FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15511

FusionGeneSummary for GSE1_CDH13

check button Fusion gene summary
Fusion gene informationFusion gene name: GSE1_CDH13
Fusion gene ID: 15511
HgeneTgene
Gene symbol

GSE1

CDH13

Gene ID

23199

1012

Gene nameGse1 coiled-coil proteincadherin 13
SynonymsCRHSP24|KIAA0182CDHH|P105
Cytomap

16q24.1

16q23.3

Type of geneprotein-codingprotein-coding
Descriptiongenetic suppressor element 1CTC-786C10.1Gse1 coiled-coil protein homologcadherin-13H-cadherin (heart)T-cadT-cadherincadherin 13, H-cadherin (heart)heart cadherin
Modification date2018051920180523
UniProtAcc

Q14687

P55290

Ensembl transtripts involved in fusion geneENST00000405402, ENST00000253458, 
ENST00000393243, ENST00000471070, 
ENST00000566620, ENST00000268613, 
ENST00000565636, ENST00000431540, 
ENST00000428848, ENST00000567445, 
ENST00000446376, ENST00000569454, 
Fusion gene scores* DoF score13 X 9 X 7=8195 X 5 X 5=125
# samples 138
** MAII scorelog2(13/819*10)=-2.65535182861255
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/125*10)=-0.643856189774725
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: GSE1 [Title/Abstract] AND CDH13 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCDH13

GO:0002040

sprouting angiogenesis

16873731

TgeneCDH13

GO:0007156

homophilic cell adhesion via plasma membrane adhesion molecules

10601632

TgeneCDH13

GO:0007162

negative regulation of cell adhesion

14729458

TgeneCDH13

GO:0008285

negative regulation of cell proliferation

10737605

TgeneCDH13

GO:0016339

calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules

10601632

TgeneCDH13

GO:0030032

lamellipodium assembly

15703273

TgeneCDH13

GO:0030335

positive regulation of cell migration

14729458

TgeneCDH13

GO:0043542

endothelial cell migration

14729458

TgeneCDH13

GO:0043616

keratinocyte proliferation

15816843

TgeneCDH13

GO:0050850

positive regulation of calcium-mediated signaling

16013438

TgeneCDH13

GO:0050927

positive regulation of positive chemotaxis

16013438

TgeneCDH13

GO:0055096

low-density lipoprotein particle mediated signaling

16013438


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-BR-8590-01AGSE1chr16

85647004

+CDH13chr16

83520082

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000405402ENST00000566620GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-3CDSENST00000405402ENST00000268613GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-intronENST00000405402ENST00000565636GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-intronENST00000405402ENST00000431540GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-intronENST00000405402ENST00000428848GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-intronENST00000405402ENST00000567445GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-intronENST00000405402ENST00000446376GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-3UTRENST00000405402ENST00000569454GSE1chr16

85647004

+CDH13chr16

83520082

+
In-frameENST00000253458ENST00000566620GSE1chr16

85647004

+CDH13chr16

83520082

+
In-frameENST00000253458ENST00000268613GSE1chr16

85647004

+CDH13chr16

83520082

+
5CDS-intronENST00000253458ENST00000565636GSE1chr16

85647004

+CDH13chr16

83520082

+
5CDS-intronENST00000253458ENST00000431540GSE1chr16

85647004

+CDH13chr16

83520082

+
5CDS-intronENST00000253458ENST00000428848GSE1chr16

85647004

+CDH13chr16

83520082

+
5CDS-intronENST00000253458ENST00000567445GSE1chr16

85647004

+CDH13chr16

83520082

+
5CDS-intronENST00000253458ENST00000446376GSE1chr16

85647004

+CDH13chr16

83520082

+
5CDS-3UTRENST00000253458ENST00000569454GSE1chr16

85647004

+CDH13chr16

83520082

+
In-frameENST00000393243ENST00000566620GSE1chr16

85647004

+CDH13chr16

83520082

+
In-frameENST00000393243ENST00000268613GSE1chr16

85647004

+CDH13chr16

83520082

+
5CDS-intronENST00000393243ENST00000565636GSE1chr16

85647004

+CDH13chr16

83520082

+
5CDS-intronENST00000393243ENST00000431540GSE1chr16

85647004

+CDH13chr16

83520082

+
5CDS-intronENST00000393243ENST00000428848GSE1chr16

85647004

+CDH13chr16

83520082

+
5CDS-intronENST00000393243ENST00000567445GSE1chr16

85647004

+CDH13chr16

83520082

+
5CDS-intronENST00000393243ENST00000446376GSE1chr16

85647004

+CDH13chr16

83520082

+
5CDS-3UTRENST00000393243ENST00000569454GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-3CDSENST00000471070ENST00000566620GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-3CDSENST00000471070ENST00000268613GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-intronENST00000471070ENST00000565636GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-intronENST00000471070ENST00000431540GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-intronENST00000471070ENST00000428848GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-intronENST00000471070ENST00000567445GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-intronENST00000471070ENST00000446376GSE1chr16

85647004

+CDH13chr16

83520082

+
intron-3UTRENST00000471070ENST00000569454GSE1chr16

85647004

+CDH13chr16

83520082

+

Top

FusionProtFeatures for GSE1_CDH13


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GSE1

Q14687

CDH13

P55290

Cadherins are calcium-dependent cell adhesion proteins.They preferentially interact with themselves in a homophilicmanner in connecting cells; cadherins may thus contribute to thesorting of heterogeneous cell types. May act as a negativeregulator of neural cell growth. {ECO:0000269|PubMed:10737605}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for GSE1_CDH13


