FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1476

FusionGeneSummary for ALDH2_LIN7A

check button Fusion gene summary
Fusion gene informationFusion gene name: ALDH2_LIN7A
Fusion gene ID: 1476
HgeneTgene
Gene symbol

ALDH2

LIN7A

Gene ID

217

8825

Gene namealdehyde dehydrogenase 2 family memberlin-7 homolog A, crumbs cell polarity complex component
SynonymsALDH-E2|ALDHI|ALDMLIN-7A|LIN7|MALS-1|MALS1|TIP-33|VELI1
Cytomap

12q24.12

12q21.31

Type of geneprotein-codingprotein-coding
Descriptionaldehyde dehydrogenase, mitochondrialALDH class 2acetaldehyde dehydrogenase 2aldehyde dehydrogenase 2 family (mitochondrial)liver mitochondrial ALDHnucleus-encoded mitochondrial aldehyde dehydrogenase 2protein lin-7 homolog Amammalian lin-seven protein 1tax interaction protein 33vertebrate LIN7 homolog 1
Modification date2018052720180523
UniProtAcc

P05091

O14910

Ensembl transtripts involved in fusion geneENST00000416293, ENST00000261733, 
ENST00000552864, 
Fusion gene scores* DoF score7 X 6 X 5=21012 X 5 X 4=240
# samples 76
** MAII scorelog2(7/210*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/240*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ALDH2 [Title/Abstract] AND LIN7A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-3B-A9HO-01AALDH2chr12

112204900

+LIN7Achr12

81242101

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000416293ENST00000552864ALDH2chr12

112204900

+LIN7Achr12

81242101

-
In-frameENST00000261733ENST00000552864ALDH2chr12

112204900

+LIN7Achr12

81242101

-

Top

FusionProtFeatures for ALDH2_LIN7A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ALDH2

P05091

LIN7A

O14910

Plays a role in establishing and maintaining theasymmetric distribution of channels and receptors at the plasmamembrane of polarized cells. Forms membrane-associatedmultiprotein complexes that may regulate delivery and recycling ofproteins to the correct membrane domains. The tripartite complexcomposed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may havethe potential to couple synaptic vesicle exocytosis to celladhesion in brain. Ensures the proper localization of GRIN2B(subunit 2B of the NMDA receptor) to neuronal postsynaptic densityand may function in localizing synaptic vesicles at synapses whereit is recruited by beta-catenin and cadherin. Required to localizeKir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2,ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.{ECO:0000269|PubMed:12967566}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneLIN7Achr12:112204900chr12:81242101ENST00000552864-16210_213671908Compositional biasNote=Poly-Gln
TgeneLIN7Achr12:112204900chr12:81242101ENST00000552864-16217_229671908Compositional biasNote=Poly-Gln
TgeneLIN7Achr12:112204900chr12:81242101ENST00000552864-16108_190671908DomainPDZ

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneALDH2chr12:112204900chr12:81242101ENST00000261733+113262_26738518Nucleotide bindingNAD
HgeneALDH2chr12:112204900chr12:81242101ENST00000416293+112262_26738471Nucleotide bindingNAD
TgeneLIN7Achr12:112204900chr12:81242101ENST00000552864-1625_80671908DomainL27
TgeneLIN7Achr12:112204900chr12:81242101ENST00000552864-1614_28671908MotifNote=Kinase interacting site


Top

FusionGeneSequence for ALDH2_LIN7A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ALDH2_ENST00000416293_chr12_112204900_+_LIN7A_ENST00000552864_chr12_81242101_-_205aa
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQVTQTMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLG
FNVMGGKEQNSPITISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRR

>In-frame_ALDH2_ENST00000261733_chr12_112204900_+_LIN7A_ENST00000552864_chr12_81242101_-_205aa
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQVTQTMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLG
FNVMGGKEQNSPITISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ALDH2_ENST00000416293_chr12_112204900_+_LIN7A_ENST00000552864_chr12_81242101_-_615nt
ATGTTGCGCGCTGCCGCCCGCTTCGGGCCCCGCCTGGGCCGCCGCCTCTTGTCAGCCGCCGCCACCCAGGCCGTGCCTGCCCCCAACCAG
CAGCCCGAGGTCTTCTGCAACCAGGTGTATCAATATATGCATGAAACGATAACTGTTAATGGCTGTCCCGAATTCCGTGCGAGGGCAACA
GCAAAGGCAACAGTTGCAGCTTTTGCAGCTAGTGAAGGCCACTCCCACCCTCGAGTAGTTGAACTGCCAAAGACTGATGAAGGCCTTGGT
TTTAATGTGATGGGAGGAAAGGAGCAAAATTCCCCCATTTATATCTCTCGCATAATTCCTGGAGGGGTGGCTGAAAGACACGGAGGCCTC
AAAAGAGGAGACCAGCTGCTATCAGTGAACGGAGTGAGTGTGGAAGGAGAACACCATGAGAAAGCTGTGGAACTACTCAAGGCTGCTAAA
GACAGCGTCAAGCTGGTGGTGCGATACACCCCAAAAGTTCTGGAAGAAATGGAGGCTCGCTTTGAAAAGCTACGAACAGCCAGGCGTCGG

