FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14268

FusionGeneSummary for GAK_LUC7L3

check button Fusion gene summary
Fusion gene informationFusion gene name: GAK_LUC7L3
Fusion gene ID: 14268
HgeneTgene
Gene symbol

GAK

LUC7L3

Gene ID

2580

51747

Gene namecyclin G associated kinaseLUC7 like 3 pre-mRNA splicing factor
SynonymsDNAJ26|DNAJC26CRA|CREAP-1|CROP|LUC7A|OA48-18|hLuc7A
Cytomap

4p16.3

17q21.33

Type of geneprotein-codingprotein-coding
Descriptioncyclin-G-associated kinaseauxilin-2luc7-like protein 3CRE-associated protein 1LUC7-like 3cAMP regulatory element-associated protein 1cisplatin resistance-associated-overexpressed proteinokadaic acid-inducible phosphoprotein OA48-18
Modification date2018052320180523
UniProtAcc

O14976

O95232

Ensembl transtripts involved in fusion geneENST00000314167, ENST00000511163, 
ENST00000509566, 
ENST00000505658, 
ENST00000393227, ENST00000311571, 
ENST00000240304, ENST00000544170, 
ENST00000503798, 
Fusion gene scores* DoF score7 X 8 X 4=2245 X 6 X 2=60
# samples 76
** MAII scorelog2(7/224*10)=-1.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/60*10)=0
Context

PubMed: GAK [Title/Abstract] AND LUC7L3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneGAK

GO:0010977

negative regulation of neuron projection development

24510904


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-CU-A5W6-01AGAKchr4

843066

-LUC7L3chr17

48834056

+
TCGALDBLCATCGA-CU-A5W6-01AGAKchr4

925831

-LUC7L3chr17

48814321

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
5CDS-intronENST00000314167ENST00000505658GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000314167ENST00000393227GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000314167ENST00000311571GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000314167ENST00000240304GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000314167ENST00000544170GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000314167ENST00000503798GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000511163ENST00000505658GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000511163ENST00000393227GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000511163ENST00000311571GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000511163ENST00000240304GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000511163ENST00000544170GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000511163ENST00000503798GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000509566ENST00000505658GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000509566ENST00000393227GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000509566ENST00000311571GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000509566ENST00000240304GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000509566ENST00000544170GAKchr4

843066

-LUC7L3chr17

48834056

+
5CDS-intronENST00000509566ENST00000503798GAKchr4

843066

-LUC7L3chr17

48834056

+
In-frameENST00000314167ENST00000505658GAKchr4

925831

-LUC7L3chr17

48814321

+
In-frameENST00000314167ENST00000393227GAKchr4

925831

-LUC7L3chr17

48814321

+
In-frameENST00000314167ENST00000311571GAKchr4

925831

-LUC7L3chr17

48814321

+
In-frameENST00000314167ENST00000240304GAKchr4

925831

-LUC7L3chr17

48814321

+
5CDS-intronENST00000314167ENST00000544170GAKchr4

925831

-LUC7L3chr17

48814321

+
5CDS-intronENST00000314167ENST00000503798GAKchr4

925831

-LUC7L3chr17

48814321

+
In-frameENST00000511163ENST00000505658GAKchr4

925831

-LUC7L3chr17

48814321

+
In-frameENST00000511163ENST00000393227GAKchr4

925831

-LUC7L3chr17

48814321

+
In-frameENST00000511163ENST00000311571GAKchr4

925831

-LUC7L3chr17

48814321

+
In-frameENST00000511163ENST00000240304GAKchr4

925831

-LUC7L3chr17

48814321

+
5CDS-intronENST00000511163ENST00000544170GAKchr4

925831

-LUC7L3chr17

48814321

+
5CDS-intronENST00000511163ENST00000503798GAKchr4

925831

-LUC7L3chr17

48814321

+
intron-3CDSENST00000509566ENST00000505658GAKchr4

925831

-LUC7L3chr17

48814321

+
intron-3CDSENST00000509566ENST00000393227GAKchr4

925831

-LUC7L3chr17

48814321

+
intron-3CDSENST00000509566ENST00000311571GAKchr4

925831

-LUC7L3chr17

48814321

+
intron-3CDSENST00000509566ENST00000240304GAKchr4

925831

-LUC7L3chr17

48814321

+
intron-intronENST00000509566ENST00000544170GAKchr4

925831

-LUC7L3chr17

48814321

+
intron-intronENST00000509566ENST00000503798GAKchr4

925831

-LUC7L3chr17

48814321

+

Top

FusionProtFeatures for GAK_LUC7L3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
GAK

O14976

LUC7L3

O95232

Associates with cyclin G and CDK5. Seems to act as anauxilin homolog that is involved in the uncoating of clathrin-coated vesicles by Hsc70 in non-neuronal cells. Expressionoscillates slightly during the cell cycle, peaking at G1.{ECO:0000269|PubMed:10625686}. Binds cAMP regulatory element DNA sequence. May play arole in RNA splicing. {ECO:0000269|PubMed:16462885}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneLUC7L3chr4:925831chr17:48814321ENST00000240304+011124_18133526Coiled coilOntology_term=ECO:0000255
TgeneLUC7L3chr4:925831chr17:48814321ENST00000505658+010124_18133433Coiled coilOntology_term=ECO:0000255
TgeneLUC7L3chr4:925831chr17:48814321ENST00000240304+011228_28233526Compositional biasNote=Glu-rich
TgeneLUC7L3chr4:925831chr17:48814321ENST00000240304+011235_39533526Compositional biasNote=Arg/Ser-rich
TgeneLUC7L3chr4:925831chr17:48814321ENST00000505658+010228_28233433Compositional biasNote=Glu-rich
TgeneLUC7L3chr4:925831chr17:48814321ENST00000505658+010235_39533433Compositional biasNote=Arg/Ser-rich

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneGAKchr4:925831chr17:48814321ENST00000314167-128347_350481312Compositional biasNote=Poly-Pro
HgeneGAKchr4:925831chr17:48814321ENST00000314167-1281247_1311481312DomainJ
HgeneGAKchr4:925831chr17:48814321ENST00000314167-128399_566481312DomainPhosphatase tensin-type
HgeneGAKchr4:925831chr17:48814321ENST00000314167-12840_314481312DomainProtein kinase
HgeneGAKchr4:925831chr17:48814321ENST00000314167-128572_710481312DomainC2 tensin-type


Top

FusionGeneSequence for GAK_LUC7L3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_GAK_ENST00000314167_chr4_925831_-_LUC7L3_ENST00000505658_chr17_48814321_+_448aa
MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGLXILSLWFLSCGIVHKYTFXSWSVXKNSXXKSTKTVXEELS
FHESWLXERFFAILTELTCRSRTXDQTRPCSFGIISKPAVFWGRWPNRQKXRKNSGSNRQNXCTSATDXRIRVXRKSRRSPGDDEISXAI
KRRERTAKVHNVDNXKLCCTRKTNGSLXSMWSLFNSRRCPVPGRXPFDGKTTHGLCQNXSYCRRIKRKVKEKNRRTXSXXASKKGEARKR
RKRKRTGERKGRKRKEKTKGRGRKRKRKGSXQRKKKEKSFTKXTLKPNIRQKMQQVSGPQKVTKXRKKAEQKXRSTKKQKPXSIRKKTQI

>In-frame_GAK_ENST00000314167_chr4_925831_-_LUC7L3_ENST00000393227_chr17_48814321_+_505aa
MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGLXILSLWFLSCGIVHKYTFXSWSVXKNSXXKSTKTVXEELS
FHESWLXERFFAILTELTCRSRTXDQTRPCSFGIISKPAVFWGRWPNRQKXRKNSGSNRQNXCTSATDXRIRVXRKSRRSPGDDEISXAI
KRRERTAKVHNVDNXKLCCTRKTNGSLXSMWSLFNSRRCPVPGRXPFDGKTTHGLCQNXSYCRRIKRKVKEKNRRTXSXXASKKGEARKR
RKRKRTGERKGRKRKEKTKGRGRKRKRKGSXQRKKKEKSFTKXTLKPNIRQKMQQVSGPQKVTKXRKKAEQKXRSTKKQKPXSIRKKTQI
SKSGSKKIKKPGSKVIXAQEQKSGQRTRXKIQGERKEGIXXXKKXCEVRXSRKAEXRHKHXIEGKXYXEXGQWDQXRHXIXSAAXVCTDE

>In-frame_GAK_ENST00000314167_chr4_925831_-_LUC7L3_ENST00000311571_chr17_48814321_+_95aa
MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGLXILSLWFLSCGIVHKYTFXSXCIWKRRXHXRCQQIFGRXQ

>In-frame_GAK_ENST00000314167_chr4_925831_-_LUC7L3_ENST00000240304_chr17_48814321_+_448aa
MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGLXILSLWFLSCGIVHKYTFXSWSVXKNSXXKSTKTVXEELS
FHESWLXERFFAILTELTCRSRTXDQTRPCSFGIISKPAVFWGRWPNRQKXRKNSGSNRQNXCTSATDXRIRVXRKSRRSPGDDEISXAI
KRRERTAKVHNVDNXKLCCTRKTNGSLXSMWSLFNSRRCPVPGRXPFDGKTTHGLCQNXSYCRRIKRKVKEKNRRTXSXXASKKGEARKR
RKRKRTGERKGRKRKEKTKGRGRKRKRKGSXQRKKKEKSFTKXTLKPNIRQKMQQVSGPQKVTKXRKKAEQKXRSTKKQKPXSIRKKTQI

>In-frame_GAK_ENST00000511163_chr4_925831_-_LUC7L3_ENST00000505658_chr17_48814321_+_448aa
MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGLXILSLWFLSCGIVHKYTFXSWSVXKNSXXKSTKTVXEELS
FHESWLXERFFAILTELTCRSRTXDQTRPCSFGIISKPAVFWGRWPNRQKXRKNSGSNRQNXCTSATDXRIRVXRKSRRSPGDDEISXAI
KRRERTAKVHNVDNXKLCCTRKTNGSLXSMWSLFNSRRCPVPGRXPFDGKTTHGLCQNXSYCRRIKRKVKEKNRRTXSXXASKKGEARKR
RKRKRTGERKGRKRKEKTKGRGRKRKRKGSXQRKKKEKSFTKXTLKPNIRQKMQQVSGPQKVTKXRKKAEQKXRSTKKQKPXSIRKKTQI