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GSE1_ENST00000253458_chr16_85647004_+_CDH13_ENST00000566620_chr16_83520082_+_456aa
MKGTTVMRMTAFDADDPATDNALLRTNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKTELIIEAQDMAGLDVGLTGTAT
ATIMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTNEGMLSVVKPLDTEISAFH
TLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPDPMMVTRQEDLSVGSVLLTVNATDPDSLQHQTIRTSVYKDPAGWLNINP
INGTVDTTAVLDRESPFVDNSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPF
KFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLF

>In-frame_GSE1_ENST00000253458_chr16_85647004_+_CDH13_ENST00000268613_chr16_83520082_+_456aa
MKGTTVMRMTAFDADDPATDNALLRTNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKTELIIEAQDMAGLDVGLTGTAT
ATIMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTNEGMLSVVKPLDTEISAFH
TLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPDPMMVTRQEDLSVGSVLLTVNATDPDSLQHQTIRTSVYKDPAGWLNINP
INGTVDTTAVLDRESPFVDNSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPF
KFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLF

>In-frame_GSE1_ENST00000393243_chr16_85647004_+_CDH13_ENST00000566620_chr16_83520082_+_456aa
MKGTTVMRMTAFDADDPATDNALLRTNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKTELIIEAQDMAGLDVGLTGTAT
ATIMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTNEGMLSVVKPLDTEISAFH
TLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPDPMMVTRQEDLSVGSVLLTVNATDPDSLQHQTIRTSVYKDPAGWLNINP
INGTVDTTAVLDRESPFVDNSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPF
KFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLF

>In-frame_GSE1_ENST00000393243_chr16_85647004_+_CDH13_ENST00000268613_chr16_83520082_+_456aa
MKGTTVMRMTAFDADDPATDNALLRTNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKTELIIEAQDMAGLDVGLTGTAT
ATIMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTNEGMLSVVKPLDTEISAFH
TLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPDPMMVTRQEDLSVGSVLLTVNATDPDSLQHQTIRTSVYKDPAGWLNINP
INGTVDTTAVLDRESPFVDNSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPF
KFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GSE1_ENST00000253458_chr16_85647004_+_CDH13_ENST00000566620_chr16_83520082_+_1368nt
ATGAAAGGCACCACAGTGATGCGGATGACAGCCTTTGATGCAGATGACCCAGCCACCGATAATGCCCTCCTGCGGTATAATATCCGTCAG
CAGACGCCTGACAAGCCATCTCCCAACATGTTCTACATCGATCCTGAGAAAGGAGACATTGTCACTGTTGTGTCACCTGCGCTGCTGGAC
CGAGAGACTCTGGAAAATCCCAAGTATGAACTGATCATCGAGGCTCAAGATATGGCTGGACTGGATGTTGGATTAACAGGCACGGCCACA
GCCACGATCATGATCGATGACAAAAATGATCACTCACCAAAATTCACCAAGAAAGAGTTTCAAGCCACAGTCGAGGAAGGAGCTGTGGGA
GTTATTGTCAATTTGACAGTTGAAGATAAGGATGACCCCACCACAGGTGCATGGAGGGCTGCCTACACCATCATCAACGGAAACCCCGGG
CAGAGCTTTGAAATCCACACCAACCCTCAAACCAACGAAGGGATGCTTTCTGTTGTCAAACCATTGGACTATGAAATTTCTGCCTTCCAC
ACCCTGCTGATCAAAGTGGAAAATGAAGACCCACTCGTACCCGACGTCTCCTACGGCCCCAGCTCCACAGCCACCGTCCACATCACTGTC
CTGGATGTCAACGAGGGCCCAGTCTTCTACCCAGACCCCATGATGGTGACCAGGCAGGAGGACCTCTCTGTGGGCAGCGTGCTGCTGACA
GTGAATGCCACGGACCCCGACTCCCTGCAGCATCAAACCATCAGGTATTCTGTTTACAAGGACCCAGCAGGTTGGCTGAATATTAACCCC
ATCAATGGGACTGTTGACACCACAGCTGTGCTGGACCGTGAGTCCCCATTTGTCGACAACAGCGTGTACACTGCTCTCTTCCTGGCAATT
GACAGTGGCAACCCTCCCGCTACGGGCACTGGGACTTTGCTGATAACCCTGGAGGACGTGAATGACAATGCCCCGTTCATTTACCCCACA
GTAGCTGAAGTCTGTGATGATGCCAAAAACCTCAGTGTAGTCATTTTGGGAGCATCAGATAAGGATCTTCACCCGAATACAGATCCTTTC
AAATTTGAAATCCACAAACAAGCTGTTCCTGATAAAGTCTGGAAGATCTCCAAGATCAACAATACACACGCCCTGGTAAGCCTTCTTCAA
AATCTGAACAAAGCAAACTACAACCTGCCCATCATGGTGACAGATTCAGGGAAACCACCCATGACGAATATCACAGATCTCAGGGTACAA
GTGTGCTCCTGCAGGAATTCCAAAGTGGACTGCAACGCGGCAGGGGCCCTGCGCTTCAGCCTGCCCTCAGTCCTGCTCCTCAGCCTCTTC

