FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1419

FusionGeneSummary for AKT3_PTPRR

check button Fusion gene summary
Fusion gene informationFusion gene name: AKT3_PTPRR
Fusion gene ID: 1419
HgeneTgene
Gene symbol

AKT3

PTPRR

Gene ID

10000

5801

Gene nameAKT serine/threonine kinase 3protein tyrosine phosphatase, receptor type R
SynonymsMPPH|MPPH2|PKB-GAMMA|PKBG|PRKBG|RAC-PK-gamma|RAC-gamma|STK-2EC-PTP|PCPTP1|PTP-SL|PTPBR7|PTPRQ
Cytomap

1q43-q44

12q15

Type of geneprotein-codingprotein-coding
DescriptionRAC-gamma serine/threonine-protein kinasePKB gammaRAC-gamma serine/threonine protein kinasev-akt murine thymoma viral oncogene homolog 3 (protein kinase B, gamma)receptor-type tyrosine-protein phosphatase RCh-1 PTPaseNC-PTPCOM1R-PTP-Rch-1PTPaseprotein tyrosine phosphatase Cr1PTPaseprotein-tyrosine phosphatase NC-PTPCOM1protein-tyrosine phosphatase PCPTP1
Modification date2018052320180519
UniProtAcc

Q9Y243

Q15256

Ensembl transtripts involved in fusion geneENST00000336199, ENST00000366540, 
ENST00000366539, ENST00000263826, 
ENST00000492957, 
ENST00000283228, 
ENST00000440835, ENST00000537619, 
ENST00000378778, ENST00000342084, 
ENST00000549308, 
Fusion gene scores* DoF score8 X 5 X 5=20033 X 13 X 10=4290
# samples 931
** MAII scorelog2(9/200*10)=-1.15200309344505
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(31/4290*10)=-3.79063752711267
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: AKT3 [Title/Abstract] AND PTPRR [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneAKT3

GO:0043536

positive regulation of blood vessel endothelial cell migration

28254819

HgeneAKT3

GO:1905564

positive regulation of vascular endothelial cell proliferation

28254819


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-ER-A197-06AAKT3chr1

243776973

-PTPRRchr12

71078044

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000336199ENST00000283228AKT3chr1

243776973

-PTPRRchr12

71078044

-
In-frameENST00000336199ENST00000440835AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000336199ENST00000537619AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000336199ENST00000378778AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000336199ENST00000342084AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000336199ENST00000549308AKT3chr1

243776973

-PTPRRchr12

71078044

-
In-frameENST00000366540ENST00000283228AKT3chr1

243776973

-PTPRRchr12

71078044

-
In-frameENST00000366540ENST00000440835AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000366540ENST00000537619AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000366540ENST00000378778AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000366540ENST00000342084AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000366540ENST00000549308AKT3chr1

243776973

-PTPRRchr12

71078044

-
Frame-shitENST00000366539ENST00000283228AKT3chr1

243776973

-PTPRRchr12

71078044

-
Frame-shitENST00000366539ENST00000440835AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000366539ENST00000537619AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000366539ENST00000378778AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000366539ENST00000342084AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000366539ENST00000549308AKT3chr1

243776973

-PTPRRchr12

71078044

-
In-frameENST00000263826ENST00000283228AKT3chr1

243776973

-PTPRRchr12

71078044

-
In-frameENST00000263826ENST00000440835AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000263826ENST00000537619AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000263826ENST00000378778AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000263826ENST00000342084AKT3chr1