>In-frame_GAK_ENST00000511163_chr4_925831_-_LUC7L3_ENST00000393227_chr17_48814321_+_505aa
MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGLXILSLWFLSCGIVHKYTFXSWSVXKNSXXKSTKTVXEELS
FHESWLXERFFAILTELTCRSRTXDQTRPCSFGIISKPAVFWGRWPNRQKXRKNSGSNRQNXCTSATDXRIRVXRKSRRSPGDDEISXAI
KRRERTAKVHNVDNXKLCCTRKTNGSLXSMWSLFNSRRCPVPGRXPFDGKTTHGLCQNXSYCRRIKRKVKEKNRRTXSXXASKKGEARKR
RKRKRTGERKGRKRKEKTKGRGRKRKRKGSXQRKKKEKSFTKXTLKPNIRQKMQQVSGPQKVTKXRKKAEQKXRSTKKQKPXSIRKKTQI
SKSGSKKIKKPGSKVIXAQEQKSGQRTRXKIQGERKEGIXXXKKXCEVRXSRKAEXRHKHXIEGKXYXEXGQWDQXRHXIXSAAXVCTDE

>In-frame_GAK_ENST00000511163_chr4_925831_-_LUC7L3_ENST00000311571_chr17_48814321_+_95aa
MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGLXILSLWFLSCGIVHKYTFXSXCIWKRRXHXRCQQIFGRXQ

>In-frame_GAK_ENST00000511163_chr4_925831_-_LUC7L3_ENST00000240304_chr17_48814321_+_448aa
MSLLQSALDFLAGPGSLGGASGRDQSDFVGQTVELGELRLRVRRVLAEGLXILSLWFLSCGIVHKYTFXSWSVXKNSXXKSTKTVXEELS
FHESWLXERFFAILTELTCRSRTXDQTRPCSFGIISKPAVFWGRWPNRQKXRKNSGSNRQNXCTSATDXRIRVXRKSRRSPGDDEISXAI
KRRERTAKVHNVDNXKLCCTRKTNGSLXSMWSLFNSRRCPVPGRXPFDGKTTHGLCQNXSYCRRIKRKVKEKNRRTXSXXASKKGEARKR
RKRKRTGERKGRKRKEKTKGRGRKRKRKGSXQRKKKEKSFTKXTLKPNIRQKMQQVSGPQKVTKXRKKAEQKXRSTKKQKPXSIRKKTQI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_GAK_ENST00000314167_chr4_925831_-_LUC7L3_ENST00000505658_chr17_48814321_+_1345nt
ATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGCGACCAGAGTGACTTCGTGGGG
CAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTATCTCTGTGGTTTTTGTCCTGC
GGAATTGTTCACAAATACACGTTCTGATCTTGGTCCGTGTGAAAAAATTCATGATGAAAATCTACGAAAACAGTATGAGAAGAGCTCTCG
TTTCATGAAAGTTGGCTATGAGAGAGATTTTTTGCGATACTTACAGAGCTTACTTGCAGAAGTAGAACGTAGGATCAGACGAGGCCATGC
TCGTTTGGCATTATCTCAAAACCAGCAGTCTTCTGGGGCCGCTGGCCCAACAGGCAAAAATGAAGAAAAAATTCAGGTTCTAACAGACAA
AATTGATGTACTTCTGCAACAGATTGAAGAATTAGGGTCTGAAGGAAAAGTAGAAGAAGCCCAGGGGATGATGAAATTAGTTGAGCAATT
AAAAGAAGAGAGAGAACTGCTAAGGTCCACAACGTCGACAATTGAAAGCTTTGCTGCACAAGAAAAACAAATGGAAGTTTGTGAAGTATG
TGGAGCCTTTTTAATAGTAGGAGATGCCCAGTCCCGGGTAGATGACCATTTGATGGGAAAACAACACATGGGCTATGCCAAAATTAAAGC
TACTGTAGAAGAATTAAAAGAAAAGTTAAGGAAAAGAACCGAAGAACCTGATCGTGATGAGCGTCTAAAAAAGGAGAAGCAAGAAAGAGA
AGAAAGAGAAAAAGAACGGGAGAGAGAAAGGGAAGAAAGAGAAAGGAAAAGACGAAGGGAAGAGGAAGAAAGAGAAAAAGAAAGGGCTCG
TGACAGAGAAAGAAGAAAGAGAAGTCGTTCACGAAGTAGACACTCAAGCCGAACATCAGACAGAAGATGCAGCAGGTCTCGGGACCACAA
AAGGTCACGAAGTAGAGAAAGAAGGCGGAGCAGAAGTAGAGATCGACGAAGAAGCAGAAGCCATGATCGATCAGAAAGAAAACACAGATC
TCGAAGTCGGGATCGAAGAAGATCAAAAAGCCGGGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCGGGACAGAGAACAAGATAGAAA
ATCCAAGGAGAAAGAAAAGAGGGGATCTGATGATAAAAAAAGTAGTGTGAAGTCCGGTAGTCGAGAAAAGCAGAGTGAAGACACAAACAC

>In-frame_GAK_ENST00000314167_chr4_925831_-_LUC7L3_ENST00000393227_chr17_48814321_+_1516nt
ATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGCGACCAGAGTGACTTCGTGGGG
CAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTATCTCTGTGGTTTTTGTCCTGC
GGAATTGTTCACAAATACACGTTCTGATCTTGGTCCGTGTGAAAAAATTCATGATGAAAATCTACGAAAACAGTATGAGAAGAGCTCTCG
TTTCATGAAAGTTGGCTATGAGAGAGATTTTTTGCGATACTTACAGAGCTTACTTGCAGAAGTAGAACGTAGGATCAGACGAGGCCATGC
TCGTTTGGCATTATCTCAAAACCAGCAGTCTTCTGGGGCCGCTGGCCCAACAGGCAAAAATGAAGAAAAAATTCAGGTTCTAACAGACAA
AATTGATGTACTTCTGCAACAGATTGAAGAATTAGGGTCTGAAGGAAAAGTAGAAGAAGCCCAGGGGATGATGAAATTAGTTGAGCAATT
AAAAGAAGAGAGAGAACTGCTAAGGTCCACAACGTCGACAATTGAAAGCTTTGCTGCACAAGAAAAACAAATGGAAGTTTGTGAAGTATG
TGGAGCCTTTTTAATAGTAGGAGATGCCCAGTCCCGGGTAGATGACCATTTGATGGGAAAACAACACATGGGCTATGCCAAAATTAAAGC
TACTGTAGAAGAATTAAAAGAAAAGTTAAGGAAAAGAACCGAAGAACCTGATCGTGATGAGCGTCTAAAAAAGGAGAAGCAAGAAAGAGA
AGAAAGAGAAAAAGAACGGGAGAGAGAAAGGGAAGAAAGAGAAAGGAAAAGACGAAGGGAAGAGGAAGAAAGAGAAAAAGAAAGGGCTCG
TGACAGAGAAAGAAGAAAGAGAAGTCGTTCACGAAGTAGACACTCAAGCCGAACATCAGACAGAAGATGCAGCAGGTCTCGGGACCACAA
AAGGTCACGAAGTAGAGAAAGAAGGCGGAGCAGAAGTAGAGATCGACGAAGAAGCAGAAGCCATGATCGATCAGAAAGAAAACACAGATC
TCGAAGTCGGGATCGAAGAAGATCAAAAAGCCGGGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCGGGACAGAGAACAAGATAGAAA
ATCCAAGGAGAAAGAAAAGAGGGGATCTGATGATAAAAAAAGTAGTGTGAAGTCCGGTAGTCGAGAAAAGCAGAGTGAAGACACAAACAC
TGAATCGAAGGAAAGTGATACTAAGAATGAGGTCAATGGGACCAGTGAAGACATTAAATCTGAAGTGCAGCGTAAGTATGCACAGATGAA
GATGGAACTAAGCCGAGTAAGAAGACATACAAAAGCCTCTTCTGAAGGAAAAGACAGTGTAGTCCTGCAAAACATTTTGAGGTACATTGT

>In-frame_GAK_ENST00000314167_chr4_925831_-_LUC7L3_ENST00000311571_chr17_48814321_+_286nt
ATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGCGACCAGAGTGACTTCGTGGGG
CAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTATCTCTGTGGTTTTTGTCCTGC
GGAATTGTTCACAAATACACGTTCTGATCTTGATGTATTTGGAAGAGGAGATAACATTAGAGATGTCAGCAAATTTTTGGAAGATGACAA

>In-frame_GAK_ENST00000314167_chr4_925831_-_LUC7L3_ENST00000240304_chr17_48814321_+_1345nt
ATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGCGACCAGAGTGACTTCGTGGGG
CAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTATCTCTGTGGTTTTTGTCCTGC
GGAATTGTTCACAAATACACGTTCTGATCTTGGTCCGTGTGAAAAAATTCATGATGAAAATCTACGAAAACAGTATGAGAAGAGCTCTCG
TTTCATGAAAGTTGGCTATGAGAGAGATTTTTTGCGATACTTACAGAGCTTACTTGCAGAAGTAGAACGTAGGATCAGACGAGGCCATGC
TCGTTTGGCATTATCTCAAAACCAGCAGTCTTCTGGGGCCGCTGGCCCAACAGGCAAAAATGAAGAAAAAATTCAGGTTCTAACAGACAA
AATTGATGTACTTCTGCAACAGATTGAAGAATTAGGGTCTGAAGGAAAAGTAGAAGAAGCCCAGGGGATGATGAAATTAGTTGAGCAATT
AAAAGAAGAGAGAGAACTGCTAAGGTCCACAACGTCGACAATTGAAAGCTTTGCTGCACAAGAAAAACAAATGGAAGTTTGTGAAGTATG
TGGAGCCTTTTTAATAGTAGGAGATGCCCAGTCCCGGGTAGATGACCATTTGATGGGAAAACAACACATGGGCTATGCCAAAATTAAAGC
TACTGTAGAAGAATTAAAAGAAAAGTTAAGGAAAAGAACCGAAGAACCTGATCGTGATGAGCGTCTAAAAAAGGAGAAGCAAGAAAGAGA
AGAAAGAGAAAAAGAACGGGAGAGAGAAAGGGAAGAAAGAGAAAGGAAAAGACGAAGGGAAGAGGAAGAAAGAGAAAAAGAAAGGGCTCG
TGACAGAGAAAGAAGAAAGAGAAGTCGTTCACGAAGTAGACACTCAAGCCGAACATCAGACAGAAGATGCAGCAGGTCTCGGGACCACAA
AAGGTCACGAAGTAGAGAAAGAAGGCGGAGCAGAAGTAGAGATCGACGAAGAAGCAGAAGCCATGATCGATCAGAAAGAAAACACAGATC
TCGAAGTCGGGATCGAAGAAGATCAAAAAGCCGGGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCGGGACAGAGAACAAGATAGAAA
ATCCAAGGAGAAAGAAAAGAGGGGATCTGATGATAAAAAAAGTAGTGTGAAGTCCGGTAGTCGAGAAAAGCAGAGTGAAGACACAAACAC