>In-frame_GSE1_ENST00000253458_chr16_85647004_+_CDH13_ENST00000268613_chr16_83520082_+_1368nt
ATGAAAGGCACCACAGTGATGCGGATGACAGCCTTTGATGCAGATGACCCAGCCACCGATAATGCCCTCCTGCGGTATAATATCCGTCAG
CAGACGCCTGACAAGCCATCTCCCAACATGTTCTACATCGATCCTGAGAAAGGAGACATTGTCACTGTTGTGTCACCTGCGCTGCTGGAC
CGAGAGACTCTGGAAAATCCCAAGTATGAACTGATCATCGAGGCTCAAGATATGGCTGGACTGGATGTTGGATTAACAGGCACGGCCACA
GCCACGATCATGATCGATGACAAAAATGATCACTCACCAAAATTCACCAAGAAAGAGTTTCAAGCCACAGTCGAGGAAGGAGCTGTGGGA
GTTATTGTCAATTTGACAGTTGAAGATAAGGATGACCCCACCACAGGTGCATGGAGGGCTGCCTACACCATCATCAACGGAAACCCCGGG
CAGAGCTTTGAAATCCACACCAACCCTCAAACCAACGAAGGGATGCTTTCTGTTGTCAAACCATTGGACTATGAAATTTCTGCCTTCCAC
ACCCTGCTGATCAAAGTGGAAAATGAAGACCCACTCGTACCCGACGTCTCCTACGGCCCCAGCTCCACAGCCACCGTCCACATCACTGTC
CTGGATGTCAACGAGGGCCCAGTCTTCTACCCAGACCCCATGATGGTGACCAGGCAGGAGGACCTCTCTGTGGGCAGCGTGCTGCTGACA
GTGAATGCCACGGACCCCGACTCCCTGCAGCATCAAACCATCAGGTATTCTGTTTACAAGGACCCAGCAGGTTGGCTGAATATTAACCCC
ATCAATGGGACTGTTGACACCACAGCTGTGCTGGACCGTGAGTCCCCATTTGTCGACAACAGCGTGTACACTGCTCTCTTCCTGGCAATT
GACAGTGGCAACCCTCCCGCTACGGGCACTGGGACTTTGCTGATAACCCTGGAGGACGTGAATGACAATGCCCCGTTCATTTACCCCACA
GTAGCTGAAGTCTGTGATGATGCCAAAAACCTCAGTGTAGTCATTTTGGGAGCATCAGATAAGGATCTTCACCCGAATACAGATCCTTTC
AAATTTGAAATCCACAAACAAGCTGTTCCTGATAAAGTCTGGAAGATCTCCAAGATCAACAATACACACGCCCTGGTAAGCCTTCTTCAA
AATCTGAACAAAGCAAACTACAACCTGCCCATCATGGTGACAGATTCAGGGAAACCACCCATGACGAATATCACAGATCTCAGGGTACAA
GTGTGCTCCTGCAGGAATTCCAAAGTGGACTGCAACGCGGCAGGGGCCCTGCGCTTCAGCCTGCCCTCAGTCCTGCTCCTCAGCCTCTTC

>In-frame_GSE1_ENST00000393243_chr16_85647004_+_CDH13_ENST00000566620_chr16_83520082_+_1368nt
ATGAAAGGCACCACAGTGATGCGGATGACAGCCTTTGATGCAGATGACCCAGCCACCGATAATGCCCTCCTGCGGTATAATATCCGTCAG
CAGACGCCTGACAAGCCATCTCCCAACATGTTCTACATCGATCCTGAGAAAGGAGACATTGTCACTGTTGTGTCACCTGCGCTGCTGGAC
CGAGAGACTCTGGAAAATCCCAAGTATGAACTGATCATCGAGGCTCAAGATATGGCTGGACTGGATGTTGGATTAACAGGCACGGCCACA
GCCACGATCATGATCGATGACAAAAATGATCACTCACCAAAATTCACCAAGAAAGAGTTTCAAGCCACAGTCGAGGAAGGAGCTGTGGGA
GTTATTGTCAATTTGACAGTTGAAGATAAGGATGACCCCACCACAGGTGCATGGAGGGCTGCCTACACCATCATCAACGGAAACCCCGGG
CAGAGCTTTGAAATCCACACCAACCCTCAAACCAACGAAGGGATGCTTTCTGTTGTCAAACCATTGGACTATGAAATTTCTGCCTTCCAC
ACCCTGCTGATCAAAGTGGAAAATGAAGACCCACTCGTACCCGACGTCTCCTACGGCCCCAGCTCCACAGCCACCGTCCACATCACTGTC
CTGGATGTCAACGAGGGCCCAGTCTTCTACCCAGACCCCATGATGGTGACCAGGCAGGAGGACCTCTCTGTGGGCAGCGTGCTGCTGACA
GTGAATGCCACGGACCCCGACTCCCTGCAGCATCAAACCATCAGGTATTCTGTTTACAAGGACCCAGCAGGTTGGCTGAATATTAACCCC
ATCAATGGGACTGTTGACACCACAGCTGTGCTGGACCGTGAGTCCCCATTTGTCGACAACAGCGTGTACACTGCTCTCTTCCTGGCAATT
GACAGTGGCAACCCTCCCGCTACGGGCACTGGGACTTTGCTGATAACCCTGGAGGACGTGAATGACAATGCCCCGTTCATTTACCCCACA
GTAGCTGAAGTCTGTGATGATGCCAAAAACCTCAGTGTAGTCATTTTGGGAGCATCAGATAAGGATCTTCACCCGAATACAGATCCTTTC
AAATTTGAAATCCACAAACAAGCTGTTCCTGATAAAGTCTGGAAGATCTCCAAGATCAACAATACACACGCCCTGGTAAGCCTTCTTCAA
AATCTGAACAAAGCAAACTACAACCTGCCCATCATGGTGACAGATTCAGGGAAACCACCCATGACGAATATCACAGATCTCAGGGTACAA
GTGTGCTCCTGCAGGAATTCCAAAGTGGACTGCAACGCGGCAGGGGCCCTGCGCTTCAGCCTGCCCTCAGTCCTGCTCCTCAGCCTCTTC