>In-frame_ALDH2_ENST00000261733_chr12_112204900_+_LIN7A_ENST00000552864_chr12_81242101_-_615nt
ATGTTGCGCGCTGCCGCCCGCTTCGGGCCCCGCCTGGGCCGCCGCCTCTTGTCAGCCGCCGCCACCCAGGCCGTGCCTGCCCCCAACCAG
CAGCCCGAGGTCTTCTGCAACCAGGTGTATCAATATATGCATGAAACGATAACTGTTAATGGCTGTCCCGAATTCCGTGCGAGGGCAACA
GCAAAGGCAACAGTTGCAGCTTTTGCAGCTAGTGAAGGCCACTCCCACCCTCGAGTAGTTGAACTGCCAAAGACTGATGAAGGCCTTGGT
TTTAATGTGATGGGAGGAAAGGAGCAAAATTCCCCCATTTATATCTCTCGCATAATTCCTGGAGGGGTGGCTGAAAGACACGGAGGCCTC
AAAAGAGGAGACCAGCTGCTATCAGTGAACGGAGTGAGTGTGGAAGGAGAACACCATGAGAAAGCTGTGGAACTACTCAAGGCTGCTAAA
GACAGCGTCAAGCTGGTGGTGCGATACACCCCAAAAGTTCTGGAAGAAATGGAGGCTCGCTTTGAAAAGCTACGAACAGCCAGGCGTCGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ALDH2_ENST00000416293_chr12_112204900_+_LIN7A_ENST00000552864_chr12_81242101_-_5918nt
ATTGGCTGCCGCGCGGGGCGGGGAGCGGGGTCGGCTCAGTGGCCCTGAGACCCTAGCTCTGCTCTCGGTCCGCTCGCTGTCCGCTAGCCC
GCTGCGATGTTGCGCGCTGCCGCCCGCTTCGGGCCCCGCCTGGGCCGCCGCCTCTTGTCAGCCGCCGCCACCCAGGCCGTGCCTGCCCCC
AACCAGCAGCCCGAGGTCTTCTGCAACCAGGTGTATCAATATATGCATGAAACGATAACTGTTAATGGCTGTCCCGAATTCCGTGCGAGG
GCAACAGCAAAGGCAACAGTTGCAGCTTTTGCAGCTAGTGAAGGCCACTCCCACCCTCGAGTAGTTGAACTGCCAAAGACTGATGAAGGC
CTTGGTTTTAATGTGATGGGAGGAAAGGAGCAAAATTCCCCCATTTATATCTCTCGCATAATTCCTGGAGGGGTGGCTGAAAGACACGGA
GGCCTCAAAAGAGGAGACCAGCTGCTATCAGTGAACGGAGTGAGTGTGGAAGGAGAACACCATGAGAAAGCTGTGGAACTACTCAAGGCT
GCTAAAGACAGCGTCAAGCTGGTGGTGCGATACACCCCAAAAGTTCTGGAAGAAATGGAGGCTCGCTTTGAAAAGCTACGAACAGCCAGG
CGTCGGCAGCAGCAGCAATTGCTAATTCAGCAGCAGCAACAGCAGCAGCAGCAACAAACACAACAAAACCACATGTCATAGGCCCTTGAG
GGAAAGCTACTTGATCAAACATCCGATAGTCACAAATTTGAAACCGTGCTTCAGAATCCCAGCACATAGTAAAAGACAACACTGATAATT
ATACCTGTCAAGAAGCTGTGAACACATGGTGTATAAATTCTTTACCAAGGCAACTCAACACCTTCTTTCTCTGGGCTTGAACCGCCACTG
CTCACGTGGGCTTTACATACATTGACCTTCCATTCACTGCAGTGGGAATTCTCAGTGTGCAGAGGGAGAGGTTTTCTAGTCTGCAAACTG
AAACAGTGTAAGAAGAATAAAGTCTATGACTTTTAAATAAATCACCAGGGCCAAGATTGAGTGAATCTTGGGTCCATAGCTTTTCCAGAT
ATTAGCAAACCCCTCATTAGGCTATAATTCAAACTGCATCAGTTCAAAGTGAAACCTACACATTGCTCCTTACCCTCACCTGCTCCACAA
TCCATAGTGCTGAGTTGTCTGAATTGGAATTCCAGTTAATTGCAAGTTCAACCTGTTTTCCTCTTGAAAATCGCAAGGTATCATACTATA
TTTATATTTTCTTCAGGTTCTAGAAGCAATCGGCTTTTTCTTTTGTTTCCATGAATTTTATTATGCATTAATAGAATGGACCAATTTTAG
CTCAACTTTTAGTTTGTTAGAAGCAAGTGTAGGAACTCTAGCACTGTAGTTTTTAATTATTGCTTGTATCTATTATTATTAATTCCAACA
