FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 15191

FusionGeneSummary for GPD1L_CMTM7

check button Fusion gene summary
Fusion gene informationFusion gene name: GPD1L_CMTM7
Fusion gene ID: 15191
HgeneTgene
Gene symbol

GPD1L

CMTM7

Gene ID

23171

112616

Gene nameglycerol-3-phosphate dehydrogenase 1 likeCKLF like MARVEL transmembrane domain containing 7
SynonymsGPD1-LCKLFSF7
Cytomap

3p22.3

3p22.3

Type of geneprotein-codingprotein-coding
Descriptionglycerol-3-phosphate dehydrogenase 1-like proteinCKLF-like MARVEL transmembrane domain-containing protein 7chemokine-like factor super family 7chemokine-like factor super family member 7 variant 2chemokine-like factor superfamily 7chemokine-like factor superfamily member 7
Modification date2018051920180523
UniProtAcc

Q8N335

Q96FZ5

Ensembl transtripts involved in fusion geneENST00000282541, ENST00000334983, 
ENST00000349718, 
Fusion gene scores* DoF score3 X 2 X 3=183 X 2 X 3=18
# samples 43
** MAII scorelog2(4/18*10)=1.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: GPD1L [Title/Abstract] AND CMTM7 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-85-8276-01AGPD1Lchr3

32188226

+CMTM7chr3

32483332

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000282541ENST00000334983GPD1Lchr3

32188226

+CMTM7chr3

32483332

+
In-frameENST00000282541ENST00000349718GPD1Lchr3

32188226

+CMTM7chr3

32483332

+

Top

FusionProtFeatures for GPD1L_CMTM7


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GPD1L

Q8N335

CMTM7

Q96FZ5

Plays a role in regulating cardiac sodium current;decreased enzymatic activity with resulting increased levels ofglycerol 3-phosphate activating the DPD1L-dependent SCN5Aphosphorylation pathway, may ultimately lead to decreased sodiumcurrent; cardiac sodium current may also be reduced due toalterations of NAD(H) balance induced by DPD1L.{ECO:0000269|PubMed:19666841, ECO:0000269|PubMed:19745168}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGPD1Lchr3:32188226chr3:32483332ENST00000282541+5812_17206352Nucleotide bindingNAD
TgeneCMTM7chr3:32188226chr3:32483332ENST00000334983+05110_13053176TransmembraneHelical
TgeneCMTM7chr3:32188226chr3:32483332ENST00000334983+05140_16053176TransmembraneHelical
TgeneCMTM7chr3:32188226chr3:32483332ENST00000334983+0577_9753176TransmembraneHelical
TgeneCMTM7chr3:32188226chr3:32483332ENST00000349718+04110_13053143TransmembraneHelical
TgeneCMTM7chr3:32188226chr3:32483332ENST00000349718+04140_16053143TransmembraneHelical
TgeneCMTM7chr3:32188226chr3:32483332ENST00000349718+0477_9753143TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGPD1Lchr3:32188226chr3:32483332ENST00000282541+58271_272206352RegionNote=Substrate binding
TgeneCMTM7chr3:32188226chr3:32483332ENST00000334983+0540_16653176DomainMARVEL
TgeneCMTM7chr3:32188226chr3:32483332ENST00000349718+0440_16653143DomainMARVEL
TgeneCMTM7chr3:32188226chr3:32483332ENST00000334983+0543_6353176TransmembraneHelical
TgeneCMTM7chr3:32188226chr3:32483332ENST00000349718+0443_6353143TransmembraneHelical


Top

FusionGeneSequence for GPD1L_CMTM7


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GPD1L_ENST00000282541_chr3_32188226_+_CMTM7_ENST00000334983_chr3_32483332_+_329aa
MAAAPLKVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETVNGRKLTDIINNDHENVKYLPGHKLPENVVAMSNLSEAVQDADL
LVFVIPHQFIHRICDEITGRVPKKALGITLIKGIDEGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLLFK
ELLQTPNFRITVVDDADTVELCGALKVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYL

