FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14816

FusionGeneSummary for GNA11_SLC30A6

check button Fusion gene summary
Fusion gene informationFusion gene name: GNA11_SLC30A6
Fusion gene ID: 14816
HgeneTgene
Gene symbol

GNA11

SLC30A6

Gene ID

2767

55676

Gene nameG protein subunit alpha 11solute carrier family 30 member 6
SynonymsFBH|FBH2|FHH2|GNA-11|HHC2|HYPOC2MST103|MSTP103|ZNT6
Cytomap

19p13.3

2p22.3

Type of geneprotein-codingprotein-coding
Descriptionguanine nucleotide-binding protein subunit alpha-11g alpha-11guanine nucleotide binding protein (G protein), alpha 11 (Gq class)guanine nucleotide-binding protein G(y) subunit alphazinc transporter 6solute carrier family 30 (zinc transporter), member 6
Modification date2018052320180522
UniProtAcc

P29992

Q6NXT4

Ensembl transtripts involved in fusion geneENST00000078429, ENST00000586180, 
ENST00000538303, ENST00000379343, 
ENST00000357055, ENST00000435660, 
ENST00000282587, ENST00000406369, 
Fusion gene scores* DoF score4 X 3 X 3=363 X 4 X 4=48
# samples 64
** MAII scorelog2(6/36*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: GNA11 [Title/Abstract] AND SLC30A6 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-CH-5754-01AGNA11chr19

3094785

+SLC30A6chr2

32400388

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000078429ENST00000538303GNA11chr19