>In-frame_GAK_ENST00000511163_chr4_925831_-_LUC7L3_ENST00000505658_chr17_48814321_+_1345nt
ATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGCGACCAGAGTGACTTCGTGGGG
CAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTATCTCTGTGGTTTTTGTCCTGC
GGAATTGTTCACAAATACACGTTCTGATCTTGGTCCGTGTGAAAAAATTCATGATGAAAATCTACGAAAACAGTATGAGAAGAGCTCTCG
TTTCATGAAAGTTGGCTATGAGAGAGATTTTTTGCGATACTTACAGAGCTTACTTGCAGAAGTAGAACGTAGGATCAGACGAGGCCATGC
TCGTTTGGCATTATCTCAAAACCAGCAGTCTTCTGGGGCCGCTGGCCCAACAGGCAAAAATGAAGAAAAAATTCAGGTTCTAACAGACAA
AATTGATGTACTTCTGCAACAGATTGAAGAATTAGGGTCTGAAGGAAAAGTAGAAGAAGCCCAGGGGATGATGAAATTAGTTGAGCAATT
AAAAGAAGAGAGAGAACTGCTAAGGTCCACAACGTCGACAATTGAAAGCTTTGCTGCACAAGAAAAACAAATGGAAGTTTGTGAAGTATG
TGGAGCCTTTTTAATAGTAGGAGATGCCCAGTCCCGGGTAGATGACCATTTGATGGGAAAACAACACATGGGCTATGCCAAAATTAAAGC
TACTGTAGAAGAATTAAAAGAAAAGTTAAGGAAAAGAACCGAAGAACCTGATCGTGATGAGCGTCTAAAAAAGGAGAAGCAAGAAAGAGA
AGAAAGAGAAAAAGAACGGGAGAGAGAAAGGGAAGAAAGAGAAAGGAAAAGACGAAGGGAAGAGGAAGAAAGAGAAAAAGAAAGGGCTCG
TGACAGAGAAAGAAGAAAGAGAAGTCGTTCACGAAGTAGACACTCAAGCCGAACATCAGACAGAAGATGCAGCAGGTCTCGGGACCACAA
AAGGTCACGAAGTAGAGAAAGAAGGCGGAGCAGAAGTAGAGATCGACGAAGAAGCAGAAGCCATGATCGATCAGAAAGAAAACACAGATC
TCGAAGTCGGGATCGAAGAAGATCAAAAAGCCGGGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCGGGACAGAGAACAAGATAGAAA
ATCCAAGGAGAAAGAAAAGAGGGGATCTGATGATAAAAAAAGTAGTGTGAAGTCCGGTAGTCGAGAAAAGCAGAGTGAAGACACAAACAC

>In-frame_GAK_ENST00000511163_chr4_925831_-_LUC7L3_ENST00000393227_chr17_48814321_+_1516nt
ATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGCGACCAGAGTGACTTCGTGGGG
CAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTATCTCTGTGGTTTTTGTCCTGC
GGAATTGTTCACAAATACACGTTCTGATCTTGGTCCGTGTGAAAAAATTCATGATGAAAATCTACGAAAACAGTATGAGAAGAGCTCTCG
TTTCATGAAAGTTGGCTATGAGAGAGATTTTTTGCGATACTTACAGAGCTTACTTGCAGAAGTAGAACGTAGGATCAGACGAGGCCATGC
TCGTTTGGCATTATCTCAAAACCAGCAGTCTTCTGGGGCCGCTGGCCCAACAGGCAAAAATGAAGAAAAAATTCAGGTTCTAACAGACAA
AATTGATGTACTTCTGCAACAGATTGAAGAATTAGGGTCTGAAGGAAAAGTAGAAGAAGCCCAGGGGATGATGAAATTAGTTGAGCAATT
AAAAGAAGAGAGAGAACTGCTAAGGTCCACAACGTCGACAATTGAAAGCTTTGCTGCACAAGAAAAACAAATGGAAGTTTGTGAAGTATG
TGGAGCCTTTTTAATAGTAGGAGATGCCCAGTCCCGGGTAGATGACCATTTGATGGGAAAACAACACATGGGCTATGCCAAAATTAAAGC
TACTGTAGAAGAATTAAAAGAAAAGTTAAGGAAAAGAACCGAAGAACCTGATCGTGATGAGCGTCTAAAAAAGGAGAAGCAAGAAAGAGA
AGAAAGAGAAAAAGAACGGGAGAGAGAAAGGGAAGAAAGAGAAAGGAAAAGACGAAGGGAAGAGGAAGAAAGAGAAAAAGAAAGGGCTCG
TGACAGAGAAAGAAGAAAGAGAAGTCGTTCACGAAGTAGACACTCAAGCCGAACATCAGACAGAAGATGCAGCAGGTCTCGGGACCACAA
AAGGTCACGAAGTAGAGAAAGAAGGCGGAGCAGAAGTAGAGATCGACGAAGAAGCAGAAGCCATGATCGATCAGAAAGAAAACACAGATC
TCGAAGTCGGGATCGAAGAAGATCAAAAAGCCGGGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCGGGACAGAGAACAAGATAGAAA
ATCCAAGGAGAAAGAAAAGAGGGGATCTGATGATAAAAAAAGTAGTGTGAAGTCCGGTAGTCGAGAAAAGCAGAGTGAAGACACAAACAC
TGAATCGAAGGAAAGTGATACTAAGAATGAGGTCAATGGGACCAGTGAAGACATTAAATCTGAAGTGCAGCGTAAGTATGCACAGATGAA
GATGGAACTAAGCCGAGTAAGAAGACATACAAAAGCCTCTTCTGAAGGAAAAGACAGTGTAGTCCTGCAAAACATTTTGAGGTACATTGT

>In-frame_GAK_ENST00000511163_chr4_925831_-_LUC7L3_ENST00000311571_chr17_48814321_+_286nt
ATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGCGACCAGAGTGACTTCGTGGGG
CAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTATCTCTGTGGTTTTTGTCCTGC
GGAATTGTTCACAAATACACGTTCTGATCTTGATGTATTTGGAAGAGGAGATAACATTAGAGATGTCAGCAAATTTTTGGAAGATGACAA

