MGAT4C, CD70, NEUROG3, HLA-DPA1, SCGB2A2, KCNC4, KLRG2, TRIM25PRICKLE2APP, USP9X


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GXYLT2_PRICKLE2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GXYLT2_PRICKLE2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePRICKLE2C0023903Liver neoplasms1CTD_human
TgenePRICKLE2C0032927Precancerous Conditions1CTD_human