>In-frame_GPD1L_ENST00000282541_chr3_32188226_+_CMTM7_ENST00000349718_chr3_32483332_+_296aa
MAAAPLKVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETVNGRKLTDIINNDHENVKYLPGHKLPENVVAMSNLSEAVQDADL
LVFVIPHQFIHRICDEITGRVPKKALGITLIKGIDEGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLLFK
ELLQTPNFRITVVDDADTVELCGALKVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSIFGFMA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GPD1L_ENST00000282541_chr3_32188226_+_CMTM7_ENST00000334983_chr3_32483332_+_987nt
ATGGCAGCGGCGCCCCTGAAAGTGTGCATCGTGGGCTCGGGGAACTGGGGTTCAGCTGTTGCAAAAATAATTGGTAATAATGTCAAGAAA
CTTCAGAAATTTGCCTCCACAGTCAAGATGTGGGTCTTTGAAGAAACAGTGAATGGCAGAAAACTGACAGACATCATAAATAATGACCAT
GAAAATGTAAAATATCTTCCTGGACACAAGCTGCCAGAAAATGTGGTTGCCATGTCAAATCTTAGCGAGGCTGTGCAGGATGCAGACCTG
CTGGTGTTTGTCATTCCCCACCAGTTCATTCACAGAATCTGTGATGAGATCACTGGGAGAGTGCCCAAGAAAGCGCTGGGAATCACCCTC
ATCAAGGGCATAGACGAGGGCCCCGAGGGGCTGAAGCTCATTTCTGACATCATCCGTGAGAAGATGGGTATTGACATCAGTGTGCTGATG
GGAGCCAACATTGCCAATGAGGTGGCTGCAGAGAAGTTCTGTGAGACCACCATCGGCAGCAAAGTAATGGAGAACGGCCTTCTCTTCAAA
GAACTTCTGCAGACTCCAAATTTTCGAATTACCGTGGTTGATGATGCAGACACTGTTGAACTCTGTGGTGCGCTTAAGGTCACCCTGCTG
ATTGCCTTCATCTGTGTGCGGAGCTCCCTGTGGACCAACTACAGCGCCTACAGCTACTTTGAAGTGGTCACCATTTGCGACTTGATAATG
ATCCTCGCCTTTTACCTGGTCCACCTCTTCCGCTTCTACCGCGTGCTCACCTGTATCAGCTGGCCCCTGTCGGAACTTCTGCACTATTTA
ATCGGTACCCTGCTCCTCCTCATCGCCTCCATTGTGGCAGCTTCCAAGAGTTACAACCAGAGCGGACTGGTAGCCGGAGCGATCTTTGGT