3094785

+SLC30A6chr2

32400388

+
In-frameENST00000078429ENST00000379343GNA11chr19

3094785

+SLC30A6chr2

32400388

+
5CDS-intronENST00000078429ENST00000357055GNA11chr19

3094785

+SLC30A6chr2

32400388

+
5CDS-intronENST00000078429ENST00000435660GNA11chr19

3094785

+SLC30A6chr2

32400388

+
5CDS-intronENST00000078429ENST00000282587GNA11chr19

3094785

+SLC30A6chr2

32400388

+
5CDS-intronENST00000078429ENST00000406369GNA11chr19

3094785

+SLC30A6chr2

32400388

+
intron-3CDSENST00000586180ENST00000538303GNA11chr19

3094785

+SLC30A6chr2

32400388

+
intron-3CDSENST00000586180ENST00000379343GNA11chr19

3094785

+SLC30A6chr2

32400388

+
intron-intronENST00000586180ENST00000357055GNA11chr19

3094785

+SLC30A6chr2

32400388

+
intron-intronENST00000586180ENST00000435660GNA11chr19

3094785

+SLC30A6chr2

32400388

+
intron-intronENST00000586180ENST00000282587GNA11chr19

3094785

+SLC30A6chr2

32400388

+
intron-intronENST00000586180ENST00000406369GNA11chr19

3094785

+SLC30A6chr2

32400388

+

Top

FusionProtFeatures for GNA11_SLC30A6


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GNA11

P29992

SLC30A6

Q6NXT4

Guanine nucleotide-binding proteins (G proteins) areinvolved as modulators or transducers in various transmembranesignaling systems. Acts as an activator of phospholipase C. Zinc-efflux transporter which allocates the cytoplasmiczinc to the trans-Golgi network (TGN) as well as the vesicularcompartment. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000282587+214120_13458462Topological domainExtracellular
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000282587+214156_20058462Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000282587+214222_22358462Topological domainExtracellular
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000282587+214245_46158462Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000282587+21455_6458462Topological domainExtracellular
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000282587+21486_9858462Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000379343+215120_13458502Topological domainExtracellular
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000379343+215156_20058502Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000379343+215222_22358502Topological domainExtracellular
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000379343+215245_46158502Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000379343+21555_6458502Topological domainExtracellular
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000379343+21586_9858502Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000435660+213120_13458439Topological domainExtracellular
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000435660+213156_20058439Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000435660+213222_22358439Topological domainExtracellular
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000435660+213245_46158439Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000435660+21355_6458439Topological domainExtracellular
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000435660+21386_9858439Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000538303+113120_13429433Topological domainExtracellular
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000538303+113156_20029433Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000538303+113222_22329433Topological domainExtracellular
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000538303+113245_46129433Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000538303+11355_6429433Topological domainExtracellular
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000538303+11386_9829433Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000282587+214135_15558462TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000282587+214201_22158462TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000282587+214224_24458462TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000282587+21465_8558462TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000282587+21499_11958462TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000379343+215135_15558502TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000379343+215201_22158502TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000379343+215224_24458502TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000379343+21565_8558502TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