GAGTATAATGTATATTTATTCTATAAAATATATATTATCAGAGTGCATTTGTTACAACTTAGGTTCTTTTCTTACCAAGTATTAAGAATC
TAGTAAGAGAATACTAGCAAAGGACCTAGCCCTGTGAACAGATTCTCGTATGTTATATACATAAACCCACTCTCAATATTTTTTGAGTTT
TATACTTTTTGATTGATAAACACTGAAGAAATCTAAACTCTACTCACACTGATGTGCTGTCATAGAAGCCTATTTCATATTTTAAAGCTT
AGCAAAACTAAATTATATGTGCATATATATTCAAATATTTGTGTCACACAAAGTTTAGGTCAATTTCCCCAAATATAAACCAGATATTTT
TGGCACTCTCAGATAAACAAGTATTATTTCTCTTATAATTGGGCAGGTGGAAACCAGTGATATCAATATTGTGAATGGCAGATGCTGCTT
CCTCTAGAAAAATAAAATAAAATCACCAACTTTAATATATTCCCATAGGTAAATAGACAATGAGATATCATTTTTCAGAAAATATCATTC
ACTGGAAAATAATCTGTTATAACTACATTTACAGGTCATAATTTTTGGTTTATGGTAAATCTAGGCACCTAAGTCTGATTTTACTTTATG
AAATAAATAGGAAGCAATAATTGTTTGGGCATTTGAATACCTTAAGCACATAAATGAACCTAAGAAAAGAATAATTGCTTAGTTGAAGTA
TTCAAAATAGATCAGTAAACCACAGGCAAATATTTGAATGTTCCCTTTTCTCAAATACAGAAATTGATTCCCCAAGATACAATACAATTT
GACACTTCAGATAATCCCCCAAAATAGAAATGTATGAAGCTCAGTTTAGACTGTCTTCTTGAAAATAAAACAAAACCAATCAAAACTACC
CAGCACATTTTATTATGCCCTGTTGGGTGATAGTATTGTCAATACCAGGTTTTCCCTGCTCTTCACAATGCATCCCTCACCAGAGGAAAA
ACAGCAAGAAAACTAGGACATTTGCTAATTTCAACAATACACCCCTGTGATAACAGATTCCCATCCTTGAATACATATCATTTTTTACTA
GAGAGAACGGGGGTGGTGAGGTGGGGGCAGTTAGGACCCTGTATGTTATGTAAAATAGATTTACAAAAAGGACAAGCATGATAAAAGGGA
ATGAATGGAGACGATGTATTATTCAGTTTGAAAGAGATAGTTCACATTTTTATAAGAAAAATTTAATAAAACATATATTTTAGTTATCAT
TTAACAAAGATATATTAAAGCTATTCAGGCAATGCCACAGGATTCTCATGAAGGGAAATCACTGAACCCTTGTCATGAGAAAATGGTCAT
TTCAACACATTTCAATACATTGTATAAATTTGGAGCTTAAGGTGAGTGAGTATGTTTTCACTTAGTCATAAATGTTTGGTCAAAATTAAA
GTTATCATATGGTTTCACATCAATACAAATATTGTCACAGTGTTACAGAAACAACTATCAAATGGTAAGATAGTTTACATTTGTGTTTTC
TAGAAACCTTTGTATTTATGCTTCATTTGGTTAATGTTAAGTGCTGATAAAGGCATACCAGATTGTTTGTCAAAGTAAAGAAGCAATCCA
TCACACCTAGGACATCTAAGGATGGATTATACGTCAGAGTGGTCTCATATACAAATGACCATTTTCCTTCAGTAAAATCTTGTTGGTTGA
AATGTAAGTCTTTTCCTAAAGTTTTAATCAGAGGTAGCCATCACTAAGACTTAAGCCACCTGTGGTTCTCTTAAGTTTCACTGAAGCCAG
AAGAAGGAAATTACCACAACTTGTATTATACTAATTATCTTCATTATTAACGATCATATTAGAGCCACTGACATGTCCCAAATTATATTA
AAATAAAAACCTGCATTGCTCTGACATGAAGCTCAATTCAATGTAATAAACAAATTAGGTATTAAACGTTATAATTTAAAAAACTTCTAC
GATATCACCAGAAATCCTGGTGAAATTTAATTTTTTCCCTTTTTTAGGTCAGTGGCCGGTGGGATAGATTTTTCTAAACTTTTTCCTGCT
ATGATTTTGAAGGCAAATACATAGAGCACAGTTCAGTAAAAGAGTTTCCAAGCCTTTTCACTGGAGCATTTACATTTTGATTCTGTTGTC