>In-frame_GPD1L_ENST00000282541_chr3_32188226_+_CMTM7_ENST00000349718_chr3_32483332_+_888nt
ATGGCAGCGGCGCCCCTGAAAGTGTGCATCGTGGGCTCGGGGAACTGGGGTTCAGCTGTTGCAAAAATAATTGGTAATAATGTCAAGAAA
CTTCAGAAATTTGCCTCCACAGTCAAGATGTGGGTCTTTGAAGAAACAGTGAATGGCAGAAAACTGACAGACATCATAAATAATGACCAT
GAAAATGTAAAATATCTTCCTGGACACAAGCTGCCAGAAAATGTGGTTGCCATGTCAAATCTTAGCGAGGCTGTGCAGGATGCAGACCTG
CTGGTGTTTGTCATTCCCCACCAGTTCATTCACAGAATCTGTGATGAGATCACTGGGAGAGTGCCCAAGAAAGCGCTGGGAATCACCCTC
ATCAAGGGCATAGACGAGGGCCCCGAGGGGCTGAAGCTCATTTCTGACATCATCCGTGAGAAGATGGGTATTGACATCAGTGTGCTGATG
GGAGCCAACATTGCCAATGAGGTGGCTGCAGAGAAGTTCTGTGAGACCACCATCGGCAGCAAAGTAATGGAGAACGGCCTTCTCTTCAAA
GAACTTCTGCAGACTCCAAATTTTCGAATTACCGTGGTTGATGATGCAGACACTGTTGAACTCTGTGGTGCGCTTAAGGTCACCCTGCTG
ATTGCCTTCATCTGTGTGCGGAGCTCCCTGTGGACCAACTACAGCGCCTACAGCTACTTTGAAGTGGTCACCATTTGCGACTTGATAATG
ATCCTCGCCTTTTACCTGGTCCACCTCTTCCGCTTCTACCGCGTGCTCACCTGTATCAGCTGGCCCCTGTCGATCTTTGGTTTCATGGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_GPD1L_ENST00000282541_chr3_32188226_+_CMTM7_ENST00000334983_chr3_32483332_+_2462nt
GCAGTGGTTCTTGGGAGTGGCGAAGCGGGTCCTGCCCCGCTGTCAGCTGCGGCCCCCGGCGCCGGGCGGGGGTGGCCGCGACCATTGGCG
GAGAGGCGAAAGGGGCGGGGCCGCCGCCAGCCGCTGCGGGCAAGGCTGAACAGGCGGAGGTGGGCAGCCGGCCAGGGAAGCACGGTCCAG
GCGGCTACATTCGGCCCGGCCATGGCAGCGGCGCCCCTGAAAGTGTGCATCGTGGGCTCGGGGAACTGGGGTTCAGCTGTTGCAAAAATA
ATTGGTAATAATGTCAAGAAACTTCAGAAATTTGCCTCCACAGTCAAGATGTGGGTCTTTGAAGAAACAGTGAATGGCAGAAAACTGACA
GACATCATAAATAATGACCATGAAAATGTAAAATATCTTCCTGGACACAAGCTGCCAGAAAATGTGGTTGCCATGTCAAATCTTAGCGAG
GCTGTGCAGGATGCAGACCTGCTGGTGTTTGTCATTCCCCACCAGTTCATTCACAGAATCTGTGATGAGATCACTGGGAGAGTGCCCAAG
AAAGCGCTGGGAATCACCCTCATCAAGGGCATAGACGAGGGCCCCGAGGGGCTGAAGCTCATTTCTGACATCATCCGTGAGAAGATGGGT
ATTGACATCAGTGTGCTGATGGGAGCCAACATTGCCAATGAGGTGGCTGCAGAGAAGTTCTGTGAGACCACCATCGGCAGCAAAGTAATG
GAGAACGGCCTTCTCTTCAAAGAACTTCTGCAGACTCCAAATTTTCGAATTACCGTGGTTGATGATGCAGACACTGTTGAACTCTGTGGT
GCGCTTAAGGTCACCCTGCTGATTGCCTTCATCTGTGTGCGGAGCTCCCTGTGGACCAACTACAGCGCCTACAGCTACTTTGAAGTGGTC
ACCATTTGCGACTTGATAATGATCCTCGCCTTTTACCTGGTCCACCTCTTCCGCTTCTACCGCGTGCTCACCTGTATCAGCTGGCCCCTG
TCGGAACTTCTGCACTATTTAATCGGTACCCTGCTCCTCCTCATCGCCTCCATTGTGGCAGCTTCCAAGAGTTACAACCAGAGCGGACTG
GTAGCCGGAGCGATCTTTGGTTTCATGGCCACCTTCCTCTGCATGGCAAGCATATGGCTGTCCTATAAGATCTCGTGTGTAACCCAGTCC
ACAGATGCAGCCGTCTGATGAGGCCACAACCCCTAGGCCCCTCAGGAGCTTTGCAGAGAGGAGGACGTGTACTCCAGGCGAGGCCTCTGG
ACCTGTGTTCCTGTGCCAAAGTCCTGTCAGGCTGGTGGGCACCAGGAAAGGCCTGCACCCTCTTCCTGCTCTCCCAGGAAGCCAGCTCCC
TGAGCTCCTGAGCCAGCCGGAAACTCTTCCTCCAGCCTTCCGGGGAGAACATCCCTCCCATTCTGGGAAAGGAAAGCAGCCTCCAGGGAA
ATGTTTTCTGCCTTCCTGCTTCTAGAACCACCTCAGGTACTGATGAACCCCACTTAGCACAGCTGAAGGGGTTTGTGAATACTCCCGCCT
AAATCCCTTCTACTTCACTCCTCAGGGGAGTGAAGTGCCTTAAGAAACAAAGCCCTGTCCTAATTTATCTAGCTTGTCAGTCCGGTCTTA
GAGATACCCTCTTTCCTGAAGTGAGGCGTGCCTGTAGAAACACTATGTGGTCAGCCTGTCCCCAAGGAGATCTTGTGTCTCCTCTCCATC
TCTGCCTTTGTTACCAGTGTGCATGTGTTTGTGTGTTTTTTAATAAAATATTGACTCGGCCAGTTGCACAAGGATTTCTTATTGAACCAG
ATGAAGGCTGTAAAACCTGGCCTGAAACAGTTTCCATTCGAGCTTGTGTCTGGCCCATGGCCCTCCACCCGTGCTCTGTGTGTGCCCCTT
GCTGAACTGCTGGACTTCAGGTTTTCTCTCCATCTTGGGGGATAGTATAGCAGGGCAGAGTTTTAGGTAAACATGTGCAGGTTCTCAATT
ATATTCACGTCCTCCTTCTCCTGCAATACCAATCTTCTCATTTTGGAAAGAGCTTTAGAGCAAGCTAAGGGTTGTGTTTACACTATGATG
ATTAATGATCTCGGCCTAAATGTGCTGTTTCGCTGATCTTGAGCTGCTCAGTTGGCTAGAAAAAGGAGGGATGGAACAATGTTTGAGCAA
CCCCGTGTGCAAGGACCTACATTCACAACCACATCTAATAGCGATGGTAGTGACTGCAAGGGGGCAGGTTATAGGACCACATTTTTAGAA
ATGAAATCGGGGCTCCATCCCCAGGCACAGGGCAAGCCAGTGAGGAGCTGGGCTCAGGATCTAGGTCTGCCTGACTCCCAGCCCCATCCT
TGCCTCTGCTGAGTGTTGCCGGAAATGGAAGCAGCCCCTGTGGGCTTTGAGCTGGAGCTCTGGGGCTACTCTTGTGGCTGCTGGCCAGCT

