FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14313

FusionGeneSummary for GALNT18_PPP1R1B

check button Fusion gene summary
Fusion gene informationFusion gene name: GALNT18_PPP1R1B
Fusion gene ID: 14313
HgeneTgene
Gene symbol

GALNT18

PPP1R1B

Gene ID

374378

84152

Gene namepolypeptide N-acetylgalactosaminyltransferase 18protein phosphatase 1 regulatory inhibitor subunit 1B
SynonymsGALNACT18|GALNT15|GALNTL4|GalNAc-T15|GalNAc-T18DARPP-32|DARPP32
Cytomap

11p15.4

17q12

Type of geneprotein-codingprotein-coding
Descriptionpolypeptide N-acetylgalactosaminyltransferase 18GalNAc-transferase 18UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 4UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 15UDP-N-acetyl-alpha-D-galactoprotein phosphatase 1 regulatory subunit 1Bdopamine and cAMP-regulated neuronal phosphoprotein 32
Modification date2018052320180527
UniProtAcc

Q6P9A2

Q9UD71

Ensembl transtripts involved in fusion geneENST00000227756, ENST00000526064, 
ENST00000580825, ENST00000254079, 
ENST00000579000, ENST00000394265, 
ENST00000394267, 
Fusion gene scores* DoF score9 X 4 X 7=25210 X 5 X 11=550
# samples 919
** MAII scorelog2(9/252*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(19/550*10)=-1.53343220008107
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: GALNT18 [Title/Abstract] AND PPP1R1B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneGALNT18

GO:0006493

protein O-linked glycosylation

22186971

TgenePPP1R1B

GO:0032515

negative regulation of phosphoprotein phosphatase activity

10807923


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-C8-A12Q-01AGALNT18chr11

11642906

-PPP1R1Bchr17

37785423

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000227756ENST00000580825GALNT18chr11

11642906

-PPP1R1Bchr17

37785423

+
In-frameENST00000227756ENST00000254079GALNT18chr11

11642906

-PPP1R1Bchr17

37785423

+
In-frameENST00000227756ENST00000579000GALNT18chr11

11642906

-PPP1R1Bchr17

37785423

+
5CDS-5UTRENST00000227756ENST00000394265GALNT18chr11

11642906

-PPP1R1Bchr17

37785423

+
5CDS-5UTRENST00000227756ENST00000394267GALNT18chr11

11642906

-PPP1R1Bchr17

37785423

+
5UTR-3CDSENST00000526064ENST00000580825GALNT18chr11

11642906

-PPP1R1Bchr17

37785423

+
5UTR-3CDSENST00000526064ENST00000254079GALNT18chr11

11642906

-PPP1R1Bchr17

37785423

+
5UTR-3CDSENST00000526064ENST00000579000GALNT18chr11

11642906

-PPP1R1Bchr17

37785423

+
5UTR-5UTRENST00000526064ENST00000394265GALNT18chr11

11642906

-PPP1R1Bchr17

37785423

+
5UTR-5UTRENST00000526064ENST00000394267GALNT18chr11

11642906

-PPP1R1Bchr17

37785423

+

Top

FusionProtFeatures for GALNT18_PPP1R1B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GALNT18

Q6P9A2

PPP1R1B

Q9UD71

Catalyzes the initial reaction in O-linkedoligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on theprotein receptor. {ECO:0000269|PubMed:22186971}. Inhibitor of protein-phosphatase 1.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGALNT18chr11:11642906chr17:37785423ENST00000227756-1111_1278608Topological domainCytoplasmic
HgeneGALNT18chr11:11642906chr17:37785423ENST00000227756-11113_3578608TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgenePPP1R1Bchr11:11642906chr17:37785423ENST00000254079+07119_13627205Compositional biasNote=Asp/Glu-rich (acidic)
TgenePPP1R1Bchr11:11642906chr17:37785423ENST00000394265+07119_136-9169Compositional biasNote=Asp/Glu-rich (acidic)
TgenePPP1R1Bchr11:11642906chr17:37785423ENST00000394267+07119_136-9169Compositional biasNote=Asp/Glu-rich (acidic)
TgenePPP1R1Bchr11:11642906chr17:37785423ENST00000580825+18119_13627205Compositional biasNote=Asp/Glu-rich (acidic)

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGALNT18chr11:11642906chr17:37785423ENST00000227756-111469_59978608DomainRicin B-type lectin
HgeneGALNT18chr11:11642906chr17:37785423ENST00000227756-111153_26778608RegionNote=Catalytic subdomain A
HgeneGALNT18chr11:11642906chr17:37785423ENST00000227756-111324_38578608RegionNote=Catalytic subdomain B
HgeneGALNT18chr11:11642906chr17:37785423ENST00000227756-11136_60778608Topological domainLumenal