ATTTGAAATAGAACATCTGCAGGGAGATAATGAGCTTAAGTTACAATTGACTTTGGAAAGAATAACAGACTTTTGTGTTTCCTCAATCAT
GTAGTCAATAGGGAATTCTCCAGTTATGTGAACAATCACAGTCTTTTAAGACAATACTTAGATCTAAATGCAAAATCTAGCATGCAGAGG
CTTTTTAAGGATTTTAGACTGTCTCCAAAGAACTTGGCTCGAGATGGATTACACAGATTTACAAATGCAGTTTTCAACTGTGACATCAAA
CTGATCTTATCTCATTTCATGTTACTCAACTGTGCCCGTAGGACCCCAAGAGGTGGAATATTTTGTCTACATTATTTTAAACATCTATAG
ATATGTGTGGATGTGTGAATAATGCCTAAATTTCTCATCTTTTAACTAGTTTGTTTTTATCATACAGACACAGCCTGTTCATAAGACCAG
CTTTAGACAACTTAGAACTCAATGCTCTGAAGATTCAGGGAGGCCAACATAGAAAAAGATCTTCCAAAATATGGGGTGGTCCAACCCATC
TCATCCCTCTCTAGCTGGAAAACTATAGAGAAAGGGCTGTGACTGCCTTGACCACTGCCTGGCACAATGTAGGCACTCGGTATTTGTTGG
ATGAATAAGTGGCTGAATCAGTGAATAGACAAAAAACATGGATTTTGCCTTCTGAAAATCTCACAAATTTTACCAGCTTATATTATACTG
ATTGTCACTATGATTTCTAAGTTTCATGGTTAGAACCATATTTTGAGTCTATATAAAAACTTTTTAGATGTATGAATTTGAAATTTCATT
AATTACTTTAAAGGCTTCAAAGATTTGAGGACATTTGAACAGTGGATAAGGAACAATGTTTGGGGATACAGAGTTTTTATGCTGAGTTGA
ACTCAACCTTTCTAGTTCTTTATACAAGCTTCCTGAATTATCTGGCAGGAATGATTCAAACATAAAACCCCATTTTTAAATTTTATAAAA
GATATTTTCATTTTTATATAAAAAGATCATCAGGCATATTATCCCCTTTGATATTTATTAACAACCATTCTCTAAGAAATTCATAATAAT
TGGAGACACCATCCCTAAATCTCTTCCTATTTTCAAAAGATCATTTATCCTTTCATATTTGATTCCTGGAATACACTAAGCTGAAGTTTA
ATCACATACTTACTCAGATGTTTCCATGTGTTTATTCATTTAACAAATACTTATTGTGTACCTAGTGCATGCTAGGTTCTGGAAATGCAA
CAGCAAACAAGACAGACACAATCCCTCTTGGAGGTTACTGTGAGAAACTCTCCAACATTTACTCTAGCAATAACTAGAGAGTTTACTGTC
CATTGGGTCCTCTTCACACCTGATAGAAAAAATAAAATTCCTCACCCCATGGAAGTCATGAAATACTCCCTGCACAGATTTGTGTGAGCT
TGCTTTTCTAAAACCACTGCTCAAAAATGCTGCTTAGTTTATCTATAAACCACGGTTATACCCCAGTGAGGTAGGTAAGTAATTTATTCA
TAACTAACATTTATGCAGCTCTATTTTCTAGCCACTGTGCTGAGTGCTTTTATGGACTATCTCACCAAATCCCTTCAACAACTCTATTCA
GTAGGTTCCATTTTATAGATACAAAAACTGAAGCACAGATATATTATGTGACTTGTCCAAGGTCACACAGCTAGCAGGTGGAACTGGGAT
TTGAACCCATGCAATCTGACACAAGAGTTCATGTGTCTAATCATTATCTGTGGTTTGGGGGACACCATTACATTAAAATGAATGAGTCAC
TAAGTGAGTCACTGTATATAAAATACTTGGAAATTGTAAAGTAATATACAAAAGATATTAACAAAGTATTATTCATGGTAAACAAATCAC
ATCAGTAGCAAACACAGGGTGGGAACTCAATCTTATGTTATAGCTTACTCTTAAGAAGAATATGTGAAGCCAGGAACATGGTTAAAGGTA
CAGACCAGAAAATTTCTGACATGTGATAAATATTTCAGTGACTTTTCAGATTTATTTCTTGTTAGCCGCTGTGTCTATTTGGTGCTACAA
AAACTGAAAGAAACAAAATCCCTGATGTAAGGGCTTATAATAAATACACAGTTTGGAGATGAACTAAGGATATTTTACATTTACGGGAAA
GGATTGGACAATAGTATCATTTTCTCACCATTTGCATGTACATCATGTCTTTCCAATTGTTTTCATTATTTTTCTGAAAGAGCTGCAAAA