>In-frame_GAK_ENST00000511163_chr4_925831_-_LUC7L3_ENST00000240304_chr17_48814321_+_1345nt
ATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGCGACCAGAGTGACTTCGTGGGG
CAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTATCTCTGTGGTTTTTGTCCTGC
GGAATTGTTCACAAATACACGTTCTGATCTTGGTCCGTGTGAAAAAATTCATGATGAAAATCTACGAAAACAGTATGAGAAGAGCTCTCG
TTTCATGAAAGTTGGCTATGAGAGAGATTTTTTGCGATACTTACAGAGCTTACTTGCAGAAGTAGAACGTAGGATCAGACGAGGCCATGC
TCGTTTGGCATTATCTCAAAACCAGCAGTCTTCTGGGGCCGCTGGCCCAACAGGCAAAAATGAAGAAAAAATTCAGGTTCTAACAGACAA
AATTGATGTACTTCTGCAACAGATTGAAGAATTAGGGTCTGAAGGAAAAGTAGAAGAAGCCCAGGGGATGATGAAATTAGTTGAGCAATT
AAAAGAAGAGAGAGAACTGCTAAGGTCCACAACGTCGACAATTGAAAGCTTTGCTGCACAAGAAAAACAAATGGAAGTTTGTGAAGTATG
TGGAGCCTTTTTAATAGTAGGAGATGCCCAGTCCCGGGTAGATGACCATTTGATGGGAAAACAACACATGGGCTATGCCAAAATTAAAGC
TACTGTAGAAGAATTAAAAGAAAAGTTAAGGAAAAGAACCGAAGAACCTGATCGTGATGAGCGTCTAAAAAAGGAGAAGCAAGAAAGAGA
AGAAAGAGAAAAAGAACGGGAGAGAGAAAGGGAAGAAAGAGAAAGGAAAAGACGAAGGGAAGAGGAAGAAAGAGAAAAAGAAAGGGCTCG
TGACAGAGAAAGAAGAAAGAGAAGTCGTTCACGAAGTAGACACTCAAGCCGAACATCAGACAGAAGATGCAGCAGGTCTCGGGACCACAA
AAGGTCACGAAGTAGAGAAAGAAGGCGGAGCAGAAGTAGAGATCGACGAAGAAGCAGAAGCCATGATCGATCAGAAAGAAAACACAGATC
TCGAAGTCGGGATCGAAGAAGATCAAAAAGCCGGGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCGGGACAGAGAACAAGATAGAAA
ATCCAAGGAGAAAGAAAAGAGGGGATCTGATGATAAAAAAAGTAGTGTGAAGTCCGGTAGTCGAGAAAAGCAGAGTGAAGACACAAACAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_GAK_ENST00000314167_chr4_925831_-_LUC7L3_ENST00000505658_chr17_48814321_+_7008nt
GAAGATGGTGCACCTCCGGGCCGGCGGTTGCTGAGCTGACCCGGACGGCGAGGGAGCGGGAGCCCGAGCCCGACCACTCCGGCTGCCGCG
GGGTGCGGCGCAGCCACCGCCATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGC
GACCAGAGTGACTTCGTGGGGCAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTA
TCTCTGTGGTTTTTGTCCTGCGGAATTGTTCACAAATACACGTTCTGATCTTGGTCCGTGTGAAAAAATTCATGATGAAAATCTACGAAA
ACAGTATGAGAAGAGCTCTCGTTTCATGAAAGTTGGCTATGAGAGAGATTTTTTGCGATACTTACAGAGCTTACTTGCAGAAGTAGAACG
TAGGATCAGACGAGGCCATGCTCGTTTGGCATTATCTCAAAACCAGCAGTCTTCTGGGGCCGCTGGCCCAACAGGCAAAAATGAAGAAAA
AATTCAGGTTCTAACAGACAAAATTGATGTACTTCTGCAACAGATTGAAGAATTAGGGTCTGAAGGAAAAGTAGAAGAAGCCCAGGGGAT
GATGAAATTAGTTGAGCAATTAAAAGAAGAGAGAGAACTGCTAAGGTCCACAACGTCGACAATTGAAAGCTTTGCTGCACAAGAAAAACA
AATGGAAGTTTGTGAAGTATGTGGAGCCTTTTTAATAGTAGGAGATGCCCAGTCCCGGGTAGATGACCATTTGATGGGAAAACAACACAT
GGGCTATGCCAAAATTAAAGCTACTGTAGAAGAATTAAAAGAAAAGTTAAGGAAAAGAACCGAAGAACCTGATCGTGATGAGCGTCTAAA
AAAGGAGAAGCAAGAAAGAGAAGAAAGAGAAAAAGAACGGGAGAGAGAAAGGGAAGAAAGAGAAAGGAAAAGACGAAGGGAAGAGGAAGA
AAGAGAAAAAGAAAGGGCTCGTGACAGAGAAAGAAGAAAGAGAAGTCGTTCACGAAGTAGACACTCAAGCCGAACATCAGACAGAAGATG
CAGCAGGTCTCGGGACCACAAAAGGTCACGAAGTAGAGAAAGAAGGCGGAGCAGAAGTAGAGATCGACGAAGAAGCAGAAGCCATGATCG
ATCAGAAAGAAAACACAGATCTCGAAGTCGGGATCGAAGAAGATCAAAAAGCCGGGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCG
GGACAGAGAACAAGATAGAAAATCCAAGGAGAAAGAAAAGAGGGGATCTGATGATAAAAAAAGTAGTGTGAAGTCCGGTAGTCGAGAAAA
GCAGAGTGAAGACACAAACACTGAATCGAAGGAAAGTGATACTAAGAATGAGGTCAATGGGACCAGTGAAGACATTAAATCTGAAGGTGA
CACTCAGTCCAATTAAAACTGATCTGATAAGACCTCAGATCAGACAGAGGTAAGTGTATTGTTTCTCACTTTGATTAGGGCTTTTTGTTA
CTGTTTGACAGTGCAGCGTAAGTATGCACAGATGAAGATGGAACTAAGCCGAGTAAGAAGACATACAAAAGCCTCTTCTGAAGGAAAAGA
CAGTGTAGTCCTGCAAAACATTTTGAGGTACATTGTTTTGTCTCAGCTATTTTGTAGCAGACTCGTGCCCCCATTAGTGTGCCTCTTTGG
AAATTATCGCCCACATTTGTAATATAGTCGCCATTGAAAAGTTAATTATCCTTTTTTTAGGGATTTTGATGTCATTTCTTTTTTTTTTTT
AATAAAAAGGTTGAACTGTTTTTTTTTTTCTTTTTGGTATTAAGTCCATCTTGTGTTGGTACATTGGCAGAGACATATGCTTTAAAAACT
TAAATATTTCGGAGGCACATGTTGGACTACTTTGTTTTAATTAAACTGCTAGTATTTCTTTGTCAAGGATGTTTCTAGTTTTTTGCTTTA
TTGCCTTGCATTCTAATGCAGTTTGTTCTGTAACTCGAGAGCCAGTAGCATTGGATTGATGGAAGTGTAGGGTTTATGAATTATTGCAGC
TGACTACCATACCTCACACAGCGTTGGTGTTGTGAGCGGCCCATGAAAAGCCAAATTAAAAATCAAGGATTCAGTCAAACTAAGCAGGTA
CTCATGCCAGGTACTCCTTTCTCTACCCACATCCATGTTTGAATGCTATTGCCTGTGATCTTTACGCTTAACTGTTGTGTATCTTTTTTG
TTCTTTACAAGAAGTGCAGAGGGGTTTTTTGTGTATTGCGTGAAAACTTATAAAACAAATGTTAACAGAATGGAATTTTTTTTCAACTGT
ATGTAGGGCTGCAGTGGTGGCCAGAATTAGATATCTTTAAAGAATTTTAAATACAATAAACACTTCATATTATTCGCCTTGTTACACTCA
ATGCAATTCTCAAGTCTATAAGAGGTATGTGCTTAATATTTCCTACTGTGTAGGAGAATTTGCAGTCAGCCATAGGTATGTAGGAATAGT
CACTCACTGGCTGATACATTTAAAGCAGCAGTGTGAATAGCAAGGACAGACACCTTCAATTTGTGAAATCAAAGAACTGATGCACTATAT
AGAACGAATTTGGGTTTTTAAAGAAATATTAAAAGTTAGGTACTGTAAGTGTTCTTAAAACCTGTAAACTTCATTCTGTGGGCTAGTGGT
GTGGGACAAAATATTCCTAATGAAAGGAAGTACCAATTAGTTGATTTGTTGGTGGCATTCCCCTTTTGGGAAAGCAATGTAAGGTTATGT
CTGTGTATGTCATTCACACTTAGGCAAGCATACACAGGCACATGGCTTTAAGAACCACACTGATGCCTTGATAATTAAAAAGAATACAAG
CATTCCATGTACACATGTTAATTAGCAGTTAGTGACTGGGCCAACACTTTCTCATAAAAATTGGCCTTTTACATGTTGTCTAATTATCAT
TTTTCCCCAAATTTTGCGTTGTAGGACTACTGTTCGAAGATTTTTGGAAGAATACTGAGAACGGCATAAAGTGAAGATCGACATTTAAAA
AATGAGGTGAAAGAAAGCTATAGTGGCATAGAAAAAGTATAAAGCTCAGTTAGTTTTTTTATTATTATTATTATTAAAAGTTAATTCAGG
ACTGATGTGACCTACCAGATTTCAGAACATGTGTTAATAGTATATATGCCACTGAAAACTTAGGTCCTGTATCATACTTTTTTCTTTAAG
ACTTTTTAAGAAATATTACTTAAACATGTGGCTTGCTCAGTGTTTAATTGCAAGTTTTCAATCTTGGACTTTGAAAACAGGATTAAACGT
TAGTATTCGTGTGAATCAGACTAAGTGGGATTTCATTTTTACAACTCTGCTCTACTTAGCCTTTGGATTTAGAAGTAAAAATAAAGTATC
TCTGACTTTCTGTTACAAAGTTGATTGTCTCTGTCATTGAAAAGTTTTAGTATTAATCTTTTTCTAATAAAGTTATTGACTCTGAACTAG
TCCCCTGTTTTAAATACAAGAGTTACACTATTACTAGAGGTGTTGGTGTACAGTTTTATCTGATTTGTTCTGTTTAAGACTAATTTTTAT
AGACTTTCTAATGTTTTAAATAATGGTGCTTCAATTTTAGGTGGTTATGAATAAATTTGAATTTTGCTTTTAATAGCAAAGATGTGCAGT
GAACTAGAATATATTTTTACATCCCTGAGAGATTCATTTAGTAGAAAATTCCAAGTATCCTGACAAGCACTCTTTAGCTGGCTAGCTATG
GGATGATGTAGAAAAGCATTCAAGAGCTAGTTTTTGTTAAGTCCTGTATCAAGATTAACCCAGCTGTGTCAGTTTATAAATGTATTTGTG
TATAGGGTGTGTAGTATATATGGCAAGGGTTTTTTCCCCCCACTTAAGTGATTATTTTTGTGTCACATCTAGGAAAACCGGCAGCATGTT
TCTATCTATAGCCAGCTTCTTCGACTGTATAAAAGTATTCTCTCCAGCTACGTATATACACACATACATATATATCATAGCAATTCCTTG
TGGTTTATAACTTGCAAATACTGCTATCAGTTTATAGGTAAAGAAACAGTGTGTTAAATGACTTATCCAGGGAGGGTCCTGTGGCTTCAT
GTTTATGGAGTTGCTAGGTCTCTGCCTCATGGTCCAGTGCCTGTTAAGCCACTGTGTTCATTCTAATAGGCATAATGAATTGTTAAAGAA
TTTACTAAAATCTCTTCCACCAAACTTTGAAAAATAATGAAGCCGCCCCCACTTTAGAGGCTCTGTATGAAAAAATGCTGTGGAGACAGA
GCCCTCCTGGCTCCCTAGCTGATCCTGGAGATGCAGCAATAGATGAATGGGTTATCTCTGAATTTGTAAGAGATAATTCACATGAGGATT
AAGATAAAATGGGAAGTAAAATCTAACAAACACAAAGATAGCTCCCAGGCACTGCTTTGTGTAGTTTGACAGCATTGTGGTTGTAGCAGC
AAAGGACTTAAAGTGATAGTTTTTAAACCATATTCTGTCCCTAAGTAATAAAAAATCTAGGAAGTTACTAAAATACCAGATTTGTTCTGC
TCTGCCTCATCTAGAATCAACGTCTAACTAACTTAAATGAAGTATAATAAATGAGTTCATATGAAAAGGCTTCCTCTATGGACACTTAGA
TATATTGTAACTATTGAAGTTACCTGGGATGTGGGGGTGGTGGGAGGAGGACCTGCCTCCCCAGGACATCTATGACTAAGGCCTGGCTTT
AGTTATGGAGAGAGACGTAGAAGTTGAATTTTACACCCAAAATTGATGTGACTGAAGAGGAACTGATTGTTGCTAACCAGCTCACAAGAA
TCCAGTATTGAGACCAGTTCACTAGAAGAAACAAACATTTCTGCCATGCAGACCAAAAAGTTATTAGTTGGTGAATATGTATTTTCTCTT
TGGAAGGTCTTTAAGGGGAGCAAACCAGTTTTAATCAATCAGATTGCTTGGTAAGTTTGGAATCTGCAATCAGTTGGTCTTAAAAAAAAA
AAAACTTTATTTTGGAAATTTAAAGACATACACAAAAGAGGAACAATATAATTAACCTCTGTTAACTCATCACCAACAAGACTCATGACC
ACTTTTATACTTCATGAGTGATTGTATTTGTATCCACTGTTTTCTATTATTTTCGAGCAAGTCTCAGACACACCATTTAATCTGTAAATA
ATTCAGCATGTATCTCTAAAAGACAAAGACCTCTTAAATAACAGTTCATTAGTATAAAACAAATTGGGTAAACTTTTGTTGGTCATCAAA
CTATATTAGCACTGGTCCAATAGTTTAATTTTCATTGAGCCTTTCAAGAGGACCGACCAGTCTGCTGCTCAAGACATCCTCTCCTCTGGA
ATGTAGAGATAATACATATCATGCTCCTTTTTGTTAAAACGTTTTTTTTTCCCCTTCAAACACAGTCCATTCATTTTTCAGTTTGGGTTG
AAACATCCTTTTCTTGATCTTGAGCTTATAATAACCTAGTCATATTGCTCAGCTCAGATATTTTTACTCCCTCTCCTTAGGCATTCTGGT
TCCTTAAATATAGTTAGTGTCACAGAGGATAAATAACCAACCTTATTTCTAAGGTCTGAGAACACTTGGACCACATATTGGTTGAGCTCA
GCCACCTTCTGATTAAAGTTTTCAGACTTGTAAGAACTGAAAATTTTTATGGTGGAAGTTCTCTGAGCCCTCATCCATTCTGTTTTTAAA
AATGCATTGCAGATGGGCTATGTGAATATGTTTTTAAACATCTGATATGTGCATGAAACAAAAAACACTTGAAGTTATTATGTATACAAT
TCTGTGGGATGGGACTTCATGCAGGATTGGTTTTCAAGTTTGATTTCCTGAGGGATTTTTTAGTTGTTTGTGAAAGAACCCCAGGTCTAC
TTTTGAAATTTTGTATTATAATTGTAATGTTGCCCATGGTTAAAAAAAAAAAGTGTTCAGTGATCTATGTCTCCTACTACTCCTATTTCT
CTGTTTTTCCTCTGCAGGAGCTTGCTGCTGTTAACAGTTATTCTTCCAAGTTGTTTTCTTTGTGGGGAGATGGGAGGTGGGAGGAAATAT
AAACATATATGTATAGATCTTTCAAAATATATGACGGTATACCCGTATGTTCTGAGTCTTGCTGTTTTTACCTGGTAATATTTAGAAACA
TTTATTTTGAGATAAAGGAGAGCACTTTTAAGTTGAACCTGTAGTTTTAAAAAGTACATTTCAAGTAAGCCAAAGCAGAGAAGTAAATGT
ATTTTTCATTGTTGTATCAGAATTTTGAATTTACTATTTTAAAAATTCAAGAGTTTTGTAGCTGATCTATTTCTTCCCCTCAGCCATCCC
AAATAGGTCATTTGTCAACAGATTTAAGAATGTTTAGAAACAACAACTTTGGGAAACGGGAAACAATTTGGTATAAGTGGGTGTGCCATA
ACCTCTCTCGTAGCCATTCATTCCCGGATACATACCCTAGAGAAACTCTTACACATGCGTACCAGGGGATGGATTTAAGCATTTGTGTGT
AATAGGAAGAAAAGAAGAAAAAACCCGGGAAGATCCCAAGTGTCCACCAACAGTGTGTTGGATAAATACTGTGGTATATTCCAACAGTGG
AATTCCACAGAAGTGAAACTGAACTGCAGCTGTGTATGTGAACATGGACAAAACTCAACAATAGAAGGATCAAAAAAAGCAAGTCACAGA
AGAATACATCACTATGGTTCCATTTCAATGAAAGTCAAAAACAGGCTGTCAAATACATGATAAAAGGAAACGATTAAGACAAAATTTAAT
GTTAGCCGTTTTGATGGAGGGAGAGGTGATCATGAGGGCACAGGGGTCTTCAGAAGAACTGGTGAGGGTCTGTTTCTGAAGCCTGTGGGC