Top

FusionGeneSequence for GALNT18_PPP1R1B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GALNT18_ENST00000227756_chr11_11642906_-_PPP1R1B_ENST00000580825_chr17_37785423_+_256aa
MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVTVRGQEPAPDKKLEEDKGDTLKIIERLDHLENVIKQHIQDPAQETNACHAV
PALRALLTRGGSLPPPESLRRGAPSQVEETQPLCLHTTFAESCAAHC_VSPAVTQQFE_EPGLRGGG_AGGASGAGLSKRGR_GGRGG__

>In-frame_GALNT18_ENST00000227756_chr11_11642906_-_PPP1R1B_ENST00000254079_chr17_37785423_+_256aa
MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVTVRGQEPAPDKKLEEDKGDTLKIIERLDHLENVIKQHIQDPAQETNACHAV
PALRALLTRGGSLPPPESLRRGAPSQVEETQPLCLHTTFAESCAAHC_VSPAVTQQFE_EPGLRGGG_AGGASGAGLSKRGR_GGRGG__

>In-frame_GALNT18_ENST00000227756_chr11_11642906_-_PPP1R1B_ENST00000579000_chr17_37785423_+_223aa
MVCTRKTKTLVSTCVILSGMTNIICLLYVGWVTNYIASVTVRGQEPAPDKKLEEDKGDTLKIIERLDHLENVIKQHIQDPAQETNACHAV
PALRALLTSCAAHC_VSPAVTQQFE_EPGLRGGG_AGGASGAGLSKRGR_GGRGG__RRGRRRGQPG_SPEGHQAVCWAKDNLWPGSGRA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GALNT18_ENST00000227756_chr11_11642906_-_PPP1R1B_ENST00000580825_chr17_37785423_+_769nt
ATGGTGTGCACCAGGAAGACCAAAACTTTGGTGTCCACTTGCGTGATCCTGAGCGGCATGACTAACATCATCTGCCTGCTCTACGTGGGC
TGGGTCACCAACTACATCGCCAGCGTGTATGTGCGGGGGCAGGAGCCGGCGCCCGACAAGAAGCTGGAGGAAGACAAAGGGGACACTCTG
AAGATTATTGAGCGGCTGGACCACCTGGAGAATGTCATCAAGCAGCACATTCAAGATCCGGCGCAGGAGACCAACGCCTGCCATGCTGTT
CCGGCTCTCAGAGCACTCCTCACCAGAGGAGGAAGCCTCCCCCCACCAGAGAGCCTCAGGAGAGGGGCACCATCTCAAGTCGAAGAGACC
CAACCCCTGTGCCTACACACCACCTTCGCTGAAAGCTGTGCAGCGCATTGCTGAGTCTCACCTGCAGTCTATCAGCAATTTGAATGAGAA
CCAGGCCTCAGAGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAGGAAGATGAGGAGGAAGAGGAGGATGATGA
AGAAGAGGAAGAAGAAGAGGACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCTGGGCAAAAGACAACCTGTGGCCAGGGTCT
GGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGA

>In-frame_GALNT18_ENST00000227756_chr11_11642906_-_PPP1R1B_ENST00000254079_chr17_37785423_+_769nt
ATGGTGTGCACCAGGAAGACCAAAACTTTGGTGTCCACTTGCGTGATCCTGAGCGGCATGACTAACATCATCTGCCTGCTCTACGTGGGC
TGGGTCACCAACTACATCGCCAGCGTGTATGTGCGGGGGCAGGAGCCGGCGCCCGACAAGAAGCTGGAGGAAGACAAAGGGGACACTCTG
AAGATTATTGAGCGGCTGGACCACCTGGAGAATGTCATCAAGCAGCACATTCAAGATCCGGCGCAGGAGACCAACGCCTGCCATGCTGTT
CCGGCTCTCAGAGCACTCCTCACCAGAGGAGGAAGCCTCCCCCCACCAGAGAGCCTCAGGAGAGGGGCACCATCTCAAGTCGAAGAGACC
CAACCCCTGTGCCTACACACCACCTTCGCTGAAAGCTGTGCAGCGCATTGCTGAGTCTCACCTGCAGTCTATCAGCAATTTGAATGAGAA
CCAGGCCTCAGAGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAGGAAGATGAGGAGGAAGAGGAGGATGATGA
AGAAGAGGAAGAAGAAGAGGACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCTGGGCAAAAGACAACCTGTGGCCAGGGTCT
GGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGA

>In-frame_GALNT18_ENST00000227756_chr11_11642906_-_PPP1R1B_ENST00000579000_chr17_37785423_+_670nt
ATGGTGTGCACCAGGAAGACCAAAACTTTGGTGTCCACTTGCGTGATCCTGAGCGGCATGACTAACATCATCTGCCTGCTCTACGTGGGC
TGGGTCACCAACTACATCGCCAGCGTGTATGTGCGGGGGCAGGAGCCGGCGCCCGACAAGAAGCTGGAGGAAGACAAAGGGGACACTCTG
AAGATTATTGAGCGGCTGGACCACCTGGAGAATGTCATCAAGCAGCACATTCAAGATCCGGCGCAGGAGACCAACGCCTGCCATGCTGTT
CCGGCTCTCAGAGCACTCCTCACCAGCTGTGCAGCGCATTGCTGAGTCTCACCTGCAGTCTATCAGCAATTTGAATGAGAACCAGGCCTC
AGAGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGGGTTATCCAAGAGAGGAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGAGGA
AGAAGAAGAGGACAGCCAGGCTGAAGTCCTGAAGGTCATCAGGCAGTCTGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGGGCC
CTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCCTGGGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_GALNT18_ENST00000227756_chr11_11642906_-_PPP1R1B_ENST00000580825_chr17_37785423_+_1316nt
GCTGTTCTCCTAGCAGCGCGGGCCGGTCGGACCGCCAAGGCAGCCGGCGCTGGCGATGGGAAGCGGCGTGGCCGCCGACACAGGCAGTGG
CAAAGTTTCCCAGACGTACACATCTGGACGCGCGGCTGCCGGCTACCCGTGACCCCTCTAGGAAGGGTTCAGGGATTTTTAATTTGGAAA
AAAATCCACCTGGTTTCCTTTGTCAAGGTCTCTCCGGGTGGCCAGCGGCAGGAGCTGCAAACTTGGGCACGGCGGCTACACCGGCAGCGG
ACCGGGCTTTGGAGAACCTCGGGACTCAGGTGCTGAGGTGCCCAGCGGCTCCGGACGTGCTACGGGGTGCGAGCGCGGGGGAGTTCGGGG
CGCACGACAAGGAAGGGCCCCCGGGAGCTCTATATGGAGGAAGGAGCCCAGAATGGTGTGCACCAGGAAGACCAAAACTTTGGTGTCCAC
TTGCGTGATCCTGAGCGGCATGACTAACATCATCTGCCTGCTCTACGTGGGCTGGGTCACCAACTACATCGCCAGCGTGTATGTGCGGGG
GCAGGAGCCGGCGCCCGACAAGAAGCTGGAGGAAGACAAAGGGGACACTCTGAAGATTATTGAGCGGCTGGACCACCTGGAGAATGTCAT
CAAGCAGCACATTCAAGATCCGGCGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCTCTCAGAGCACTCCTCACCAGAGGAGGAAGCCT
CCCCCCACCAGAGAGCCTCAGGAGAGGGGCACCATCTCAAGTCGAAGAGACCCAACCCCTGTGCCTACACACCACCTTCGCTGAAAGCTG
TGCAGCGCATTGCTGAGTCTCACCTGCAGTCTATCAGCAATTTGAATGAGAACCAGGCCTCAGAGGAGGAGGATGAGCTGGGGGAGCTTC
GGGAGCTGGGTTATCCAAGAGAGGAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGAGGAAGAAGAAGAGGACAGCCAGGCTGAAGTCC
TGAAGGTCATCAGGCAGTCTGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGT
CCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCCTGGGGAGGAACCTCAGCGCCCTTCCCCCTCTGAGC
CTGGCACATAGGCACCCAGCCTGCATCTCCCAGGAGGAAGTGGAGGGGACATCGCTGTTCCCCAGAAACCCACTCTATCCTCACCCTGTT