>In-frame_ALDH2_ENST00000261733_chr12_112204900_+_LIN7A_ENST00000552864_chr12_81242101_-_5883nt
TCAGTGGCCCTGAGACCCTAGCTCTGCTCTCGGTCCGCTCGCTGTCCGCTAGCCCGCTGCGATGTTGCGCGCTGCCGCCCGCTTCGGGCC
CCGCCTGGGCCGCCGCCTCTTGTCAGCCGCCGCCACCCAGGCCGTGCCTGCCCCCAACCAGCAGCCCGAGGTCTTCTGCAACCAGGTGTA
TCAATATATGCATGAAACGATAACTGTTAATGGCTGTCCCGAATTCCGTGCGAGGGCAACAGCAAAGGCAACAGTTGCAGCTTTTGCAGC
TAGTGAAGGCCACTCCCACCCTCGAGTAGTTGAACTGCCAAAGACTGATGAAGGCCTTGGTTTTAATGTGATGGGAGGAAAGGAGCAAAA
TTCCCCCATTTATATCTCTCGCATAATTCCTGGAGGGGTGGCTGAAAGACACGGAGGCCTCAAAAGAGGAGACCAGCTGCTATCAGTGAA
CGGAGTGAGTGTGGAAGGAGAACACCATGAGAAAGCTGTGGAACTACTCAAGGCTGCTAAAGACAGCGTCAAGCTGGTGGTGCGATACAC
CCCAAAAGTTCTGGAAGAAATGGAGGCTCGCTTTGAAAAGCTACGAACAGCCAGGCGTCGGCAGCAGCAGCAATTGCTAATTCAGCAGCA
GCAACAGCAGCAGCAGCAACAAACACAACAAAACCACATGTCATAGGCCCTTGAGGGAAAGCTACTTGATCAAACATCCGATAGTCACAA
ATTTGAAACCGTGCTTCAGAATCCCAGCACATAGTAAAAGACAACACTGATAATTATACCTGTCAAGAAGCTGTGAACACATGGTGTATA
AATTCTTTACCAAGGCAACTCAACACCTTCTTTCTCTGGGCTTGAACCGCCACTGCTCACGTGGGCTTTACATACATTGACCTTCCATTC
ACTGCAGTGGGAATTCTCAGTGTGCAGAGGGAGAGGTTTTCTAGTCTGCAAACTGAAACAGTGTAAGAAGAATAAAGTCTATGACTTTTA
AATAAATCACCAGGGCCAAGATTGAGTGAATCTTGGGTCCATAGCTTTTCCAGATATTAGCAAACCCCTCATTAGGCTATAATTCAAACT
GCATCAGTTCAAAGTGAAACCTACACATTGCTCCTTACCCTCACCTGCTCCACAATCCATAGTGCTGAGTTGTCTGAATTGGAATTCCAG
TTAATTGCAAGTTCAACCTGTTTTCCTCTTGAAAATCGCAAGGTATCATACTATATTTATATTTTCTTCAGGTTCTAGAAGCAATCGGCT
TTTTCTTTTGTTTCCATGAATTTTATTATGCATTAATAGAATGGACCAATTTTAGCTCAACTTTTAGTTTGTTAGAAGCAAGTGTAGGAA
CTCTAGCACTGTAGTTTTTAATTATTGCTTGTATCTATTATTATTAATTCCAACAGAGTATAATGTATATTTATTCTATAAAATATATAT
TATCAGAGTGCATTTGTTACAACTTAGGTTCTTTTCTTACCAAGTATTAAGAATCTAGTAAGAGAATACTAGCAAAGGACCTAGCCCTGT
GAACAGATTCTCGTATGTTATATACATAAACCCACTCTCAATATTTTTTGAGTTTTATACTTTTTGATTGATAAACACTGAAGAAATCTA
AACTCTACTCACACTGATGTGCTGTCATAGAAGCCTATTTCATATTTTAAAGCTTAGCAAAACTAAATTATATGTGCATATATATTCAAA
TATTTGTGTCACACAAAGTTTAGGTCAATTTCCCCAAATATAAACCAGATATTTTTGGCACTCTCAGATAAACAAGTATTATTTCTCTTA
TAATTGGGCAGGTGGAAACCAGTGATATCAATATTGTGAATGGCAGATGCTGCTTCCTCTAGAAAAATAAAATAAAATCACCAACTTTAA