>In-frame_GSE1_ENST00000393243_chr16_85647004_+_CDH13_ENST00000268613_chr16_83520082_+_1368nt
ATGAAAGGCACCACAGTGATGCGGATGACAGCCTTTGATGCAGATGACCCAGCCACCGATAATGCCCTCCTGCGGTATAATATCCGTCAG
CAGACGCCTGACAAGCCATCTCCCAACATGTTCTACATCGATCCTGAGAAAGGAGACATTGTCACTGTTGTGTCACCTGCGCTGCTGGAC
CGAGAGACTCTGGAAAATCCCAAGTATGAACTGATCATCGAGGCTCAAGATATGGCTGGACTGGATGTTGGATTAACAGGCACGGCCACA
GCCACGATCATGATCGATGACAAAAATGATCACTCACCAAAATTCACCAAGAAAGAGTTTCAAGCCACAGTCGAGGAAGGAGCTGTGGGA
GTTATTGTCAATTTGACAGTTGAAGATAAGGATGACCCCACCACAGGTGCATGGAGGGCTGCCTACACCATCATCAACGGAAACCCCGGG
CAGAGCTTTGAAATCCACACCAACCCTCAAACCAACGAAGGGATGCTTTCTGTTGTCAAACCATTGGACTATGAAATTTCTGCCTTCCAC
ACCCTGCTGATCAAAGTGGAAAATGAAGACCCACTCGTACCCGACGTCTCCTACGGCCCCAGCTCCACAGCCACCGTCCACATCACTGTC
CTGGATGTCAACGAGGGCCCAGTCTTCTACCCAGACCCCATGATGGTGACCAGGCAGGAGGACCTCTCTGTGGGCAGCGTGCTGCTGACA
GTGAATGCCACGGACCCCGACTCCCTGCAGCATCAAACCATCAGGTATTCTGTTTACAAGGACCCAGCAGGTTGGCTGAATATTAACCCC
ATCAATGGGACTGTTGACACCACAGCTGTGCTGGACCGTGAGTCCCCATTTGTCGACAACAGCGTGTACACTGCTCTCTTCCTGGCAATT
GACAGTGGCAACCCTCCCGCTACGGGCACTGGGACTTTGCTGATAACCCTGGAGGACGTGAATGACAATGCCCCGTTCATTTACCCCACA
GTAGCTGAAGTCTGTGATGATGCCAAAAACCTCAGTGTAGTCATTTTGGGAGCATCAGATAAGGATCTTCACCCGAATACAGATCCTTTC
AAATTTGAAATCCACAAACAAGCTGTTCCTGATAAAGTCTGGAAGATCTCCAAGATCAACAATACACACGCCCTGGTAAGCCTTCTTCAA
AATCTGAACAAAGCAAACTACAACCTGCCCATCATGGTGACAGATTCAGGGAAACCACCCATGACGAATATCACAGATCTCAGGGTACAA
GTGTGCTCCTGCAGGAATTCCAAAGTGGACTGCAACGCGGCAGGGGCCCTGCGCTTCAGCCTGCCCTCAGTCCTGCTCCTCAGCCTCTTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_GSE1_ENST00000253458_chr16_85647004_+_CDH13_ENST00000566620_chr16_83520082_+_3113nt
TCCTCGGCGGCGACAGCAGCAGGTGTTTCTTGGCCGGGGCCCCGGAAGCTCCACCTCCCCAGCGGGCCCGAGCTGCCGCCGCCGAGCAGC
CCCGGGTGAGATAAGCAGTTTAGACAAACACTGGGCGACGGTGGCTCCAGCATGTATCAGCCGAGGTGGAGCTGCGGGGCCCTGGCATGA
AAGGCACCACAGTGATGCGGATGACAGCCTTTGATGCAGATGACCCAGCCACCGATAATGCCCTCCTGCGGTATAATATCCGTCAGCAGA
CGCCTGACAAGCCATCTCCCAACATGTTCTACATCGATCCTGAGAAAGGAGACATTGTCACTGTTGTGTCACCTGCGCTGCTGGACCGAG
AGACTCTGGAAAATCCCAAGTATGAACTGATCATCGAGGCTCAAGATATGGCTGGACTGGATGTTGGATTAACAGGCACGGCCACAGCCA
CGATCATGATCGATGACAAAAATGATCACTCACCAAAATTCACCAAGAAAGAGTTTCAAGCCACAGTCGAGGAAGGAGCTGTGGGAGTTA
TTGTCAATTTGACAGTTGAAGATAAGGATGACCCCACCACAGGTGCATGGAGGGCTGCCTACACCATCATCAACGGAAACCCCGGGCAGA
GCTTTGAAATCCACACCAACCCTCAAACCAACGAAGGGATGCTTTCTGTTGTCAAACCATTGGACTATGAAATTTCTGCCTTCCACACCC
TGCTGATCAAAGTGGAAAATGAAGACCCACTCGTACCCGACGTCTCCTACGGCCCCAGCTCCACAGCCACCGTCCACATCACTGTCCTGG
ATGTCAACGAGGGCCCAGTCTTCTACCCAGACCCCATGATGGTGACCAGGCAGGAGGACCTCTCTGTGGGCAGCGTGCTGCTGACAGTGA
ATGCCACGGACCCCGACTCCCTGCAGCATCAAACCATCAGGTATTCTGTTTACAAGGACCCAGCAGGTTGGCTGAATATTAACCCCATCA
ATGGGACTGTTGACACCACAGCTGTGCTGGACCGTGAGTCCCCATTTGTCGACAACAGCGTGTACACTGCTCTCTTCCTGGCAATTGACA
GTGGCAACCCTCCCGCTACGGGCACTGGGACTTTGCTGATAACCCTGGAGGACGTGAATGACAATGCCCCGTTCATTTACCCCACAGTAG
CTGAAGTCTGTGATGATGCCAAAAACCTCAGTGTAGTCATTTTGGGAGCATCAGATAAGGATCTTCACCCGAATACAGATCCTTTCAAAT
TTGAAATCCACAAACAAGCTGTTCCTGATAAAGTCTGGAAGATCTCCAAGATCAACAATACACACGCCCTGGTAAGCCTTCTTCAAAATC
TGAACAAAGCAAACTACAACCTGCCCATCATGGTGACAGATTCAGGGAAACCACCCATGACGAATATCACAGATCTCAGGGTACAAGTGT
GCTCCTGCAGGAATTCCAAAGTGGACTGCAACGCGGCAGGGGCCCTGCGCTTCAGCCTGCCCTCAGTCCTGCTCCTCAGCCTCTTCAGCT
TAGCTTGTCTGTGAGAACTCCTGACGTCTGAAGCTTGACTCCCAAGTTTCCATAGCAACAGGAAAAAAAAAAATCTATCCAAATCTGAAG
ATTGCGGTTTACAGCTATCGAACTTCACAACTAGGCCTCAATTGTTCCGGTTTTTTATTTTCTTTACAATTTCACTTAGTCTGTACTTCA
TCATTTTGACAGCATCTTCCTCCCTCCTTTAATTAATGGAATCTTCTGAATTTTCCCTGAATGTTTAAAGATCATGACATATGACTTGAT
CTTCTGGGAGCAGGAACAATGACTACTTTTTCTGGTGTGTTAACATGTCGCTAGCCAGTGCTCCAGGCACCCAGCTTTGTCTGTGGGTTA
GTATTGGTGTATGTATGAGTATCTGTATGTATATATACACGGTATTTATAGAGAGAGACTATCCTGGAGAAGCCTCGTTTTGATGCCATT
CTTCCTTGCAAGGTTAAGCAAGGTGGGTGGAAACTAAGACACCTGAACCCTCCAGGGCCTCCCGCATCAAGGTCAGCATGAGGACAGACC
ACAGAGCTGTCACTTTTGCTCCGAAGCTACTTCTCCACTGTCCCGTTCAGTCTGAATGCTGCCACAACCAGCCAGGCAGGTCCACAGAGA
GGGAGAGCAGAGAAAGAAGTCCTTTCTCTTTATTGAGTTCGAGGACTACAACCAATTTACACTGCCATCTGATGCCGTGATCCTGAGCCA
AGGAGGTGAGGAGCAGAGCAGGCAATTTCACCACCAAATGCCAAGAAAAGGGCTGACATTTTCTTTCATGGGCACCAACCTGCATTTGTA
TGTGTCCCGAATCCACAGTCGTACTGATTCTAATGGGGACACAGATCATGGTAGAGAATCTCTCCCTCCTCAGTAAATGTACAACTGCAC
CTGTCATCATGGAGGTCATACATGCATACAAAGAGGTGTACAGGTACCATCTTGTATACACATATATACCCACATGTACAGACATACATT
TATGCACATTCACGCTGTTTGTTTCATATATACAGGCATAAAATAGAGTAAATACAGGTAGTTTTAAAAGTACCCTTTTGTGTGAATTGA
CTACCGTTGTTTGCAAACCCGAAAATAAAAGACGTTCATTATGTATGAAAAGTAACTGATTTGTATTCTGTGAGCATGTAAAAGCGGAAA
GTTAGTGCTTGTTCTAAGATTACCTTCTTGTTGATAAACCATAAATGAATCATCAAAGCTCACACCAAATTTTTCTATCAAATAAAACTA
GTGACAGCTTGTGGCTTTTTATTAGAGCTCGCCACGAACTAGGGTAAGGTGAGTGTCTTAGCATATTTTAATGCAGTTGCTTACTAAAGG
TTTTAACCGCACATGCACACACACACGCTTTCTTATGCAATCTATGTTTGCACTTGTGCTTTCAGTTAGCCTTCTGTAGGAAGTAGAAGT
CATATGTTGTCTTTGTTGTAGTGAAATTATACAGATAGAGTTCCATATATTGTATTTGTTTCAATGGTAAATCCTTTTGGAACATATAGA