>In-frame_GAK_ENST00000314167_chr4_925831_-_LUC7L3_ENST00000393227_chr17_48814321_+_2307nt
GAAGATGGTGCACCTCCGGGCCGGCGGTTGCTGAGCTGACCCGGACGGCGAGGGAGCGGGAGCCCGAGCCCGACCACTCCGGCTGCCGCG
GGGTGCGGCGCAGCCACCGCCATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGC
GACCAGAGTGACTTCGTGGGGCAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTA
TCTCTGTGGTTTTTGTCCTGCGGAATTGTTCACAAATACACGTTCTGATCTTGGTCCGTGTGAAAAAATTCATGATGAAAATCTACGAAA
ACAGTATGAGAAGAGCTCTCGTTTCATGAAAGTTGGCTATGAGAGAGATTTTTTGCGATACTTACAGAGCTTACTTGCAGAAGTAGAACG
TAGGATCAGACGAGGCCATGCTCGTTTGGCATTATCTCAAAACCAGCAGTCTTCTGGGGCCGCTGGCCCAACAGGCAAAAATGAAGAAAA
AATTCAGGTTCTAACAGACAAAATTGATGTACTTCTGCAACAGATTGAAGAATTAGGGTCTGAAGGAAAAGTAGAAGAAGCCCAGGGGAT
GATGAAATTAGTTGAGCAATTAAAAGAAGAGAGAGAACTGCTAAGGTCCACAACGTCGACAATTGAAAGCTTTGCTGCACAAGAAAAACA
AATGGAAGTTTGTGAAGTATGTGGAGCCTTTTTAATAGTAGGAGATGCCCAGTCCCGGGTAGATGACCATTTGATGGGAAAACAACACAT
GGGCTATGCCAAAATTAAAGCTACTGTAGAAGAATTAAAAGAAAAGTTAAGGAAAAGAACCGAAGAACCTGATCGTGATGAGCGTCTAAA
AAAGGAGAAGCAAGAAAGAGAAGAAAGAGAAAAAGAACGGGAGAGAGAAAGGGAAGAAAGAGAAAGGAAAAGACGAAGGGAAGAGGAAGA
AAGAGAAAAAGAAAGGGCTCGTGACAGAGAAAGAAGAAAGAGAAGTCGTTCACGAAGTAGACACTCAAGCCGAACATCAGACAGAAGATG
CAGCAGGTCTCGGGACCACAAAAGGTCACGAAGTAGAGAAAGAAGGCGGAGCAGAAGTAGAGATCGACGAAGAAGCAGAAGCCATGATCG
ATCAGAAAGAAAACACAGATCTCGAAGTCGGGATCGAAGAAGATCAAAAAGCCGGGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCG
GGACAGAGAACAAGATAGAAAATCCAAGGAGAAAGAAAAGAGGGGATCTGATGATAAAAAAAGTAGTGTGAAGTCCGGTAGTCGAGAAAA
GCAGAGTGAAGACACAAACACTGAATCGAAGGAAAGTGATACTAAGAATGAGGTCAATGGGACCAGTGAAGACATTAAATCTGAAGTGCA
GCGTAAGTATGCACAGATGAAGATGGAACTAAGCCGAGTAAGAAGACATACAAAAGCCTCTTCTGAAGGAAAAGACAGTGTAGTCCTGCA
AAACATTTTGAGGTACATTGTTTTGTCTCAGCTATTTTGTAGCAGACTCGTGCCCCCATTAGTGTGCCTCTTTGGAAATTATCGCCCACA
TTTGTAATATAGTCGCCATTGAAAAGTTAATTATCCTTTTTTTAGGGATTTTGATGTCATTTCTTTTTTTTTTTTAATAAAAAGGTTGAA
CTGTTTTTTTTTTTCTTTTTGGTATTAAGTCCATCTTGTGTTGGTACATTGGCAGAGACATATGCTTTAAAAACTTAAATATTTCGGAGG
CACATGTTGGACTACTTTGTTTTAATTAAACTGCTAGTATTTCTTTGTCAAGGATGTTTCTAGTTTTTTGCTTTATTGCCTTGCATTCTA
ATGCAGTTTGTTCTGTAACTCGAGAGCCAGTAGCATTGGATTGATGGAAGTGTAGGGTTTATGAATTATTGCAGCTGACTACCATACCTC
ACACAGCGTTGGTGTTGTGAGCGGCCCATGAAAAGCCAAATTAAAAATCAAGGATTCAGTCAAACTAAGCAGGTACTCATGCCAGGTACT
CCTTTCTCTACCCACATCCATGTTTGAATGCTATTGCCTGTGATCTTTACGCTTAACTGTTGTGTATCTTTTTTGTTCTTTACAAGAAGT
GCAGAGGGGTTTTTTGTGTATTGCGTGAAAACTTATAAAACAAATGTTAACAGAATGGAATTTTTTTTCAACTGTATGTAGGGCTGCAGT

>In-frame_GAK_ENST00000314167_chr4_925831_-_LUC7L3_ENST00000311571_chr17_48814321_+_397nt
GAAGATGGTGCACCTCCGGGCCGGCGGTTGCTGAGCTGACCCGGACGGCGAGGGAGCGGGAGCCCGAGCCCGACCACTCCGGCTGCCGCG
GGGTGCGGCGCAGCCACCGCCATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGC
GACCAGAGTGACTTCGTGGGGCAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTA
TCTCTGTGGTTTTTGTCCTGCGGAATTGTTCACAAATACACGTTCTGATCTTGATGTATTTGGAAGAGGAGATAACATTAGAGATGTCAG