TATATTCCCATAGGTAAATAGACAATGAGATATCATTTTTCAGAAAATATCATTCACTGGAAAATAATCTGTTATAACTACATTTACAGG
TCATAATTTTTGGTTTATGGTAAATCTAGGCACCTAAGTCTGATTTTACTTTATGAAATAAATAGGAAGCAATAATTGTTTGGGCATTTG
AATACCTTAAGCACATAAATGAACCTAAGAAAAGAATAATTGCTTAGTTGAAGTATTCAAAATAGATCAGTAAACCACAGGCAAATATTT
GAATGTTCCCTTTTCTCAAATACAGAAATTGATTCCCCAAGATACAATACAATTTGACACTTCAGATAATCCCCCAAAATAGAAATGTAT
GAAGCTCAGTTTAGACTGTCTTCTTGAAAATAAAACAAAACCAATCAAAACTACCCAGCACATTTTATTATGCCCTGTTGGGTGATAGTA
TTGTCAATACCAGGTTTTCCCTGCTCTTCACAATGCATCCCTCACCAGAGGAAAAACAGCAAGAAAACTAGGACATTTGCTAATTTCAAC
AATACACCCCTGTGATAACAGATTCCCATCCTTGAATACATATCATTTTTTACTAGAGAGAACGGGGGTGGTGAGGTGGGGGCAGTTAGG
ACCCTGTATGTTATGTAAAATAGATTTACAAAAAGGACAAGCATGATAAAAGGGAATGAATGGAGACGATGTATTATTCAGTTTGAAAGA
GATAGTTCACATTTTTATAAGAAAAATTTAATAAAACATATATTTTAGTTATCATTTAACAAAGATATATTAAAGCTATTCAGGCAATGC
CACAGGATTCTCATGAAGGGAAATCACTGAACCCTTGTCATGAGAAAATGGTCATTTCAACACATTTCAATACATTGTATAAATTTGGAG
CTTAAGGTGAGTGAGTATGTTTTCACTTAGTCATAAATGTTTGGTCAAAATTAAAGTTATCATATGGTTTCACATCAATACAAATATTGT
CACAGTGTTACAGAAACAACTATCAAATGGTAAGATAGTTTACATTTGTGTTTTCTAGAAACCTTTGTATTTATGCTTCATTTGGTTAAT
GTTAAGTGCTGATAAAGGCATACCAGATTGTTTGTCAAAGTAAAGAAGCAATCCATCACACCTAGGACATCTAAGGATGGATTATACGTC
AGAGTGGTCTCATATACAAATGACCATTTTCCTTCAGTAAAATCTTGTTGGTTGAAATGTAAGTCTTTTCCTAAAGTTTTAATCAGAGGT
AGCCATCACTAAGACTTAAGCCACCTGTGGTTCTCTTAAGTTTCACTGAAGCCAGAAGAAGGAAATTACCACAACTTGTATTATACTAAT
TATCTTCATTATTAACGATCATATTAGAGCCACTGACATGTCCCAAATTATATTAAAATAAAAACCTGCATTGCTCTGACATGAAGCTCA
ATTCAATGTAATAAACAAATTAGGTATTAAACGTTATAATTTAAAAAACTTCTACGATATCACCAGAAATCCTGGTGAAATTTAATTTTT
TCCCTTTTTTAGGTCAGTGGCCGGTGGGATAGATTTTTCTAAACTTTTTCCTGCTATGATTTTGAAGGCAAATACATAGAGCACAGTTCA
GTAAAAGAGTTTCCAAGCCTTTTCACTGGAGCATTTACATTTTGATTCTGTTGTCATTTGAAATAGAACATCTGCAGGGAGATAATGAGC
TTAAGTTACAATTGACTTTGGAAAGAATAACAGACTTTTGTGTTTCCTCAATCATGTAGTCAATAGGGAATTCTCCAGTTATGTGAACAA
TCACAGTCTTTTAAGACAATACTTAGATCTAAATGCAAAATCTAGCATGCAGAGGCTTTTTAAGGATTTTAGACTGTCTCCAAAGAACTT
GGCTCGAGATGGATTACACAGATTTACAAATGCAGTTTTCAACTGTGACATCAAACTGATCTTATCTCATTTCATGTTACTCAACTGTGC