000379343+21599_11958502TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000435660+213135_15558439TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000435660+213201_22158439TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000435660+213224_24458439TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000435660+21365_8558439TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000435660+21399_11958439TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000538303+113135_15529433TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000538303+113201_22129433TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000538303+113224_24429433TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000538303+11334_5429433TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000538303+11365_8529433TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000538303+11399_11929433TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGNA11chr19:3094785chr2:32400388ENST00000078429+17180_18645360Nucleotide bindingGTP
HgeneGNA11chr19:3094785chr2:32400388ENST00000078429+17205_20945360Nucleotide bindingGTP
HgeneGNA11chr19:3094785chr2:32400388ENST00000078429+17274_27745360Nucleotide bindingGTP
HgeneGNA11chr19:3094785chr2:32400388ENST00000078429+1746_5345360Nucleotide bindingGTP
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000282587+2141_3358462Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000379343+2151_3358502Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000435660+2131_3358439Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000538303+1131_3329433Topological domainCytoplasmic
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000282587+21434_5458462TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000379343+21534_5458502TransmembraneHelical
TgeneSLC30A6chr19:3094785chr2:32400388ENST00000435660+21334_5458439TransmembraneHelical


Top

FusionGeneSequence for GNA11_SLC30A6


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GNA11_ENST00000078429_chr19_3094785_+_SLC30A6_ENST00000538303_chr2_32400388_+_449aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLALTATTYLTIFDLFSLMTCLISYWVTLRKPSPVTSFGFERLEVLA
VFASTVLAQLGALFILKESAERFLEQPEIHTGRLLVGTFVALCFNLFTMLSIRNKPFATVSEAASTSWLQEHVADLSRSLCGIIPGLSSI
FLPRMNPFVLIDLAGAFALCITTMLIEINNTFAVDTASAIAIALMTFGTMTPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVR
NEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPV

>In-frame_GNA11_ENST00000078429_chr19_3094785_+_SLC30A6_ENST00000379343_chr2_32400388_+_489aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLALTATTYLTIFDLFRDGVSPFWLGWSQTPDLKWSTHLGLPKCWDN
RRELPCLSNSLMTCLISYWVTLRKPSPVTSFGFERLEVLAVFASTVLAQLGALFILKESAERFLEQPEIHTGRLLVGTFVALCFNLFTML
SIRNKPFATVSEAASTSWLQEHVADLSRSLCGIIPGLSSIFLPRMNPFVLIDLAGAFALCITTMLIEINNTFAVDTASAIAIALMTFGTM
TPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVLEVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFK
DDWIRPALLSGPVAANVLNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPTGFGLNHGHTPYSSM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GNA11_ENST00000078429_chr19_3094785_+_SLC30A6_ENST00000538303_chr2_32400388_+_1347nt
ATGACTCTGGAGTCCATGATGGCGTGTTGCCTGAGCGATGAGGTGAAGGAGTCCAAGCGGATCAACGCCGAGATCGAGAAGCAGCTGCGG
CGGGACAAGCGCGACGCCCGGCGCGAGCTCAAGCTGCTGCTGCTCGCTTTAACTGCCTATACTTACCTGACCATTTTTGATCTTTTTAGT
TTAATGACATGTTTAATAAGTTACTGGGTAACATTGAGGAAACCTAGCCCTGTCTATTCATTTGGGTTTGAAAGATTAGAAGTCCTGGCT
GTATTTGCCTCCACAGTCTTGGCACAGTTGGGAGCTCTCTTTATATTAAAAGAAAGTGCAGAACGCTTTTTGGAACAGCCCGAGATACAC
ACGGGAAGATTATTAGTTGGTACTTTTGTGGCTCTTTGTTTCAACCTGTTCACGATGCTTTCTATTCGGAATAAACCTTTTGCTTATGTC
TCAGAAGCTGCTAGTACGAGCTGGCTTCAAGAGCATGTTGCAGATCTTAGTCGAAGCTTGTGTGGAATTATTCCGGGACTTAGCAGTATC
TTCCTTCCCCGAATGAATCCATTTGTTTTGATTGATCTTGCTGGAGCATTTGCTCTTTGTATTACATATATGCTCATTGAAATTAATAAT
TATTTTGCCGTAGACACTGCCTCTGCTATAGCTATTGCCTTGATGACATTTGGCACTATGTATCCCATGAGTGTGTACAGTGGGAAAGTC
TTACTCCAGACAACACCACCCCATGTTATTGGTCAGTTGGACAAACTCATCAGAGAGGTATCTACCTTAGATGGAGTTTTAGAAGTCCGA
AATGAACATTTTTGGACCCTAGGTTTTGGCTCATTGGCTGGATCAGTGCATGTAAGAATTCGACGAGATGCCAATGAACAAATGGTTCTT
GCTCATGTGACCAACAGGCTGTACACTCTAGTGTCTACTCTAACTGTTCAAATTTTCAAGGATGACTGGATTAGGCCTGCCTTATTGTCT
GGGCCTGTTGCAGCCAATGTCCTAAACTTTTCAGATCATCACGTAATCCCAATGCCTCTTTTAAAGGGTACTGATGATTTGAACCCAGTT
ACATCAACTCCAGCTAAACCTAGTAGTCCACCTCCAGAATTTTCATTTAACACTCCTGGGAAAAATGTGAACCCAGTTATTCTTCTAAAC
ACACAAACAAGGCCTTATGGTTTTGGTCTCAATCATGGACACACACCTTACAGCAGCATGCTTAATCAAGGACTTGGAGTTCCAGGAATT