>In-frame_GPD1L_ENST00000282541_chr3_32188226_+_CMTM7_ENST00000349718_chr3_32483332_+_1665nt
GCAGTGGTTCTTGGGAGTGGCGAAGCGGGTCCTGCCCCGCTGTCAGCTGCGGCCCCCGGCGCCGGGCGGGGGTGGCCGCGACCATTGGCG
GAGAGGCGAAAGGGGCGGGGCCGCCGCCAGCCGCTGCGGGCAAGGCTGAACAGGCGGAGGTGGGCAGCCGGCCAGGGAAGCACGGTCCAG
GCGGCTACATTCGGCCCGGCCATGGCAGCGGCGCCCCTGAAAGTGTGCATCGTGGGCTCGGGGAACTGGGGTTCAGCTGTTGCAAAAATA
ATTGGTAATAATGTCAAGAAACTTCAGAAATTTGCCTCCACAGTCAAGATGTGGGTCTTTGAAGAAACAGTGAATGGCAGAAAACTGACA
GACATCATAAATAATGACCATGAAAATGTAAAATATCTTCCTGGACACAAGCTGCCAGAAAATGTGGTTGCCATGTCAAATCTTAGCGAG
GCTGTGCAGGATGCAGACCTGCTGGTGTTTGTCATTCCCCACCAGTTCATTCACAGAATCTGTGATGAGATCACTGGGAGAGTGCCCAAG
AAAGCGCTGGGAATCACCCTCATCAAGGGCATAGACGAGGGCCCCGAGGGGCTGAAGCTCATTTCTGACATCATCCGTGAGAAGATGGGT
ATTGACATCAGTGTGCTGATGGGAGCCAACATTGCCAATGAGGTGGCTGCAGAGAAGTTCTGTGAGACCACCATCGGCAGCAAAGTAATG
GAGAACGGCCTTCTCTTCAAAGAACTTCTGCAGACTCCAAATTTTCGAATTACCGTGGTTGATGATGCAGACACTGTTGAACTCTGTGGT
GCGCTTAAGGTCACCCTGCTGATTGCCTTCATCTGTGTGCGGAGCTCCCTGTGGACCAACTACAGCGCCTACAGCTACTTTGAAGTGGTC
ACCATTTGCGACTTGATAATGATCCTCGCCTTTTACCTGGTCCACCTCTTCCGCTTCTACCGCGTGCTCACCTGTATCAGCTGGCCCCTG
TCGATCTTTGGTTTCATGGCCACCTTCCTCTGCATGGCAAGCATATGGCTGTCCTATAAGATCTCGTGTGTAACCCAGTCCACAGATGCA
GCCGTCTGATGAGGCCACAACCCCTAGGCCCCTCAGGAGCTTTGCAGAGAGGAGGACGTGTACTCCAGGCGAGGCCTCTGGACCTGTGTT
CCTGTGCCAAAGTCCTGTCAGGCTGGTGGGCACCAGGAAAGGCCTGCACCCTCTTCCTGCTCTCCCAGGAAGCCAGCTCCCTGAGCTCCT
GAGCCAGCCGGAAACTCTTCCTCCAGCCTTCCGGGGAGAACATCCCTCCCATTCTGGGAAAGGAAAGCAGCCTCCAGGGAAATGTTTTCT
GCCTTCCTGCTTCTAGAACCACCTCAGGTACTGATGAACCCCACTTAGCACAGCTGAAGGGGTTTGTGAATACTCCCGCCTAAATCCCTT
CTACTTCACTCCTCAGGGGAGTGAAGTGCCTTAAGAAACAAAGCCCTGTCCTAATTTATCTAGCTTGTCAGTCCGGTCTTAGAGATACCC
TCTTTCCTGAAGTGAGGCGTGCCTGTAGAAACACTATGTGGTCAGCCTGTCCCCAAGGAGATCTTGTGTCTCCTCTCCATCTCTGCCTTT


Top

FusionGenePPI for GPD1L_CMTM7


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GPD1LELAVL1, BSG, FAS, PALM2, ART3, ISLR, TGOLN2, ALDOA, ALDOC, CYCS, GNPNAT1, ACO2, CKMT1A, CKMT1B, FH, GAPDH, GPT2, MYH7B, PHGDH, PYCRL, PGM1, TPI1, UPP1, GPD1, LAMP2, FAM174A, C1orf85, CCL5, DKKL1CMTM7LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GPD1L_CMTM7


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GPD1L_CMTM7


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneGPD1LC2673193Brugada Syndrome 23CTD_human;UNIPROT
HgeneGPD1LC0038644Sudden infant death syndrome2UNIPROT
HgeneGPD1LC0015695Fatty Liver1CTD_human