>In-frame_GALNT18_ENST00000227756_chr11_11642906_-_PPP1R1B_ENST00000254079_chr17_37785423_+_1942nt
GCTGTTCTCCTAGCAGCGCGGGCCGGTCGGACCGCCAAGGCAGCCGGCGCTGGCGATGGGAAGCGGCGTGGCCGCCGACACAGGCAGTGG
CAAAGTTTCCCAGACGTACACATCTGGACGCGCGGCTGCCGGCTACCCGTGACCCCTCTAGGAAGGGTTCAGGGATTTTTAATTTGGAAA
AAAATCCACCTGGTTTCCTTTGTCAAGGTCTCTCCGGGTGGCCAGCGGCAGGAGCTGCAAACTTGGGCACGGCGGCTACACCGGCAGCGG
ACCGGGCTTTGGAGAACCTCGGGACTCAGGTGCTGAGGTGCCCAGCGGCTCCGGACGTGCTACGGGGTGCGAGCGCGGGGGAGTTCGGGG
CGCACGACAAGGAAGGGCCCCCGGGAGCTCTATATGGAGGAAGGAGCCCAGAATGGTGTGCACCAGGAAGACCAAAACTTTGGTGTCCAC
TTGCGTGATCCTGAGCGGCATGACTAACATCATCTGCCTGCTCTACGTGGGCTGGGTCACCAACTACATCGCCAGCGTGTATGTGCGGGG
GCAGGAGCCGGCGCCCGACAAGAAGCTGGAGGAAGACAAAGGGGACACTCTGAAGATTATTGAGCGGCTGGACCACCTGGAGAATGTCAT
CAAGCAGCACATTCAAGATCCGGCGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCTCTCAGAGCACTCCTCACCAGAGGAGGAAGCCT
CCCCCCACCAGAGAGCCTCAGGAGAGGGGCACCATCTCAAGTCGAAGAGACCCAACCCCTGTGCCTACACACCACCTTCGCTGAAAGCTG
TGCAGCGCATTGCTGAGTCTCACCTGCAGTCTATCAGCAATTTGAATGAGAACCAGGCCTCAGAGGAGGAGGATGAGCTGGGGGAGCTTC
GGGAGCTGGGTTATCCAAGAGAGGAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGAGGAAGAAGAAGAGGACAGCCAGGCTGAAGTCC
TGAAGGTCATCAGGCAGTCTGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGT
CCGAGAGAGATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCCTGGGGAGGAACCTCAGCGCCCTTCCCCCTCTGAGC
CTGGCACATAGGCACCCAGCCTGCATCTCCCAGGAGGAAGTGGAGGGGACATCGCTGTTCCCCAGAAACCCACTCTATCCTCACCCTGTT
TTGTGCTCTTCCCCTCGCCTGCTAGGGCTGCGGCTTCTGACTTCTAGAAGACTAAGGCTGGTCTGTGTTTGCTTGTTTGCCCACCTTTGG
CTGATACCCAGAGAACCTGGGCACTTGCTGCCTGATGCCCACCCCTGCCAGTCATTCCTCCATTCACCCAGCGGGAGGTGGGATGTGAGA
CAGCCCACATTGGAAAATCCAGAAAACCGGGAACAGGGATTTGCCCTTCACAATTCTACTCCCCAGATCCTCTCCCCTGGACACAGGAGA
CCCACAGGGCAGGACCCTAAGATCTGGGGAAAGGAGGTCCTGAGAACCTTGAGGTACCCTTAGATCCTTTTCTACCCACTTTCCTATGGA
GGATTCCAAGTCACCACTTCTCTCACCGGCTTCTACCAGGGTCCAGGACTAAGGCGTTTTTCTCCATAGCCTCAACATTTTGGGAATCTT
CCCTTAATCACCCTTGCTCCTCCTGGGTGCCTGGAAGATGGACTGGCAGAGACCTCTTTGTTGCGTTTTGTGCTTTGATGCCAGGAATGC
CGCCTAGTTTATGTCCCCGGTGGGGCACACAGCGGGGGGCGCCAGGTTTTCCTTGTCCCCCAGCTGCTCTGCCCCTTTCCCCTTCTTCCC