>In-frame_GSE1_ENST00000253458_chr16_85647004_+_CDH13_ENST00000268613_chr16_83520082_+_1890nt
TCCTCGGCGGCGACAGCAGCAGGTGTTTCTTGGCCGGGGCCCCGGAAGCTCCACCTCCCCAGCGGGCCCGAGCTGCCGCCGCCGAGCAGC
CCCGGGTGAGATAAGCAGTTTAGACAAACACTGGGCGACGGTGGCTCCAGCATGTATCAGCCGAGGTGGAGCTGCGGGGCCCTGGCATGA
AAGGCACCACAGTGATGCGGATGACAGCCTTTGATGCAGATGACCCAGCCACCGATAATGCCCTCCTGCGGTATAATATCCGTCAGCAGA
CGCCTGACAAGCCATCTCCCAACATGTTCTACATCGATCCTGAGAAAGGAGACATTGTCACTGTTGTGTCACCTGCGCTGCTGGACCGAG
AGACTCTGGAAAATCCCAAGTATGAACTGATCATCGAGGCTCAAGATATGGCTGGACTGGATGTTGGATTAACAGGCACGGCCACAGCCA
CGATCATGATCGATGACAAAAATGATCACTCACCAAAATTCACCAAGAAAGAGTTTCAAGCCACAGTCGAGGAAGGAGCTGTGGGAGTTA
TTGTCAATTTGACAGTTGAAGATAAGGATGACCCCACCACAGGTGCATGGAGGGCTGCCTACACCATCATCAACGGAAACCCCGGGCAGA
GCTTTGAAATCCACACCAACCCTCAAACCAACGAAGGGATGCTTTCTGTTGTCAAACCATTGGACTATGAAATTTCTGCCTTCCACACCC
TGCTGATCAAAGTGGAAAATGAAGACCCACTCGTACCCGACGTCTCCTACGGCCCCAGCTCCACAGCCACCGTCCACATCACTGTCCTGG
ATGTCAACGAGGGCCCAGTCTTCTACCCAGACCCCATGATGGTGACCAGGCAGGAGGACCTCTCTGTGGGCAGCGTGCTGCTGACAGTGA
ATGCCACGGACCCCGACTCCCTGCAGCATCAAACCATCAGGTATTCTGTTTACAAGGACCCAGCAGGTTGGCTGAATATTAACCCCATCA
ATGGGACTGTTGACACCACAGCTGTGCTGGACCGTGAGTCCCCATTTGTCGACAACAGCGTGTACACTGCTCTCTTCCTGGCAATTGACA
GTGGCAACCCTCCCGCTACGGGCACTGGGACTTTGCTGATAACCCTGGAGGACGTGAATGACAATGCCCCGTTCATTTACCCCACAGTAG
CTGAAGTCTGTGATGATGCCAAAAACCTCAGTGTAGTCATTTTGGGAGCATCAGATAAGGATCTTCACCCGAATACAGATCCTTTCAAAT
TTGAAATCCACAAACAAGCTGTTCCTGATAAAGTCTGGAAGATCTCCAAGATCAACAATACACACGCCCTGGTAAGCCTTCTTCAAAATC
TGAACAAAGCAAACTACAACCTGCCCATCATGGTGACAGATTCAGGGAAACCACCCATGACGAATATCACAGATCTCAGGGTACAAGTGT
GCTCCTGCAGGAATTCCAAAGTGGACTGCAACGCGGCAGGGGCCCTGCGCTTCAGCCTGCCCTCAGTCCTGCTCCTCAGCCTCTTCAGCT
TAGCTTGTCTGTGAGAACTCCTGACGTCTGAAGCTTGACTCCCAAGTTTCCATAGCAACAGGAAAAAAAAAAATCTATCCAAATCTGAAG
ATTGCGGTTTACAGCTATCGAACTTCACAACTAGGCCTCAATTGTTCCGGTTTTTTATTTTCTTTACAATTTCACTTAGTCTGTACTTCA
TCATTTTGACAGCATCTTCCTCCCTCCTTTAATTAATGGAATCTTCTGAATTTTCCCTGAATGTTTAAAGATCATGACATATGACTTGAT
CTTCTGGGAGCAGGAACAATGACTACTTTTTCTGGTGTGTTAACATGTCGCTAGCCAGTGCTCCAGGCACCCAGCTTTGTCTGTGGGTTA