243776973

-PTPRRchr12

71078044

-
5CDS-intronENST00000263826ENST00000549308AKT3chr1

243776973

-PTPRRchr12

71078044

-
5UTR-3CDSENST00000492957ENST00000283228AKT3chr1

243776973

-PTPRRchr12

71078044

-
5UTR-3CDSENST00000492957ENST00000440835AKT3chr1

243776973

-PTPRRchr12

71078044

-
5UTR-intronENST00000492957ENST00000537619AKT3chr1

243776973

-PTPRRchr12

71078044

-
5UTR-intronENST00000492957ENST00000378778AKT3chr1

243776973

-PTPRRchr12

71078044

-
5UTR-intronENST00000492957ENST00000342084AKT3chr1

243776973

-PTPRRchr12

71078044

-
5UTR-intronENST00000492957ENST00000549308AKT3chr1

243776973

-PTPRRchr12

71078044

-

Top

FusionProtFeatures for AKT3_PTPRR


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AKT3

Q9Y243

PTPRR

Q15256

AKT3 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, andwhich regulate many processes including metabolism, proliferation,cell survival, growth and angiogenesis. This is mediated throughserine and/or threonine phosphorylation of a range of downstreamsubstrates. Over 100 substrate candidates have been reported sofar, but for most of them, no isoform specificity has beenreported. AKT3 is the least studied AKT isoform. It plays animportant role in brain development and is crucial for theviability of malignant glioma cells. AKT3 isoform may also be thekey molecule in up-regulation and down-regulation of MMP13 viaIL13. Required for the coordination of mitochondrial biogenesiswith growth factor-induced increases in cellular energy demands.Down-regulation by RNA interference reduces the expression of thephosphorylated form of BAD, resulting in the induction of caspase-dependent apoptosis. {ECO:0000269|PubMed:18524868,ECO:0000269|PubMed:21191416}. Sequesters mitogen-activated protein kinases (MAPKs)such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactiveform. The MAPKs bind to a dephosphorylated kinase interactingmotif, phosphorylation of which by the protein kinase A complexreleases the MAPKs for activation and translocation into thenucleus (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAKT3chr1:243776973chr12:71078044ENST00000263826-7135_107232480DomainPH
HgeneAKT3chr1:243776973chr12:71078044ENST00000336199-7145_107232476DomainPH
HgeneAKT3chr1:243776973chr12:71078044ENST00000366539-8145_107232480DomainPH
HgeneAKT3chr1:243776973chr12:71078044ENST00000366540-8145_107232466DomainPH
HgeneAKT3chr1:243776973chr12:71078044ENST00000263826-713154_162232480Nucleotide bindingATP
HgeneAKT3chr1:243776973chr12:71078044ENST00000336199-714154_162232476Nucleotide bindingATP
HgeneAKT3chr1:243776973chr12:71078044ENST00000366539-814154_162232480Nucleotide bindingATP
HgeneAKT3chr1:243776973chr12:71078044ENST00000366540-814154_162232466Nucleotide bindingATP
TgenePTPRRchr1:243776973chr12:71078044ENST00000342084-713393_647341546DomainTyrosine-protein phosphatase
TgenePTPRRchr1:243776973chr12:71078044ENST00000378778-511393_647247452DomainTyrosine-protein phosphatase
TgenePTPRRchr1:243776973chr12:71078044ENST00000440835-410393_647208413DomainTyrosine-protein phosphatase
TgenePTPRRchr1:243776973chr12:71078044ENST00000549308-511393_647208413DomainTyrosine-protein phosphatase
TgenePTPRRchr1:243776973chr12:71078044ENST00000283228-814588_594453658RegionSubstrate binding
TgenePTPRRchr1:243776973chr12:71078044ENST00000342084-713588_594341546RegionSubstrate binding
TgenePTPRRchr1:243776973chr12:71078044ENST00000378778-511588_594247452RegionSubstrate binding
TgenePTPRRchr1:243776973chr12:71078044ENST00000440835-410588_594208413RegionSubstrate binding
TgenePTPRRchr1:243776973chr12:71078044ENST00000549308-511588_594208413RegionSubstrate binding
TgenePTPRRchr1:243776973chr12:71078044ENST00000378778-511249_657247452Topological domainCytoplasmic
TgenePTPRRchr1:243776973chr12:71078044ENST00000440835-410249_657208413Topological domainCytoplasmic
TgenePTPRRchr1:243776973chr12:71078044ENST00000549308-511249_657208413Topological domainCytoplasmic
TgenePTPRRchr1:243776973chr12:71078044ENST00000440835-410228_248208413TransmembraneHelical
TgenePTPRRchr1:243776973chr12:71078044ENST00000549308-511228_248208413TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAKT3chr1:243776973chr12:71078044ENST00000263826-713148_405232480DomainProtein kinase
HgeneAKT3chr1:243776973chr12:71078044ENST00000263826-713406_479232480DomainNote=AGC-kinase C-terminal
HgeneAKT3chr1:243776973chr12:71078044ENST00000336199-714148_405232476DomainProtein kinase
HgeneAKT3chr1:243776973chr12:71078044ENST00000336199-714406_479232476DomainNote=AGC-kinase C-terminal
HgeneAKT3chr1:243776973chr12:71078044ENST00000366539-814148_405232480DomainProtein kinase
HgeneAKT3chr1:243776973chr12:71078044ENST00000366539-814406_479232480DomainNote=AGC-kinase C-terminal
HgeneAKT3chr1:243776973chr12:71078044ENST00000366540-814148_405232466DomainProtein kinase
HgeneAKT3chr1:243776973chr12:71078044ENST00000366540-814406_479232466DomainNote=AGC-kinase C-terminal
TgenePTPRRchr1:243776973chr12:71078044ENST00000283228-814393_647453658DomainTyrosine-protein phosphatase
TgenePTPRRchr1:243776973chr12:71078044ENST00000283228-81422_227453658Topological domainExtracellular
TgenePTPRRchr1:243776973chr12:71078044ENST00000283228-814249_657453658Topological domainCytoplasmic
TgenePTPRRchr1:243776973chr12:71078044ENST00000342084-71322_227341546Topological domainExtracellular
TgenePTPRRchr1:243776973chr12:71078044ENST00000342084-713249_657341546Topological domainCytoplasmic
TgenePTPRRchr1:243776973chr12:71078044ENST00000378778-51122_227247452Topological domainExtracellular
TgenePTPRRchr1:243776973chr12:71078044ENST00000440835-41022_227208413Topological domainExtracellular
TgenePTPRRchr1:243776973chr12:71078044ENST00000549308-51122_227208413Topological domainExtracellular
TgenePTPRRchr1:243776973chr12:71078044ENST00000283228-814228_248453658TransmembraneHelical
TgenePTPRRchr1:243776973chr12:71078044ENST00000342084-713228_248341546TransmembraneHelical
TgenePTPRRchr1:243776973chr12:71078044ENST00000378778-511228_248247452TransmembraneHelical