>In-frame_GAK_ENST00000314167_chr4_925831_-_LUC7L3_ENST00000240304_chr17_48814321_+_1999nt
GAAGATGGTGCACCTCCGGGCCGGCGGTTGCTGAGCTGACCCGGACGGCGAGGGAGCGGGAGCCCGAGCCCGACCACTCCGGCTGCCGCG
GGGTGCGGCGCAGCCACCGCCATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGC
GACCAGAGTGACTTCGTGGGGCAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTA
TCTCTGTGGTTTTTGTCCTGCGGAATTGTTCACAAATACACGTTCTGATCTTGGTCCGTGTGAAAAAATTCATGATGAAAATCTACGAAA
ACAGTATGAGAAGAGCTCTCGTTTCATGAAAGTTGGCTATGAGAGAGATTTTTTGCGATACTTACAGAGCTTACTTGCAGAAGTAGAACG
TAGGATCAGACGAGGCCATGCTCGTTTGGCATTATCTCAAAACCAGCAGTCTTCTGGGGCCGCTGGCCCAACAGGCAAAAATGAAGAAAA
AATTCAGGTTCTAACAGACAAAATTGATGTACTTCTGCAACAGATTGAAGAATTAGGGTCTGAAGGAAAAGTAGAAGAAGCCCAGGGGAT
GATGAAATTAGTTGAGCAATTAAAAGAAGAGAGAGAACTGCTAAGGTCCACAACGTCGACAATTGAAAGCTTTGCTGCACAAGAAAAACA
AATGGAAGTTTGTGAAGTATGTGGAGCCTTTTTAATAGTAGGAGATGCCCAGTCCCGGGTAGATGACCATTTGATGGGAAAACAACACAT
GGGCTATGCCAAAATTAAAGCTACTGTAGAAGAATTAAAAGAAAAGTTAAGGAAAAGAACCGAAGAACCTGATCGTGATGAGCGTCTAAA
AAAGGAGAAGCAAGAAAGAGAAGAAAGAGAAAAAGAACGGGAGAGAGAAAGGGAAGAAAGAGAAAGGAAAAGACGAAGGGAAGAGGAAGA
AAGAGAAAAAGAAAGGGCTCGTGACAGAGAAAGAAGAAAGAGAAGTCGTTCACGAAGTAGACACTCAAGCCGAACATCAGACAGAAGATG
CAGCAGGTCTCGGGACCACAAAAGGTCACGAAGTAGAGAAAGAAGGCGGAGCAGAAGTAGAGATCGACGAAGAAGCAGAAGCCATGATCG
ATCAGAAAGAAAACACAGATCTCGAAGTCGGGATCGAAGAAGATCAAAAAGCCGGGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCG
GGACAGAGAACAAGATAGAAAATCCAAGGAGAAAGAAAAGAGGGGATCTGATGATAAAAAAAGTAGTGTGAAGTCCGGTAGTCGAGAAAA
GCAGAGTGAAGACACAAACACTGAATCGAAGGAAAGTGATACTAAGAATGAGGTCAATGGGACCAGTGAAGACATTAAATCTGAAGGTGA
CACTCAGTCCAATTAAAACTGATCTGATAAGACCTCAGATCAGACAGAGGACTACTGTTCGAAGATTTTTGGAAGAATACTGAGAACGGC
ATAAAGTGAAGATCGACATTTAAAAAATGAGGTGAAAGAAAGCTATAGTGGCATAGAAAAAGTATAAAGCTCAGTTAGTTTTTTTATTAT
TATTATTATTAAAAGTTAATTCAGGACTGATGTGACCTACCAGATTTCAGAACATGTGTTAATAGTATATATGCCACTGAAAACTTAGGT
CCTGTATCATACTTTTTTCTTTAAGACTTTTTAAGAAATATTACTTAAACATGTGGCTTGCTCAGTGTTTAATTGCAAGTTTTCAATCTT
GGACTTTGAAAACAGGATTAAACGTTAGTATTCGTGTGAATCAGACTAAGTGGGATTTCATTTTTACAACTCTGCTCTACTTAGCCTTTG
GATTTAGAAGTAAAAATAAAGTATCTCTGACTTTCTGTTACAAAGTTGATTGTCTCTGTCATTGAAAAGTTTTAGTATTAATCTTTTTCT