>In-frame_GSE1_ENST00000393243_chr16_85647004_+_CDH13_ENST00000566620_chr16_83520082_+_2977nt
CCAGCATGTATCAGCCGAGGTGGAGCTGCGGGGCCCTGGCATGAAAGGCACCACAGTGATGCGGATGACAGCCTTTGATGCAGATGACCC
AGCCACCGATAATGCCCTCCTGCGGTATAATATCCGTCAGCAGACGCCTGACAAGCCATCTCCCAACATGTTCTACATCGATCCTGAGAA
AGGAGACATTGTCACTGTTGTGTCACCTGCGCTGCTGGACCGAGAGACTCTGGAAAATCCCAAGTATGAACTGATCATCGAGGCTCAAGA
TATGGCTGGACTGGATGTTGGATTAACAGGCACGGCCACAGCCACGATCATGATCGATGACAAAAATGATCACTCACCAAAATTCACCAA
GAAAGAGTTTCAAGCCACAGTCGAGGAAGGAGCTGTGGGAGTTATTGTCAATTTGACAGTTGAAGATAAGGATGACCCCACCACAGGTGC
ATGGAGGGCTGCCTACACCATCATCAACGGAAACCCCGGGCAGAGCTTTGAAATCCACACCAACCCTCAAACCAACGAAGGGATGCTTTC
TGTTGTCAAACCATTGGACTATGAAATTTCTGCCTTCCACACCCTGCTGATCAAAGTGGAAAATGAAGACCCACTCGTACCCGACGTCTC
CTACGGCCCCAGCTCCACAGCCACCGTCCACATCACTGTCCTGGATGTCAACGAGGGCCCAGTCTTCTACCCAGACCCCATGATGGTGAC
CAGGCAGGAGGACCTCTCTGTGGGCAGCGTGCTGCTGACAGTGAATGCCACGGACCCCGACTCCCTGCAGCATCAAACCATCAGGTATTC
TGTTTACAAGGACCCAGCAGGTTGGCTGAATATTAACCCCATCAATGGGACTGTTGACACCACAGCTGTGCTGGACCGTGAGTCCCCATT
TGTCGACAACAGCGTGTACACTGCTCTCTTCCTGGCAATTGACAGTGGCAACCCTCCCGCTACGGGCACTGGGACTTTGCTGATAACCCT
GGAGGACGTGAATGACAATGCCCCGTTCATTTACCCCACAGTAGCTGAAGTCTGTGATGATGCCAAAAACCTCAGTGTAGTCATTTTGGG
AGCATCAGATAAGGATCTTCACCCGAATACAGATCCTTTCAAATTTGAAATCCACAAACAAGCTGTTCCTGATAAAGTCTGGAAGATCTC
CAAGATCAACAATACACACGCCCTGGTAAGCCTTCTTCAAAATCTGAACAAAGCAAACTACAACCTGCCCATCATGGTGACAGATTCAGG
GAAACCACCCATGACGAATATCACAGATCTCAGGGTACAAGTGTGCTCCTGCAGGAATTCCAAAGTGGACTGCAACGCGGCAGGGGCCCT
GCGCTTCAGCCTGCCCTCAGTCCTGCTCCTCAGCCTCTTCAGCTTAGCTTGTCTGTGAGAACTCCTGACGTCTGAAGCTTGACTCCCAAG
TTTCCATAGCAACAGGAAAAAAAAAAATCTATCCAAATCTGAAGATTGCGGTTTACAGCTATCGAACTTCACAACTAGGCCTCAATTGTT
CCGGTTTTTTATTTTCTTTACAATTTCACTTAGTCTGTACTTCATCATTTTGACAGCATCTTCCTCCCTCCTTTAATTAATGGAATCTTC
TGAATTTTCCCTGAATGTTTAAAGATCATGACATATGACTTGATCTTCTGGGAGCAGGAACAATGACTACTTTTTCTGGTGTGTTAACAT
GTCGCTAGCCAGTGCTCCAGGCACCCAGCTTTGTCTGTGGGTTAGTATTGGTGTATGTATGAGTATCTGTATGTATATATACACGGTATT
TATAGAGAGAGACTATCCTGGAGAAGCCTCGTTTTGATGCCATTCTTCCTTGCAAGGTTAAGCAAGGTGGGTGGAAACTAAGACACCTGA
ACCCTCCAGGGCCTCCCGCATCAAGGTCAGCATGAGGACAGACCACAGAGCTGTCACTTTTGCTCCGAAGCTACTTCTCCACTGTCCCGT
TCAGTCTGAATGCTGCCACAACCAGCCAGGCAGGTCCACAGAGAGGGAGAGCAGAGAAAGAAGTCCTTTCTCTTTATTGAGTTCGAGGAC
TACAACCAATTTACACTGCCATCTGATGCCGTGATCCTGAGCCAAGGAGGTGAGGAGCAGAGCAGGCAATTTCACCACCAAATGCCAAGA
AAAGGGCTGACATTTTCTTTCATGGGCACCAACCTGCATTTGTATGTGTCCCGAATCCACAGTCGTACTGATTCTAATGGGGACACAGAT
CATGGTAGAGAATCTCTCCCTCCTCAGTAAATGTACAACTGCACCTGTCATCATGGAGGTCATACATGCATACAAAGAGGTGTACAGGTA
CCATCTTGTATACACATATATACCCACATGTACAGACATACATTTATGCACATTCACGCTGTTTGTTTCATATATACAGGCATAAAATAG
AGTAAATACAGGTAGTTTTAAAAGTACCCTTTTGTGTGAATTGACTACCGTTGTTTGCAAACCCGAAAATAAAAGACGTTCATTATGTAT
GAAAAGTAACTGATTTGTATTCTGTGAGCATGTAAAAGCGGAAAGTTAGTGCTTGTTCTAAGATTACCTTCTTGTTGATAAACCATAAAT
GAATCATCAAAGCTCACACCAAATTTTTCTATCAAATAAAACTAGTGACAGCTTGTGGCTTTTTATTAGAGCTCGCCACGAACTAGGGTA
AGGTGAGTGTCTTAGCATATTTTAATGCAGTTGCTTACTAAAGGTTTTAACCGCACATGCACACACACACGCTTTCTTATGCAATCTATG
TTTGCACTTGTGCTTTCAGTTAGCCTTCTGTAGGAAGTAGAAGTCATATGTTGTCTTTGTTGTAGTGAAATTATACAGATAGAGTTCCAT
ATATTGTATTTGTTTCAATGGTAAATCCTTTTGGAACATATAGAATGCAGAGATTTTTTTTTCCATTAAAATAAATGGGTATTGGTGGTT