>In-frame_GNA11_ENST00000078429_chr19_3094785_+_SLC30A6_ENST00000379343_chr2_32400388_+_1467nt
ATGACTCTGGAGTCCATGATGGCGTGTTGCCTGAGCGATGAGGTGAAGGAGTCCAAGCGGATCAACGCCGAGATCGAGAAGCAGCTGCGG
CGGGACAAGCGCGACGCCCGGCGCGAGCTCAAGCTGCTGCTGCTCGCTTTAACTGCCTATACTTACCTGACCATTTTTGATCTTTTTAGA
GACGGGGTTTCACCATTTTGGCTGGGCTGGTCTCAAACTCCTGACCTCAAGTGGTCCACCCACCTCGGCCTACCAAAGTGCTGGGATAAC
AGGCGTGAGCTACCGTGCCTGAGCAATAGTTTAATGACATGTTTAATAAGTTACTGGGTAACATTGAGGAAACCTAGCCCTGTCTATTCA
TTTGGGTTTGAAAGATTAGAAGTCCTGGCTGTATTTGCCTCCACAGTCTTGGCACAGTTGGGAGCTCTCTTTATATTAAAAGAAAGTGCA
GAACGCTTTTTGGAACAGCCCGAGATACACACGGGAAGATTATTAGTTGGTACTTTTGTGGCTCTTTGTTTCAACCTGTTCACGATGCTT
TCTATTCGGAATAAACCTTTTGCTTATGTCTCAGAAGCTGCTAGTACGAGCTGGCTTCAAGAGCATGTTGCAGATCTTAGTCGAAGCTTG
TGTGGAATTATTCCGGGACTTAGCAGTATCTTCCTTCCCCGAATGAATCCATTTGTTTTGATTGATCTTGCTGGAGCATTTGCTCTTTGT
ATTACATATATGCTCATTGAAATTAATAATTATTTTGCCGTAGACACTGCCTCTGCTATAGCTATTGCCTTGATGACATTTGGCACTATG
TATCCCATGAGTGTGTACAGTGGGAAAGTCTTACTCCAGACAACACCACCCCATGTTATTGGTCAGTTGGACAAACTCATCAGAGAGGTA
TCTACCTTAGATGGAGTTTTAGAAGTCCGAAATGAACATTTTTGGACCCTAGGTTTTGGCTCATTGGCTGGATCAGTGCATGTAAGAATT
CGACGAGATGCCAATGAACAAATGGTTCTTGCTCATGTGACCAACAGGCTGTACACTCTAGTGTCTACTCTAACTGTTCAAATTTTCAAG
GATGACTGGATTAGGCCTGCCTTATTGTCTGGGCCTGTTGCAGCCAATGTCCTAAACTTTTCAGATCATCACGTAATCCCAATGCCTCTT
TTAAAGGGTACTGATGATTTGAACCCAGTTACATCAACTCCAGCTAAACCTAGTAGTCCACCTCCAGAATTTTCATTTAACACTCCTGGG
AAAAATGTGAACCCAGTTATTCTTCTAAACACACAAACAAGGCCTTATGGTTTTGGTCTCAATCATGGACACACACCTTACAGCAGCATG
CTTAATCAAGGACTTGGAGTTCCAGGAATTGGAGCAACTCAAGGATTGAGGACTGGTTTTACAAATATACCAAGTAGATATGGAACTAAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_GNA11_ENST00000078429_chr19_3094785_+_SLC30A6_ENST00000538303_chr2_32400388_+_2023nt
GCTGCGGCGGCGGCGCGGGCTGAGTGCGGCCGCGCGGGAGTCCGCGGCTGGCGCGGCCCGAGCGGGGACCCGGCGGCTCGCCAGGCGGCG
GCCGAGGCGGGGCGGGCCGGCCCGGGGCCGAGGGCCGGTGGCCGAGGCCGGAGGGCCGCGGCGGGCGGCGGCCGAGGCGGCTCCGGCCAG
GGCCGGGCCGGGGGCCGGGGGGCGGCGGCGGGCAGGCGGCCGCGTCGGCCGGGGCCGGGACGATGACTCTGGAGTCCATGATGGCGTGTT
GCCTGAGCGATGAGGTGAAGGAGTCCAAGCGGATCAACGCCGAGATCGAGAAGCAGCTGCGGCGGGACAAGCGCGACGCCCGGCGCGAGC
TCAAGCTGCTGCTGCTCGCTTTAACTGCCTATACTTACCTGACCATTTTTGATCTTTTTAGTTTAATGACATGTTTAATAAGTTACTGGG
TAACATTGAGGAAACCTAGCCCTGTCTATTCATTTGGGTTTGAAAGATTAGAAGTCCTGGCTGTATTTGCCTCCACAGTCTTGGCACAGT
TGGGAGCTCTCTTTATATTAAAAGAAAGTGCAGAACGCTTTTTGGAACAGCCCGAGATACACACGGGAAGATTATTAGTTGGTACTTTTG
TGGCTCTTTGTTTCAACCTGTTCACGATGCTTTCTATTCGGAATAAACCTTTTGCTTATGTCTCAGAAGCTGCTAGTACGAGCTGGCTTC
AAGAGCATGTTGCAGATCTTAGTCGAAGCTTGTGTGGAATTATTCCGGGACTTAGCAGTATCTTCCTTCCCCGAATGAATCCATTTGTTT
TGATTGATCTTGCTGGAGCATTTGCTCTTTGTATTACATATATGCTCATTGAAATTAATAATTATTTTGCCGTAGACACTGCCTCTGCTA
TAGCTATTGCCTTGATGACATTTGGCACTATGTATCCCATGAGTGTGTACAGTGGGAAAGTCTTACTCCAGACAACACCACCCCATGTTA
TTGGTCAGTTGGACAAACTCATCAGAGAGGTATCTACCTTAGATGGAGTTTTAGAAGTCCGAAATGAACATTTTTGGACCCTAGGTTTTG
GCTCATTGGCTGGATCAGTGCATGTAAGAATTCGACGAGATGCCAATGAACAAATGGTTCTTGCTCATGTGACCAACAGGCTGTACACTC
TAGTGTCTACTCTAACTGTTCAAATTTTCAAGGATGACTGGATTAGGCCTGCCTTATTGTCTGGGCCTGTTGCAGCCAATGTCCTAAACT
TTTCAGATCATCACGTAATCCCAATGCCTCTTTTAAAGGGTACTGATGATTTGAACCCAGTTACATCAACTCCAGCTAAACCTAGTAGTC
CACCTCCAGAATTTTCATTTAACACTCCTGGGAAAAATGTGAACCCAGTTATTCTTCTAAACACACAAACAAGGCCTTATGGTTTTGGTC
TCAATCATGGACACACACCTTACAGCAGCATGCTTAATCAAGGACTTGGAGTTCCAGGAATTGGAGCAACTCAAGGATTGAGGACTGGTT
TTACAAATATACCAAGTAGATATGGAACTAATAATAGAATTGGACAACCAAGACCATGATAGACTCTAACTTATTTTTATAAGGAATATT
GACTCCTTGGCTTCCAATTTATTTAGTAATCCAACTTTGCATTGACTGTTTAATCATTTACTCTAAATGTTAGATAATAGTAGTCTTGTT
CACATTTCATGAAACCTATGAAACTATATTTTTGTAAAATGTATTTGTGACAGTGAAATCCTCGTAAATGTTAAAGGCTTTAAATAGGCT
TCCTTTAGAAAATGTGTTTCTTTAAATTTGGATTTTGGTATCTTTGGTTTTGTAGTTGACTGCAGTGTGATGTGACCTTACCTTTATAAG
AGCCACTTGATGGAGTAGATCTGTCACATTACTAAGATACGATATTTCTTTTTTTTTCCGAGACGGAGTCTTGCTCTGCCACTGTGCCCG