>In-frame_GAK_ENST00000511163_chr4_925831_-_LUC7L3_ENST00000505658_chr17_48814321_+_7083nt
AGGGGACGGGGCTAGGCCGGGTCGCCGCCTGACGCGACGCGTCCTCACGGGCGCCTACGTCACGGCGTCGAGGCGGAAGATGGTGCACCT
CCGGGCCGGCGGTTGCTGAGCTGACCCGGACGGCGAGGGAGCGGGAGCCCGAGCCCGACCACTCCGGCTGCCGCGGGGTGCGGCGCAGCC
ACCGCCATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGCGACCAGAGTGACTTC
GTGGGGCAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTATCTCTGTGGTTTTTG
TCCTGCGGAATTGTTCACAAATACACGTTCTGATCTTGGTCCGTGTGAAAAAATTCATGATGAAAATCTACGAAAACAGTATGAGAAGAG
CTCTCGTTTCATGAAAGTTGGCTATGAGAGAGATTTTTTGCGATACTTACAGAGCTTACTTGCAGAAGTAGAACGTAGGATCAGACGAGG
CCATGCTCGTTTGGCATTATCTCAAAACCAGCAGTCTTCTGGGGCCGCTGGCCCAACAGGCAAAAATGAAGAAAAAATTCAGGTTCTAAC
AGACAAAATTGATGTACTTCTGCAACAGATTGAAGAATTAGGGTCTGAAGGAAAAGTAGAAGAAGCCCAGGGGATGATGAAATTAGTTGA
GCAATTAAAAGAAGAGAGAGAACTGCTAAGGTCCACAACGTCGACAATTGAAAGCTTTGCTGCACAAGAAAAACAAATGGAAGTTTGTGA
AGTATGTGGAGCCTTTTTAATAGTAGGAGATGCCCAGTCCCGGGTAGATGACCATTTGATGGGAAAACAACACATGGGCTATGCCAAAAT
TAAAGCTACTGTAGAAGAATTAAAAGAAAAGTTAAGGAAAAGAACCGAAGAACCTGATCGTGATGAGCGTCTAAAAAAGGAGAAGCAAGA
AAGAGAAGAAAGAGAAAAAGAACGGGAGAGAGAAAGGGAAGAAAGAGAAAGGAAAAGACGAAGGGAAGAGGAAGAAAGAGAAAAAGAAAG
GGCTCGTGACAGAGAAAGAAGAAAGAGAAGTCGTTCACGAAGTAGACACTCAAGCCGAACATCAGACAGAAGATGCAGCAGGTCTCGGGA
CCACAAAAGGTCACGAAGTAGAGAAAGAAGGCGGAGCAGAAGTAGAGATCGACGAAGAAGCAGAAGCCATGATCGATCAGAAAGAAAACA
CAGATCTCGAAGTCGGGATCGAAGAAGATCAAAAAGCCGGGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCGGGACAGAGAACAAGA
TAGAAAATCCAAGGAGAAAGAAAAGAGGGGATCTGATGATAAAAAAAGTAGTGTGAAGTCCGGTAGTCGAGAAAAGCAGAGTGAAGACAC
AAACACTGAATCGAAGGAAAGTGATACTAAGAATGAGGTCAATGGGACCAGTGAAGACATTAAATCTGAAGGTGACACTCAGTCCAATTA
AAACTGATCTGATAAGACCTCAGATCAGACAGAGGTAAGTGTATTGTTTCTCACTTTGATTAGGGCTTTTTGTTACTGTTTGACAGTGCA
GCGTAAGTATGCACAGATGAAGATGGAACTAAGCCGAGTAAGAAGACATACAAAAGCCTCTTCTGAAGGAAAAGACAGTGTAGTCCTGCA
AAACATTTTGAGGTACATTGTTTTGTCTCAGCTATTTTGTAGCAGACTCGTGCCCCCATTAGTGTGCCTCTTTGGAAATTATCGCCCACA
TTTGTAATATAGTCGCCATTGAAAAGTTAATTATCCTTTTTTTAGGGATTTTGATGTCATTTCTTTTTTTTTTTTAATAAAAAGGTTGAA
CTGTTTTTTTTTTTCTTTTTGGTATTAAGTCCATCTTGTGTTGGTACATTGGCAGAGACATATGCTTTAAAAACTTAAATATTTCGGAGG
CACATGTTGGACTACTTTGTTTTAATTAAACTGCTAGTATTTCTTTGTCAAGGATGTTTCTAGTTTTTTGCTTTATTGCCTTGCATTCTA
ATGCAGTTTGTTCTGTAACTCGAGAGCCAGTAGCATTGGATTGATGGAAGTGTAGGGTTTATGAATTATTGCAGCTGACTACCATACCTC
ACACAGCGTTGGTGTTGTGAGCGGCCCATGAAAAGCCAAATTAAAAATCAAGGATTCAGTCAAACTAAGCAGGTACTCATGCCAGGTACT
CCTTTCTCTACCCACATCCATGTTTGAATGCTATTGCCTGTGATCTTTACGCTTAACTGTTGTGTATCTTTTTTGTTCTTTACAAGAAGT
GCAGAGGGGTTTTTTGTGTATTGCGTGAAAACTTATAAAACAAATGTTAACAGAATGGAATTTTTTTTCAACTGTATGTAGGGCTGCAGT
GGTGGCCAGAATTAGATATCTTTAAAGAATTTTAAATACAATAAACACTTCATATTATTCGCCTTGTTACACTCAATGCAATTCTCAAGT
CTATAAGAGGTATGTGCTTAATATTTCCTACTGTGTAGGAGAATTTGCAGTCAGCCATAGGTATGTAGGAATAGTCACTCACTGGCTGAT
ACATTTAAAGCAGCAGTGTGAATAGCAAGGACAGACACCTTCAATTTGTGAAATCAAAGAACTGATGCACTATATAGAACGAATTTGGGT
TTTTAAAGAAATATTAAAAGTTAGGTACTGTAAGTGTTCTTAAAACCTGTAAACTTCATTCTGTGGGCTAGTGGTGTGGGACAAAATATT
CCTAATGAAAGGAAGTACCAATTAGTTGATTTGTTGGTGGCATTCCCCTTTTGGGAAAGCAATGTAAGGTTATGTCTGTGTATGTCATTC
ACACTTAGGCAAGCATACACAGGCACATGGCTTTAAGAACCACACTGATGCCTTGATAATTAAAAAGAATACAAGCATTCCATGTACACA
TGTTAATTAGCAGTTAGTGACTGGGCCAACACTTTCTCATAAAAATTGGCCTTTTACATGTTGTCTAATTATCATTTTTCCCCAAATTTT
GCGTTGTAGGACTACTGTTCGAAGATTTTTGGAAGAATACTGAGAACGGCATAAAGTGAAGATCGACATTTAAAAAATGAGGTGAAAGAA
AGCTATAGTGGCATAGAAAAAGTATAAAGCTCAGTTAGTTTTTTTATTATTATTATTATTAAAAGTTAATTCAGGACTGATGTGACCTAC
CAGATTTCAGAACATGTGTTAATAGTATATATGCCACTGAAAACTTAGGTCCTGTATCATACTTTTTTCTTTAAGACTTTTTAAGAAATA
TTACTTAAACATGTGGCTTGCTCAGTGTTTAATTGCAAGTTTTCAATCTTGGACTTTGAAAACAGGATTAAACGTTAGTATTCGTGTGAA
TCAGACTAAGTGGGATTTCATTTTTACAACTCTGCTCTACTTAGCCTTTGGATTTAGAAGTAAAAATAAAGTATCTCTGACTTTCTGTTA
CAAAGTTGATTGTCTCTGTCATTGAAAAGTTTTAGTATTAATCTTTTTCTAATAAAGTTATTGACTCTGAACTAGTCCCCTGTTTTAAAT
ACAAGAGTTACACTATTACTAGAGGTGTTGGTGTACAGTTTTATCTGATTTGTTCTGTTTAAGACTAATTTTTATAGACTTTCTAATGTT
TTAAATAATGGTGCTTCAATTTTAGGTGGTTATGAATAAATTTGAATTTTGCTTTTAATAGCAAAGATGTGCAGTGAACTAGAATATATT
TTTACATCCCTGAGAGATTCATTTAGTAGAAAATTCCAAGTATCCTGACAAGCACTCTTTAGCTGGCTAGCTATGGGATGATGTAGAAAA
GCATTCAAGAGCTAGTTTTTGTTAAGTCCTGTATCAAGATTAACCCAGCTGTGTCAGTTTATAAATGTATTTGTGTATAGGGTGTGTAGT
ATATATGGCAAGGGTTTTTTCCCCCCACTTAAGTGATTATTTTTGTGTCACATCTAGGAAAACCGGCAGCATGTTTCTATCTATAGCCAG
CTTCTTCGACTGTATAAAAGTATTCTCTCCAGCTACGTATATACACACATACATATATATCATAGCAATTCCTTGTGGTTTATAACTTGC
AAATACTGCTATCAGTTTATAGGTAAAGAAACAGTGTGTTAAATGACTTATCCAGGGAGGGTCCTGTGGCTTCATGTTTATGGAGTTGCT
AGGTCTCTGCCTCATGGTCCAGTGCCTGTTAAGCCACTGTGTTCATTCTAATAGGCATAATGAATTGTTAAAGAATTTACTAAAATCTCT
TCCACCAAACTTTGAAAAATAATGAAGCCGCCCCCACTTTAGAGGCTCTGTATGAAAAAATGCTGTGGAGACAGAGCCCTCCTGGCTCCC
TAGCTGATCCTGGAGATGCAGCAATAGATGAATGGGTTATCTCTGAATTTGTAAGAGATAATTCACATGAGGATTAAGATAAAATGGGAA
GTAAAATCTAACAAACACAAAGATAGCTCCCAGGCACTGCTTTGTGTAGTTTGACAGCATTGTGGTTGTAGCAGCAAAGGACTTAAAGTG
ATAGTTTTTAAACCATATTCTGTCCCTAAGTAATAAAAAATCTAGGAAGTTACTAAAATACCAGATTTGTTCTGCTCTGCCTCATCTAGA
ATCAACGTCTAACTAACTTAAATGAAGTATAATAAATGAGTTCATATGAAAAGGCTTCCTCTATGGACACTTAGATATATTGTAACTATT
GAAGTTACCTGGGATGTGGGGGTGGTGGGAGGAGGACCTGCCTCCCCAGGACATCTATGACTAAGGCCTGGCTTTAGTTATGGAGAGAGA
CGTAGAAGTTGAATTTTACACCCAAAATTGATGTGACTGAAGAGGAACTGATTGTTGCTAACCAGCTCACAAGAATCCAGTATTGAGACC
AGTTCACTAGAAGAAACAAACATTTCTGCCATGCAGACCAAAAAGTTATTAGTTGGTGAATATGTATTTTCTCTTTGGAAGGTCTTTAAG
GGGAGCAAACCAGTTTTAATCAATCAGATTGCTTGGTAAGTTTGGAATCTGCAATCAGTTGGTCTTAAAAAAAAAAAAACTTTATTTTGG
AAATTTAAAGACATACACAAAAGAGGAACAATATAATTAACCTCTGTTAACTCATCACCAACAAGACTCATGACCACTTTTATACTTCAT
GAGTGATTGTATTTGTATCCACTGTTTTCTATTATTTTCGAGCAAGTCTCAGACACACCATTTAATCTGTAAATAATTCAGCATGTATCT
CTAAAAGACAAAGACCTCTTAAATAACAGTTCATTAGTATAAAACAAATTGGGTAAACTTTTGTTGGTCATCAAACTATATTAGCACTGG
TCCAATAGTTTAATTTTCATTGAGCCTTTCAAGAGGACCGACCAGTCTGCTGCTCAAGACATCCTCTCCTCTGGAATGTAGAGATAATAC
ATATCATGCTCCTTTTTGTTAAAACGTTTTTTTTTCCCCTTCAAACACAGTCCATTCATTTTTCAGTTTGGGTTGAAACATCCTTTTCTT
GATCTTGAGCTTATAATAACCTAGTCATATTGCTCAGCTCAGATATTTTTACTCCCTCTCCTTAGGCATTCTGGTTCCTTAAATATAGTT
AGTGTCACAGAGGATAAATAACCAACCTTATTTCTAAGGTCTGAGAACACTTGGACCACATATTGGTTGAGCTCAGCCACCTTCTGATTA
AAGTTTTCAGACTTGTAAGAACTGAAAATTTTTATGGTGGAAGTTCTCTGAGCCCTCATCCATTCTGTTTTTAAAAATGCATTGCAGATG
GGCTATGTGAATATGTTTTTAAACATCTGATATGTGCATGAAACAAAAAACACTTGAAGTTATTATGTATACAATTCTGTGGGATGGGAC
TTCATGCAGGATTGGTTTTCAAGTTTGATTTCCTGAGGGATTTTTTAGTTGTTTGTGAAAGAACCCCAGGTCTACTTTTGAAATTTTGTA
TTATAATTGTAATGTTGCCCATGGTTAAAAAAAAAAAGTGTTCAGTGATCTATGTCTCCTACTACTCCTATTTCTCTGTTTTTCCTCTGC
AGGAGCTTGCTGCTGTTAACAGTTATTCTTCCAAGTTGTTTTCTTTGTGGGGAGATGGGAGGTGGGAGGAAATATAAACATATATGTATA
GATCTTTCAAAATATATGACGGTATACCCGTATGTTCTGAGTCTTGCTGTTTTTACCTGGTAATATTTAGAAACATTTATTTTGAGATAA
AGGAGAGCACTTTTAAGTTGAACCTGTAGTTTTAAAAAGTACATTTCAAGTAAGCCAAAGCAGAGAAGTAAATGTATTTTTCATTGTTGT
ATCAGAATTTTGAATTTACTATTTTAAAAATTCAAGAGTTTTGTAGCTGATCTATTTCTTCCCCTCAGCCATCCCAAATAGGTCATTTGT
CAACAGATTTAAGAATGTTTAGAAACAACAACTTTGGGAAACGGGAAACAATTTGGTATAAGTGGGTGTGCCATAACCTCTCTCGTAGCC
ATTCATTCCCGGATACATACCCTAGAGAAACTCTTACACATGCGTACCAGGGGATGGATTTAAGCATTTGTGTGTAATAGGAAGAAAAGA
AGAAAAAACCCGGGAAGATCCCAAGTGTCCACCAACAGTGTGTTGGATAAATACTGTGGTATATTCCAACAGTGGAATTCCACAGAAGTG
AAACTGAACTGCAGCTGTGTATGTGAACATGGACAAAACTCAACAATAGAAGGATCAAAAAAAGCAAGTCACAGAAGAATACATCACTAT
GGTTCCATTTCAATGAAAGTCAAAAACAGGCTGTCAAATACATGATAAAAGGAAACGATTAAGACAAAATTTAATGTTAGCCGTTTTGAT
GGAGGGAGAGGTGATCATGAGGGCACAGGGGTCTTCAGAAGAACTGGTGAGGGTCTGTTTCTGAAGCCTGTGGGCATTTCCTTTTTTAAT