>In-frame_GSE1_ENST00000393243_chr16_85647004_+_CDH13_ENST00000268613_chr16_83520082_+_1754nt
CCAGCATGTATCAGCCGAGGTGGAGCTGCGGGGCCCTGGCATGAAAGGCACCACAGTGATGCGGATGACAGCCTTTGATGCAGATGACCC
AGCCACCGATAATGCCCTCCTGCGGTATAATATCCGTCAGCAGACGCCTGACAAGCCATCTCCCAACATGTTCTACATCGATCCTGAGAA
AGGAGACATTGTCACTGTTGTGTCACCTGCGCTGCTGGACCGAGAGACTCTGGAAAATCCCAAGTATGAACTGATCATCGAGGCTCAAGA
TATGGCTGGACTGGATGTTGGATTAACAGGCACGGCCACAGCCACGATCATGATCGATGACAAAAATGATCACTCACCAAAATTCACCAA
GAAAGAGTTTCAAGCCACAGTCGAGGAAGGAGCTGTGGGAGTTATTGTCAATTTGACAGTTGAAGATAAGGATGACCCCACCACAGGTGC
ATGGAGGGCTGCCTACACCATCATCAACGGAAACCCCGGGCAGAGCTTTGAAATCCACACCAACCCTCAAACCAACGAAGGGATGCTTTC
TGTTGTCAAACCATTGGACTATGAAATTTCTGCCTTCCACACCCTGCTGATCAAAGTGGAAAATGAAGACCCACTCGTACCCGACGTCTC
CTACGGCCCCAGCTCCACAGCCACCGTCCACATCACTGTCCTGGATGTCAACGAGGGCCCAGTCTTCTACCCAGACCCCATGATGGTGAC
CAGGCAGGAGGACCTCTCTGTGGGCAGCGTGCTGCTGACAGTGAATGCCACGGACCCCGACTCCCTGCAGCATCAAACCATCAGGTATTC
TGTTTACAAGGACCCAGCAGGTTGGCTGAATATTAACCCCATCAATGGGACTGTTGACACCACAGCTGTGCTGGACCGTGAGTCCCCATT
TGTCGACAACAGCGTGTACACTGCTCTCTTCCTGGCAATTGACAGTGGCAACCCTCCCGCTACGGGCACTGGGACTTTGCTGATAACCCT
GGAGGACGTGAATGACAATGCCCCGTTCATTTACCCCACAGTAGCTGAAGTCTGTGATGATGCCAAAAACCTCAGTGTAGTCATTTTGGG
AGCATCAGATAAGGATCTTCACCCGAATACAGATCCTTTCAAATTTGAAATCCACAAACAAGCTGTTCCTGATAAAGTCTGGAAGATCTC
CAAGATCAACAATACACACGCCCTGGTAAGCCTTCTTCAAAATCTGAACAAAGCAAACTACAACCTGCCCATCATGGTGACAGATTCAGG
GAAACCACCCATGACGAATATCACAGATCTCAGGGTACAAGTGTGCTCCTGCAGGAATTCCAAAGTGGACTGCAACGCGGCAGGGGCCCT
GCGCTTCAGCCTGCCCTCAGTCCTGCTCCTCAGCCTCTTCAGCTTAGCTTGTCTGTGAGAACTCCTGACGTCTGAAGCTTGACTCCCAAG
TTTCCATAGCAACAGGAAAAAAAAAAATCTATCCAAATCTGAAGATTGCGGTTTACAGCTATCGAACTTCACAACTAGGCCTCAATTGTT
CCGGTTTTTTATTTTCTTTACAATTTCACTTAGTCTGTACTTCATCATTTTGACAGCATCTTCCTCCCTCCTTTAATTAATGGAATCTTC
TGAATTTTCCCTGAATGTTTAAAGATCATGACATATGACTTGATCTTCTGGGAGCAGGAACAATGACTACTTTTTCTGGTGTGTTAACAT