CCGTAGGACCCCAAGAGGTGGAATATTTTGTCTACATTATTTTAAACATCTATAGATATGTGTGGATGTGTGAATAATGCCTAAATTTCT
CATCTTTTAACTAGTTTGTTTTTATCATACAGACACAGCCTGTTCATAAGACCAGCTTTAGACAACTTAGAACTCAATGCTCTGAAGATT
CAGGGAGGCCAACATAGAAAAAGATCTTCCAAAATATGGGGTGGTCCAACCCATCTCATCCCTCTCTAGCTGGAAAACTATAGAGAAAGG
GCTGTGACTGCCTTGACCACTGCCTGGCACAATGTAGGCACTCGGTATTTGTTGGATGAATAAGTGGCTGAATCAGTGAATAGACAAAAA
ACATGGATTTTGCCTTCTGAAAATCTCACAAATTTTACCAGCTTATATTATACTGATTGTCACTATGATTTCTAAGTTTCATGGTTAGAA
CCATATTTTGAGTCTATATAAAAACTTTTTAGATGTATGAATTTGAAATTTCATTAATTACTTTAAAGGCTTCAAAGATTTGAGGACATT
TGAACAGTGGATAAGGAACAATGTTTGGGGATACAGAGTTTTTATGCTGAGTTGAACTCAACCTTTCTAGTTCTTTATACAAGCTTCCTG
AATTATCTGGCAGGAATGATTCAAACATAAAACCCCATTTTTAAATTTTATAAAAGATATTTTCATTTTTATATAAAAAGATCATCAGGC
ATATTATCCCCTTTGATATTTATTAACAACCATTCTCTAAGAAATTCATAATAATTGGAGACACCATCCCTAAATCTCTTCCTATTTTCA
AAAGATCATTTATCCTTTCATATTTGATTCCTGGAATACACTAAGCTGAAGTTTAATCACATACTTACTCAGATGTTTCCATGTGTTTAT
TCATTTAACAAATACTTATTGTGTACCTAGTGCATGCTAGGTTCTGGAAATGCAACAGCAAACAAGACAGACACAATCCCTCTTGGAGGT
TACTGTGAGAAACTCTCCAACATTTACTCTAGCAATAACTAGAGAGTTTACTGTCCATTGGGTCCTCTTCACACCTGATAGAAAAAATAA
AATTCCTCACCCCATGGAAGTCATGAAATACTCCCTGCACAGATTTGTGTGAGCTTGCTTTTCTAAAACCACTGCTCAAAAATGCTGCTT
AGTTTATCTATAAACCACGGTTATACCCCAGTGAGGTAGGTAAGTAATTTATTCATAACTAACATTTATGCAGCTCTATTTTCTAGCCAC
TGTGCTGAGTGCTTTTATGGACTATCTCACCAAATCCCTTCAACAACTCTATTCAGTAGGTTCCATTTTATAGATACAAAAACTGAAGCA
CAGATATATTATGTGACTTGTCCAAGGTCACACAGCTAGCAGGTGGAACTGGGATTTGAACCCATGCAATCTGACACAAGAGTTCATGTG
TCTAATCATTATCTGTGGTTTGGGGGACACCATTACATTAAAATGAATGAGTCACTAAGTGAGTCACTGTATATAAAATACTTGGAAATT
GTAAAGTAATATACAAAAGATATTAACAAAGTATTATTCATGGTAAACAAATCACATCAGTAGCAAACACAGGGTGGGAACTCAATCTTA
TGTTATAGCTTACTCTTAAGAAGAATATGTGAAGCCAGGAACATGGTTAAAGGTACAGACCAGAAAATTTCTGACATGTGATAAATATTT
CAGTGACTTTTCAGATTTATTTCTTGTTAGCCGCTGTGTCTATTTGGTGCTACAAAAACTGAAAGAAACAAAATCCCTGATGTAAGGGCT
TATAATAAATACACAGTTTGGAGATGAACTAAGGATATTTTACATTTACGGGAAAGGATTGGACAATAGTATCATTTTCTCACCATTTGC
ATGTACATCATGTCTTTCCAATTGTTTTCATTATTTTTCTGAAAGAGCTGCAAAATTGTGCAGTGGTTCAACCTGACCAAAGTGGTATTA