>In-frame_GAK_ENST00000511163_chr4_925831_-_LUC7L3_ENST00000393227_chr17_48814321_+_2382nt
AGGGGACGGGGCTAGGCCGGGTCGCCGCCTGACGCGACGCGTCCTCACGGGCGCCTACGTCACGGCGTCGAGGCGGAAGATGGTGCACCT
CCGGGCCGGCGGTTGCTGAGCTGACCCGGACGGCGAGGGAGCGGGAGCCCGAGCCCGACCACTCCGGCTGCCGCGGGGTGCGGCGCAGCC
ACCGCCATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGCGACCAGAGTGACTTC
GTGGGGCAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTATCTCTGTGGTTTTTG
TCCTGCGGAATTGTTCACAAATACACGTTCTGATCTTGGTCCGTGTGAAAAAATTCATGATGAAAATCTACGAAAACAGTATGAGAAGAG
CTCTCGTTTCATGAAAGTTGGCTATGAGAGAGATTTTTTGCGATACTTACAGAGCTTACTTGCAGAAGTAGAACGTAGGATCAGACGAGG
CCATGCTCGTTTGGCATTATCTCAAAACCAGCAGTCTTCTGGGGCCGCTGGCCCAACAGGCAAAAATGAAGAAAAAATTCAGGTTCTAAC
AGACAAAATTGATGTACTTCTGCAACAGATTGAAGAATTAGGGTCTGAAGGAAAAGTAGAAGAAGCCCAGGGGATGATGAAATTAGTTGA
GCAATTAAAAGAAGAGAGAGAACTGCTAAGGTCCACAACGTCGACAATTGAAAGCTTTGCTGCACAAGAAAAACAAATGGAAGTTTGTGA
AGTATGTGGAGCCTTTTTAATAGTAGGAGATGCCCAGTCCCGGGTAGATGACCATTTGATGGGAAAACAACACATGGGCTATGCCAAAAT
TAAAGCTACTGTAGAAGAATTAAAAGAAAAGTTAAGGAAAAGAACCGAAGAACCTGATCGTGATGAGCGTCTAAAAAAGGAGAAGCAAGA
AAGAGAAGAAAGAGAAAAAGAACGGGAGAGAGAAAGGGAAGAAAGAGAAAGGAAAAGACGAAGGGAAGAGGAAGAAAGAGAAAAAGAAAG
GGCTCGTGACAGAGAAAGAAGAAAGAGAAGTCGTTCACGAAGTAGACACTCAAGCCGAACATCAGACAGAAGATGCAGCAGGTCTCGGGA
CCACAAAAGGTCACGAAGTAGAGAAAGAAGGCGGAGCAGAAGTAGAGATCGACGAAGAAGCAGAAGCCATGATCGATCAGAAAGAAAACA
CAGATCTCGAAGTCGGGATCGAAGAAGATCAAAAAGCCGGGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCGGGACAGAGAACAAGA
TAGAAAATCCAAGGAGAAAGAAAAGAGGGGATCTGATGATAAAAAAAGTAGTGTGAAGTCCGGTAGTCGAGAAAAGCAGAGTGAAGACAC
AAACACTGAATCGAAGGAAAGTGATACTAAGAATGAGGTCAATGGGACCAGTGAAGACATTAAATCTGAAGTGCAGCGTAAGTATGCACA
GATGAAGATGGAACTAAGCCGAGTAAGAAGACATACAAAAGCCTCTTCTGAAGGAAAAGACAGTGTAGTCCTGCAAAACATTTTGAGGTA
CATTGTTTTGTCTCAGCTATTTTGTAGCAGACTCGTGCCCCCATTAGTGTGCCTCTTTGGAAATTATCGCCCACATTTGTAATATAGTCG
CCATTGAAAAGTTAATTATCCTTTTTTTAGGGATTTTGATGTCATTTCTTTTTTTTTTTTAATAAAAAGGTTGAACTGTTTTTTTTTTTC
TTTTTGGTATTAAGTCCATCTTGTGTTGGTACATTGGCAGAGACATATGCTTTAAAAACTTAAATATTTCGGAGGCACATGTTGGACTAC
TTTGTTTTAATTAAACTGCTAGTATTTCTTTGTCAAGGATGTTTCTAGTTTTTTGCTTTATTGCCTTGCATTCTAATGCAGTTTGTTCTG
TAACTCGAGAGCCAGTAGCATTGGATTGATGGAAGTGTAGGGTTTATGAATTATTGCAGCTGACTACCATACCTCACACAGCGTTGGTGT
TGTGAGCGGCCCATGAAAAGCCAAATTAAAAATCAAGGATTCAGTCAAACTAAGCAGGTACTCATGCCAGGTACTCCTTTCTCTACCCAC
ATCCATGTTTGAATGCTATTGCCTGTGATCTTTACGCTTAACTGTTGTGTATCTTTTTTGTTCTTTACAAGAAGTGCAGAGGGGTTTTTT
GTGTATTGCGTGAAAACTTATAAAACAAATGTTAACAGAATGGAATTTTTTTTCAACTGTATGTAGGGCTGCAGTGGTGGCCAGAATTAG

>In-frame_GAK_ENST00000511163_chr4_925831_-_LUC7L3_ENST00000311571_chr17_48814321_+_472nt
AGGGGACGGGGCTAGGCCGGGTCGCCGCCTGACGCGACGCGTCCTCACGGGCGCCTACGTCACGGCGTCGAGGCGGAAGATGGTGCACCT
CCGGGCCGGCGGTTGCTGAGCTGACCCGGACGGCGAGGGAGCGGGAGCCCGAGCCCGACCACTCCGGCTGCCGCGGGGTGCGGCGCAGCC
ACCGCCATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGCGACCAGAGTGACTTC
GTGGGGCAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTATCTCTGTGGTTTTTG
TCCTGCGGAATTGTTCACAAATACACGTTCTGATCTTGATGTATTTGGAAGAGGAGATAACATTAGAGATGTCAGCAAATTTTTGGAAGA

>In-frame_GAK_ENST00000511163_chr4_925831_-_LUC7L3_ENST00000240304_chr17_48814321_+_2074nt
AGGGGACGGGGCTAGGCCGGGTCGCCGCCTGACGCGACGCGTCCTCACGGGCGCCTACGTCACGGCGTCGAGGCGGAAGATGGTGCACCT
CCGGGCCGGCGGTTGCTGAGCTGACCCGGACGGCGAGGGAGCGGGAGCCCGAGCCCGACCACTCCGGCTGCCGCGGGGTGCGGCGCAGCC
ACCGCCATGTCGCTGCTGCAGTCGGCGCTCGACTTCTTGGCGGGTCCAGGCTCCCTGGGCGGTGCTTCCGGCCGCGACCAGAGTGACTTC
GTGGGGCAGACGGTGGAACTGGGCGAGCTGCGGCTGCGGGTGCGGCGGGTCCTGGCCGAAGGTTTGTAAATATTATCTCTGTGGTTTTTG
TCCTGCGGAATTGTTCACAAATACACGTTCTGATCTTGGTCCGTGTGAAAAAATTCATGATGAAAATCTACGAAAACAGTATGAGAAGAG
CTCTCGTTTCATGAAAGTTGGCTATGAGAGAGATTTTTTGCGATACTTACAGAGCTTACTTGCAGAAGTAGAACGTAGGATCAGACGAGG
CCATGCTCGTTTGGCATTATCTCAAAACCAGCAGTCTTCTGGGGCCGCTGGCCCAACAGGCAAAAATGAAGAAAAAATTCAGGTTCTAAC
AGACAAAATTGATGTACTTCTGCAACAGATTGAAGAATTAGGGTCTGAAGGAAAAGTAGAAGAAGCCCAGGGGATGATGAAATTAGTTGA
GCAATTAAAAGAAGAGAGAGAACTGCTAAGGTCCACAACGTCGACAATTGAAAGCTTTGCTGCACAAGAAAAACAAATGGAAGTTTGTGA
AGTATGTGGAGCCTTTTTAATAGTAGGAGATGCCCAGTCCCGGGTAGATGACCATTTGATGGGAAAACAACACATGGGCTATGCCAAAAT
TAAAGCTACTGTAGAAGAATTAAAAGAAAAGTTAAGGAAAAGAACCGAAGAACCTGATCGTGATGAGCGTCTAAAAAAGGAGAAGCAAGA
AAGAGAAGAAAGAGAAAAAGAACGGGAGAGAGAAAGGGAAGAAAGAGAAAGGAAAAGACGAAGGGAAGAGGAAGAAAGAGAAAAAGAAAG
GGCTCGTGACAGAGAAAGAAGAAAGAGAAGTCGTTCACGAAGTAGACACTCAAGCCGAACATCAGACAGAAGATGCAGCAGGTCTCGGGA
CCACAAAAGGTCACGAAGTAGAGAAAGAAGGCGGAGCAGAAGTAGAGATCGACGAAGAAGCAGAAGCCATGATCGATCAGAAAGAAAACA
CAGATCTCGAAGTCGGGATCGAAGAAGATCAAAAAGCCGGGATCGAAAGTCATATAAGCACAGGAGCAAAAGTCGGGACAGAGAACAAGA
TAGAAAATCCAAGGAGAAAGAAAAGAGGGGATCTGATGATAAAAAAAGTAGTGTGAAGTCCGGTAGTCGAGAAAAGCAGAGTGAAGACAC
AAACACTGAATCGAAGGAAAGTGATACTAAGAATGAGGTCAATGGGACCAGTGAAGACATTAAATCTGAAGGTGACACTCAGTCCAATTA
AAACTGATCTGATAAGACCTCAGATCAGACAGAGGACTACTGTTCGAAGATTTTTGGAAGAATACTGAGAACGGCATAAAGTGAAGATCG
ACATTTAAAAAATGAGGTGAAAGAAAGCTATAGTGGCATAGAAAAAGTATAAAGCTCAGTTAGTTTTTTTATTATTATTATTATTAAAAG
TTAATTCAGGACTGATGTGACCTACCAGATTTCAGAACATGTGTTAATAGTATATATGCCACTGAAAACTTAGGTCCTGTATCATACTTT
TTTCTTTAAGACTTTTTAAGAAATATTACTTAAACATGTGGCTTGCTCAGTGTTTAATTGCAAGTTTTCAATCTTGGACTTTGAAAACAG
GATTAAACGTTAGTATTCGTGTGAATCAGACTAAGTGGGATTTCATTTTTACAACTCTGCTCTACTTAGCCTTTGGATTTAGAAGTAAAA
ATAAAGTATCTCTGACTTTCTGTTACAAAGTTGATTGTCTCTGTCATTGAAAAGTTTTAGTATTAATCTTTTTCTAATAAAGTTATTGAC


Top

FusionGenePPI for GAK_LUC7L3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
GAKUSO1, AXIN1, CDK5, CCNG1, ALK, ATP13A2, APP, LGR4, DMWD, STAMBP, NTRK1, PPM1B, AP2A1, AP2A2, AP2B1, CALM1, CALML3, CAPZB, AP2M1, CLTA, CLTB, CLTC, CPM, DAB2, DBN1, EPS15, PHKG2, PICALM, SEC16A, GTSE1, GOLGB1, HIP1, MYO1C, MYO6, PIK3C2A, PSMA5, SEC13, SP1, SPTAN1, CLTCL1, NUMB, TNK1, HIP1R, XPR1, SEC24C, CLINT1, FEM1B, TNK2, RBM14, KIF3A, SYNPO, CEP162, AAK1, EDRF1, PHGDH, CHMP4A, LIMA1, PLXNA3, BMP2K, KIDINS220, STAMBPL1, DENND1A, AFAP1, ZNF106, INF2, WNK1, CPSF7, PUS7L, PARP10, STON2, MISP, ACTRT1, FAM83B, FAM83H, FBXW7, GPX7, HSPA8, RABGEF1, HSPBP1, C5AR2, IARS2, CBLC, CLASRP, MPP5, FAM174A, TRIM25LUC7L3RNPS1, LUC7L3, SRSF1, CLK1, SRPK1, SRPK2, RRP1B, MEPCE, TADA2A, YWHAG, ITSN2, CUL2, CUL1, COPS5, CAND1, SRSF7, SART1, SMU1, HNRNPU, NXF1, VTN, TRMT112, BANF1, NFIA, RCC1, S100A9, ESR1, BARD1, WWOX, ENO1, SHMT2, MOV10, CUL7, OBSL1, SUZ12, EED, RNF2, BMI1, EAF1, ZRANB2, LUC7L, LUC7L2, UNK, SNRPD2, NTRK1, PTTG1, SYN1, AKAP5, NABP2, NLRP3, NF2, SNW1, EGFR, JMJD6, UHRF2, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for GAK_LUC7L3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for GAK_LUC7L3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneGAKC0030567Parkinson Disease1CTD_human