Top

FusionGenePPI for GSE1_CDH13


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GSE1NUDT18, RBPMS, RCOR3, HDAC2, KDM1A, RBM48, XRCC6, NR2E1, CDC5L, CEP63, TNIK, ELAVL1, TCF3, FUS, HDAC1, MTA3, EXOSC6, DGCR6, RUNX1T1, GOLGA2, TRIP6, RALBP1, GSE1, C1orf94, TEKT4, C6orf165, SNAI1, HMG20B, FGF1, DOK4, NTRK1, SRPK2, NINL, MAPK3, HMG20A, TCF4, EYA2, LLGL2, HAO2, FAM136A, NR3C1, AR, TRIM25CDH13MAPK6, HAX1, NUFIP1, DGUOK, DNAAF2, AURKA, CASP8, CCND1, CHEK2, HMMR, PTPN1, RAD51, SEC14L1, AGPAT5, INSIG1, DSTYK, RRAGB, ERMP1, VMP1, UQCC1, TUBB3, CHPT1, TUBB8, GHITM, ARF5, PIGU, TMX4, RPL23, MTNR1B


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GSE1_CDH13


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GSE1_CDH13


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCDH13C0001973Alcoholic Intoxication, Chronic3PSYGENET
TgeneCDH13C0033578Prostatic Neoplasms2CTD_human
TgeneCDH13C2239176Liver carcinoma2CTD_human
TgeneCDH13C0004763Barrett Esophagus1CTD_human
TgeneCDH13C0007131Non-Small Cell Lung Carcinoma1CTD_human
TgeneCDH13C0011570Mental Depression1PSYGENET
TgeneCDH13C0011581Depressive disorder1PSYGENET
TgeneCDH13C0014859Esophageal Neoplasms1CTD_human
TgeneCDH13C0024121Lung Neoplasms1CTD_human
TgeneCDH13C0236733Amphetamine-Related Disorders1CTD_human
TgeneCDH13C0236969Substance-Related Disorders1CTD_human