>In-frame_GNA11_ENST00000078429_chr19_3094785_+_SLC30A6_ENST00000379343_chr2_32400388_+_2520nt
GCTGCGGCGGCGGCGCGGGCTGAGTGCGGCCGCGCGGGAGTCCGCGGCTGGCGCGGCCCGAGCGGGGACCCGGCGGCTCGCCAGGCGGCG
GCCGAGGCGGGGCGGGCCGGCCCGGGGCCGAGGGCCGGTGGCCGAGGCCGGAGGGCCGCGGCGGGCGGCGGCCGAGGCGGCTCCGGCCAG
GGCCGGGCCGGGGGCCGGGGGGCGGCGGCGGGCAGGCGGCCGCGTCGGCCGGGGCCGGGACGATGACTCTGGAGTCCATGATGGCGTGTT
GCCTGAGCGATGAGGTGAAGGAGTCCAAGCGGATCAACGCCGAGATCGAGAAGCAGCTGCGGCGGGACAAGCGCGACGCCCGGCGCGAGC
TCAAGCTGCTGCTGCTCGCTTTAACTGCCTATACTTACCTGACCATTTTTGATCTTTTTAGAGACGGGGTTTCACCATTTTGGCTGGGCT
GGTCTCAAACTCCTGACCTCAAGTGGTCCACCCACCTCGGCCTACCAAAGTGCTGGGATAACAGGCGTGAGCTACCGTGCCTGAGCAATA
GTTTAATGACATGTTTAATAAGTTACTGGGTAACATTGAGGAAACCTAGCCCTGTCTATTCATTTGGGTTTGAAAGATTAGAAGTCCTGG
CTGTATTTGCCTCCACAGTCTTGGCACAGTTGGGAGCTCTCTTTATATTAAAAGAAAGTGCAGAACGCTTTTTGGAACAGCCCGAGATAC
ACACGGGAAGATTATTAGTTGGTACTTTTGTGGCTCTTTGTTTCAACCTGTTCACGATGCTTTCTATTCGGAATAAACCTTTTGCTTATG
TCTCAGAAGCTGCTAGTACGAGCTGGCTTCAAGAGCATGTTGCAGATCTTAGTCGAAGCTTGTGTGGAATTATTCCGGGACTTAGCAGTA
TCTTCCTTCCCCGAATGAATCCATTTGTTTTGATTGATCTTGCTGGAGCATTTGCTCTTTGTATTACATATATGCTCATTGAAATTAATA
ATTATTTTGCCGTAGACACTGCCTCTGCTATAGCTATTGCCTTGATGACATTTGGCACTATGTATCCCATGAGTGTGTACAGTGGGAAAG
TCTTACTCCAGACAACACCACCCCATGTTATTGGTCAGTTGGACAAACTCATCAGAGAGGTATCTACCTTAGATGGAGTTTTAGAAGTCC
GAAATGAACATTTTTGGACCCTAGGTTTTGGCTCATTGGCTGGATCAGTGCATGTAAGAATTCGACGAGATGCCAATGAACAAATGGTTC
TTGCTCATGTGACCAACAGGCTGTACACTCTAGTGTCTACTCTAACTGTTCAAATTTTCAAGGATGACTGGATTAGGCCTGCCTTATTGT
CTGGGCCTGTTGCAGCCAATGTCCTAAACTTTTCAGATCATCACGTAATCCCAATGCCTCTTTTAAAGGGTACTGATGATTTGAACCCAG
TTACATCAACTCCAGCTAAACCTAGTAGTCCACCTCCAGAATTTTCATTTAACACTCCTGGGAAAAATGTGAACCCAGTTATTCTTCTAA
ACACACAAACAAGGCCTTATGGTTTTGGTCTCAATCATGGACACACACCTTACAGCAGCATGCTTAATCAAGGACTTGGAGTTCCAGGAA
TTGGAGCAACTCAAGGATTGAGGACTGGTTTTACAAATATACCAAGTAGATATGGAACTAATAATAGAATTGGACAACCAAGACCATGAT
AGACTCTAACTTATTTTTATAAGGAATATTGACTCCTTGGCTTCCAATTTATTTAGTAATCCAACTTTGCATTGACTGTTTAATCATTTA
CTCTAAATGTTAGATAATAGTAGTCTTGTTCACATTTCATGAAACCTATGAAACTATATTTTTGTAAAATGTATTTGTGACAGTGAAATC
CTCGTAAATGTTAAAGGCTTTAAATAGGCTTCCTTTAGAAAATGTGTTTCTTTAAATTTGGATTTTGGTATCTTTGGTTTTGTAGTTGAC
TGCAGTGTGATGTGACCTTACCTTTATAAGAGCCACTTGATGGAGTAGATCTGTCACATTACTAAGATACGATATTTCTTTTTTTTTCCG
AGACGGAGTCTTGCTCTGCCACTGTGCCCGGCCAATACATTATTATTAACTTAAGGCTGTACTTTATTAAGGCTTCCTTAGTTTTTGTTT
TGTTTTGTTTTTTGAGATGGAGTCTCACTCTGTCGCCCAGGCTGGAATGCAGTGGCATGATCTCAGCTCACTGCAACCTCTGCCTCCTGA
GTTCAAATGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGGATTACAGGCACCTGCCACCACGCCCAGCTAATTTTTGTATTTTTAGTAA
AGACGGGGGATTTCACCATGTTGGCCAGGCTGGTCTTGAACTCCTGACCTCATGATCCACCCACCTTAGCCTCCCAAAGTGCTGGGATTA
GGTGTGAGCCACCGCACCTGGCCGATATTTTCTTTAATGAAATTTATAAATATGCTTCTTGAATAATACACATTTTGGGAAAGGGAAAAA