>In-frame_GALNT18_ENST00000227756_chr11_11642906_-_PPP1R1B_ENST00000579000_chr17_37785423_+_1839nt
GCTGTTCTCCTAGCAGCGCGGGCCGGTCGGACCGCCAAGGCAGCCGGCGCTGGCGATGGGAAGCGGCGTGGCCGCCGACACAGGCAGTGG
CAAAGTTTCCCAGACGTACACATCTGGACGCGCGGCTGCCGGCTACCCGTGACCCCTCTAGGAAGGGTTCAGGGATTTTTAATTTGGAAA
AAAATCCACCTGGTTTCCTTTGTCAAGGTCTCTCCGGGTGGCCAGCGGCAGGAGCTGCAAACTTGGGCACGGCGGCTACACCGGCAGCGG
ACCGGGCTTTGGAGAACCTCGGGACTCAGGTGCTGAGGTGCCCAGCGGCTCCGGACGTGCTACGGGGTGCGAGCGCGGGGGAGTTCGGGG
CGCACGACAAGGAAGGGCCCCCGGGAGCTCTATATGGAGGAAGGAGCCCAGAATGGTGTGCACCAGGAAGACCAAAACTTTGGTGTCCAC
TTGCGTGATCCTGAGCGGCATGACTAACATCATCTGCCTGCTCTACGTGGGCTGGGTCACCAACTACATCGCCAGCGTGTATGTGCGGGG
GCAGGAGCCGGCGCCCGACAAGAAGCTGGAGGAAGACAAAGGGGACACTCTGAAGATTATTGAGCGGCTGGACCACCTGGAGAATGTCAT
CAAGCAGCACATTCAAGATCCGGCGCAGGAGACCAACGCCTGCCATGCTGTTCCGGCTCTCAGAGCACTCCTCACCAGCTGTGCAGCGCA
TTGCTGAGTCTCACCTGCAGTCTATCAGCAATTTGAATGAGAACCAGGCCTCAGAGGAGGAGGATGAGCTGGGGGAGCTTCGGGAGCTGG
GTTATCCAAGAGAGGAAGATGAGGAGGAAGAGGAGGATGATGAAGAAGAGGAAGAAGAAGAGGACAGCCAGGCTGAAGTCCTGAAGGTCA
TCAGGCAGTCTGCTGGGCAAAAGACAACCTGTGGCCAGGGTCTGGAAGGGCCCTGGGAGCGCCCACCCCCTCTGGATGAGTCCGAGAGAG
ATGGAGGCTCTGAGGACCAAGTGGAAGACCCAGCACTAAGTGAGCCTGGGGAGGAACCTCAGCGCCCTTCCCCCTCTGAGCCTGGCACAT
AGGCACCCAGCCTGCATCTCCCAGGAGGAAGTGGAGGGGACATCGCTGTTCCCCAGAAACCCACTCTATCCTCACCCTGTTTTGTGCTCT
TCCCCTCGCCTGCTAGGGCTGCGGCTTCTGACTTCTAGAAGACTAAGGCTGGTCTGTGTTTGCTTGTTTGCCCACCTTTGGCTGATACCC
AGAGAACCTGGGCACTTGCTGCCTGATGCCCACCCCTGCCAGTCATTCCTCCATTCACCCAGCGGGAGGTGGGATGTGAGACAGCCCACA
TTGGAAAATCCAGAAAACCGGGAACAGGGATTTGCCCTTCACAATTCTACTCCCCAGATCCTCTCCCCTGGACACAGGAGACCCACAGGG
CAGGACCCTAAGATCTGGGGAAAGGAGGTCCTGAGAACCTTGAGGTACCCTTAGATCCTTTTCTACCCACTTTCCTATGGAGGATTCCAA
GTCACCACTTCTCTCACCGGCTTCTACCAGGGTCCAGGACTAAGGCGTTTTTCTCCATAGCCTCAACATTTTGGGAATCTTCCCTTAATC
ACCCTTGCTCCTCCTGGGTGCCTGGAAGATGGACTGGCAGAGACCTCTTTGTTGCGTTTTGTGCTTTGATGCCAGGAATGCCGCCTAGTT
TATGTCCCCGGTGGGGCACACAGCGGGGGGCGCCAGGTTTTCCTTGTCCCCCAGCTGCTCTGCCCCTTTCCCCTTCTTCCCTGACTCCAG


Top

FusionGenePPI for GALNT18_PPP1R1B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GALNT18CEP250, TAZ, IDS, PLAUR, TMEM25, PTPRK, LYZL2, OS9, ST8SIA4, SLAMF1, AVP, LYZL1, TDGF1, PTCH1PPP1R1BDLGAP4, CSNK2A1, PPP1CC, PPP1CA, TFCP2, KLHL6, ACTBL2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GALNT18_PPP1R1B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GALNT18_PPP1R1B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePPP1R1BC0036341Schizophrenia5PSYGENET
TgenePPP1R1BC0005586Bipolar Disorder4PSYGENET
TgenePPP1R1BC0001973Alcoholic Intoxication, Chronic1PSYGENET
TgenePPP1R1BC0007370Catalepsy1CTD_human
TgenePPP1R1BC0011570Mental Depression1PSYGENET
TgenePPP1R1BC0011581Depressive disorder1PSYGENET
TgenePPP1R1BC0013384Dyskinetic syndrome1CTD_human