Top

FusionGenePPI for ALDH2_LIN7A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ALDH2UNC119, SLC35F6, IGSF21, CRMP1, C14orf1, EIF6, HSPE1, HSPD1, UBA5, ICT1, CUL3, APP, ALDH1A1, RPL13A, SERPINB5, IGKC, ALDH1A2, ALDH6A1, FGB, SERPINA1, TF, FGG, IGHG1, IGHG3, IGHG4, APOA1, FGA, CALML5, BTRC, LDHA, LDHAL6A, LDHB, RPE, SOD2, ESD, PDCD6IP, PGM1, UQCRC2, NTRK1, HSPB2, IGHA1, RPL11, ARID1A, XRCC3, ATAD5, APC, PHB2, RAD23B, SIRT3LIN7AKCNJ12, KCNJ4, DLG1, CASK, MPP6, DLG4, GRIN2B, AMOT, APP, MPP5, BAI1, GOLGA2, MPP2, MPP3, ZYX, FAM9B, NOTCH2NL, FAM188A, CADM1, EPB41L2, GUCY1A2, GUCY1B3, INADL, MPDZ, MPP7, PIP4K2B, PXDC1, SLC20A1, SNTB2, CDA, NSUN2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ALDH2_LIN7A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneALDH2P05091DB00822DisulfiramAldehyde dehydrogenase, mitochondrialsmall moleculeapproved

Top

RelatedDiseases for ALDH2_LIN7A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneALDH2C0001973Alcoholic Intoxication, Chronic7CTD_human;PSYGENET
HgeneALDH2C0001969Alcoholic Intoxication5PSYGENET
HgeneALDH2C0085762Alcohol abuse5PSYGENET
HgeneALDH2C0393756Hangover from alcohol4PSYGENET
HgeneALDH2C0236664Alcohol-Related Disorders3PSYGENET
HgeneALDH2C0004096Asthma2CTD_human
HgeneALDH2C0005586Bipolar Disorder2PSYGENET
HgeneALDH2C0279626Squamous cell carcinoma of esophagus2CTD_human
HgeneALDH2C0009404Colorectal Neoplasms1CTD_human
HgeneALDH2C0014859Esophageal Neoplasms1CTD_human
HgeneALDH2C0016382Flushing1CTD_human
HgeneALDH2C0021364Male infertility1CTD_human
HgeneALDH2C0023893Liver Cirrhosis, Experimental1CTD_human
HgeneALDH2C0028796Dermatitis, Occupational1CTD_human
HgeneALDH2C0032927Precancerous Conditions1CTD_human
HgeneALDH2C0042373Vascular Diseases1CTD_human
HgeneALDH2C0242973Ventricular Dysfunction1CTD_human
HgeneALDH2C0342257Complications of Diabetes Mellitus1CTD_human
HgeneALDH2C0349464Wernicke-Korsakoff Syndrome1PSYGENET
HgeneALDH2C0520459Necrotizing Enterocolitis1CTD_human
HgeneALDH2C2674838ALCOHOL SENSITIVITY, ACUTE1CTD_human
TgeneLIN7AC0023893Liver Cirrhosis, Experimental1CTD_human
TgeneLIN7AC0024667Animal Mammary Neoplasms1CTD_human
TgeneLIN7AC0024668Mammary Neoplasms, Experimental1CTD_human