Top

FusionGenePPI for GNA11_SLC30A6


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GNA11MTNR1A, RGS3, EDNRA, EDNRB, ELAVL1, RGS14, GNB1, GNAS, CFTR, RGS13, SLC9A3R1, TBXA2R, PLCB1, CXCR5, ABCE1, SLC25A41, FBXL18, HOXB5, NUFIP1, PAPOLA, FYTTD1, TMEM185A, ATM, CCNL2, TMEM180, GNB2, GNB4, TMEM63B, DUSP9, GNG3, DUSP22, GNG4, TRIM25SLC30A6SLC30A5, RIC3, B3GNT3, CHRNA9, SPECC1L, HDGFRP3, ACTB, ACTBL2, MYO18A, C12orf43, TCTN3, TMEM17, TMEM216, SPPL2B, CSGALNACT2, KCNA5, TPRA1, FPR2, PMEL, FUT3, ST8SIA3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GNA11_SLC30A6


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GNA11_SLC30A6


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneGNA11C0220633Uveal melanoma3CTD_human;ORPHANET
HgeneGNA11C3809243HYPOCALCEMIA, AUTOSOMAL DOMINANT 22UNIPROT
HgeneGNA11C0018798Congenital Heart Defects1CTD_human
HgeneGNA11C0025202melanoma1CTD_human
HgeneGNA11C1840347HYPOCALCIURIC HYPERCALCEMIA, FAMILIAL, TYPE II (disorder)1ORPHANET;UNIPROT
TgeneSLC30A6C0002395Alzheimer's Disease1CTD_human