Top

FusionGeneSequence for AKT3_PTPRR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AKT3_ENST00000336199_chr1_243776973_-_PTPRR_ENST00000283228_chr12_71078044_-_437aa
MSDVTIVKEGWVQKRGETIKNWRPRYFLLKTDGSFIGTKEKPQDVDLPTPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVD
TPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDTLKLLGKGTFGKVILVREKASGKYTAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKTSFQTKDRLCFVMETVNGGEGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMI
TKLKEKNEKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGR

>In-frame_AKT3_ENST00000336199_chr1_243776973_-_PTPRR_ENST00000440835_chr12_71078044_-_437aa
MSDVTIVKEGWVQKRGETIKNWRPRYFLLKTDGSFIGTKEKPQDVDLPTPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVD
TPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDTLKLLGKGTFGKVILVREKASGKYTAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKTSFQTKDRLCFVMETVNGGEGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMI
TKLKEKNEKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGR

>In-frame_AKT3_ENST00000366540_chr1_243776973_-_PTPRR_ENST00000283228_chr12_71078044_-_437aa
MSDVTIVKEGWVQKRGETIKNWRPRYFLLKTDGSFIGTKEKPQDVDLPTPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVD
TPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDTLKLLGKGTFGKVILVREKASGKYTAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKTSFQTKDRLCFVMETVNGGEGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMI
TKLKEKNEKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGR

>In-frame_AKT3_ENST00000366540_chr1_243776973_-_PTPRR_ENST00000440835_chr12_71078044_-_437aa
MSDVTIVKEGWVQKRGETIKNWRPRYFLLKTDGSFIGTKEKPQDVDLPTPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVD
TPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDTLKLLGKGTFGKVILVREKASGKYTAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKTSFQTKDRLCFVMETVNGGEGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMI
TKLKEKNEKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGR

>In-frame_AKT3_ENST00000263826_chr1_243776973_-_PTPRR_ENST00000283228_chr12_71078044_-_437aa
MSDVTIVKEGWVQKRGETIKNWRPRYFLLKTDGSFIGTKEKPQDVDLPTPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVD
TPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDTLKLLGKGTFGKVILVREKASGKYTAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKTSFQTKDRLCFVMETVNGGEGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMI
TKLKEKNEKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGR

>In-frame_AKT3_ENST00000263826_chr1_243776973_-_PTPRR_ENST00000440835_chr12_71078044_-_437aa
MSDVTIVKEGWVQKRGETIKNWRPRYFLLKTDGSFIGTKEKPQDVDLPTPLNNFSVAKCQLMKTERPKPNTFIIRCLQWTTVIERTFHVD
TPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDTLKLLGKGTFGKVILVREKASGKYTAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKTSFQTKDRLCFVMETVNGGEGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVMI
TKLKEKNEKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AKT3_ENST00000336199_chr1_243776973_-_PTPRR_ENST00000283228_chr12_71078044_-_1311nt
ATGAGCGATGTTACCATTGTGAAAGAAGGTTGGGTTCAGAAGAGGGGAGAATATATAAAAAACTGGAGGCCAAGATACTTCCTTTTGAAG
ACAGATGGCTCATTCATAGGATATAAAGAGAAACCTCAAGATGTGGATTTACCTTATCCCCTCAACAACTTTTCAGTGGCAAAATGCCAG
TTAATGAAAACAGAACGACCAAAGCCAAACACATTTATAATCAGATGTCTCCAGTGGACTACTGTTATAGAGAGAACATTTCATGTAGAT
ACTCCAGAGGAAAGGGAAGAATGGACAGAAGCTATCCAGGCTGTAGCAGACAGACTGCAGAGGCAAGAAGAGGAGAGAATGAATTGTAGT
CCAACTTCACAAATTGATAATATAGGAGAGGAAGAGATGGATGCCTCTACAACCCATCATAAAAGAAAGACAATGAATGATTTTGACTAT
TTGAAACTACTAGGTAAAGGCACTTTTGGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAG
AAAGAAGTCATTATTGCAAAGGATGAAGTGGCACACACTCTAACTGAAAGCAGAGTATTAAAGAACACTAGACATCCCTTTTTAACATCC
TTGAAATATTCCTTCCAGACAAAAGACCGTTTGTGTTTTGTGATGGAATATGTTAATGGGGGCGAGGGCTACAGTGGCAAGGAGAAAGCC
TTCATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATC
ACAAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGT
GTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCA
TGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGA
GGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAA
GGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCAC

>In-frame_AKT3_ENST00000336199_chr1_243776973_-_PTPRR_ENST00000440835_chr12_71078044_-_1311nt
ATGAGCGATGTTACCATTGTGAAAGAAGGTTGGGTTCAGAAGAGGGGAGAATATATAAAAAACTGGAGGCCAAGATACTTCCTTTTGAAG
ACAGATGGCTCATTCATAGGATATAAAGAGAAACCTCAAGATGTGGATTTACCTTATCCCCTCAACAACTTTTCAGTGGCAAAATGCCAG
TTAATGAAAACAGAACGACCAAAGCCAAACACATTTATAATCAGATGTCTCCAGTGGACTACTGTTATAGAGAGAACATTTCATGTAGAT
ACTCCAGAGGAAAGGGAAGAATGGACAGAAGCTATCCAGGCTGTAGCAGACAGACTGCAGAGGCAAGAAGAGGAGAGAATGAATTGTAGT
CCAACTTCACAAATTGATAATATAGGAGAGGAAGAGATGGATGCCTCTACAACCCATCATAAAAGAAAGACAATGAATGATTTTGACTAT
TTGAAACTACTAGGTAAAGGCACTTTTGGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAG
AAAGAAGTCATTATTGCAAAGGATGAAGTGGCACACACTCTAACTGAAAGCAGAGTATTAAAGAACACTAGACATCCCTTTTTAACATCC
TTGAAATATTCCTTCCAGACAAAAGACCGTTTGTGTTTTGTGATGGAATATGTTAATGGGGGCGAGGGCTACAGTGGCAAGGAGAAAGCC
TTCATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATC
ACAAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGT
GTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCA
TGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGA
GGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAA
GGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCAC

>In-frame_AKT3_ENST00000366540_chr1_243776973_-_PTPRR_ENST00000283228_chr12_71078044_-_1311nt
ATGAGCGATGTTACCATTGTGAAAGAAGGTTGGGTTCAGAAGAGGGGAGAATATATAAAAAACTGGAGGCCAAGATACTTCCTTTTGAAG
ACAGATGGCTCATTCATAGGATATAAAGAGAAACCTCAAGATGTGGATTTACCTTATCCCCTCAACAACTTTTCAGTGGCAAAATGCCAG
TTAATGAAAACAGAACGACCAAAGCCAAACACATTTATAATCAGATGTCTCCAGTGGACTACTGTTATAGAGAGAACATTTCATGTAGAT
ACTCCAGAGGAAAGGGAAGAATGGACAGAAGCTATCCAGGCTGTAGCAGACAGACTGCAGAGGCAAGAAGAGGAGAGAATGAATTGTAGT
CCAACTTCACAAATTGATAATATAGGAGAGGAAGAGATGGATGCCTCTACAACCCATCATAAAAGAAAGACAATGAATGATTTTGACTAT
TTGAAACTACTAGGTAAAGGCACTTTTGGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAG
AAAGAAGTCATTATTGCAAAGGATGAAGTGGCACACACTCTAACTGAAAGCAGAGTATTAAAGAACACTAGACATCCCTTTTTAACATCC
TTGAAATATTCCTTCCAGACAAAAGACCGTTTGTGTTTTGTGATGGAATATGTTAATGGGGGCGAGGGCTACAGTGGCAAGGAGAAAGCC
TTCATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATC
ACAAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGT
GTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCA
TGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGA
GGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAA
GGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCAC

>In-frame_AKT3_ENST00000366540_chr1_243776973_-_PTPRR_ENST00000440835_chr12_71078044_-_1311nt
ATGAGCGATGTTACCATTGTGAAAGAAGGTTGGGTTCAGAAGAGGGGAGAATATATAAAAAACTGGAGGCCAAGATACTTCCTTTTGAAG
ACAGATGGCTCATTCATAGGATATAAAGAGAAACCTCAAGATGTGGATTTACCTTATCCCCTCAACAACTTTTCAGTGGCAAAATGCCAG
TTAATGAAAACAGAACGACCAAAGCCAAACACATTTATAATCAGATGTCTCCAGTGGACTACTGTTATAGAGAGAACATTTCATGTAGAT
ACTCCAGAGGAAAGGGAAGAATGGACAGAAGCTATCCAGGCTGTAGCAGACAGACTGCAGAGGCAAGAAGAGGAGAGAATGAATTGTAGT
CCAACTTCACAAATTGATAATATAGGAGAGGAAGAGATGGATGCCTCTACAACCCATCATAAAAGAAAGACAATGAATGATTTTGACTAT
TTGAAACTACTAGGTAAAGGCACTTTTGGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAG
AAAGAAGTCATTATTGCAAAGGATGAAGTGGCACACACTCTAACTGAAAGCAGAGTATTAAAGAACACTAGACATCCCTTTTTAACATCC
TTGAAATATTCCTTCCAGACAAAAGACCGTTTGTGTTTTGTGATGGAATATGTTAATGGGGGCGAGGGCTACAGTGGCAAGGAGAAAGCC
TTCATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATC
ACAAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGT
GTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCA
TGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGA
GGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAA
GGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCAC

>In-frame_AKT3_ENST00000263826_chr1_243776973_-_PTPRR_ENST00000283228_chr12_71078044_-_1311nt
ATGAGCGATGTTACCATTGTGAAAGAAGGTTGGGTTCAGAAGAGGGGAGAATATATAAAAAACTGGAGGCCAAGATACTTCCTTTTGAAG
ACAGATGGCTCATTCATAGGATATAAAGAGAAACCTCAAGATGTGGATTTACCTTATCCCCTCAACAACTTTTCAGTGGCAAAATGCCAG
TTAATGAAAACAGAACGACCAAAGCCAAACACATTTATAATCAGATGTCTCCAGTGGACTACTGTTATAGAGAGAACATTTCATGTAGAT
ACTCCAGAGGAAAGGGAAGAATGGACAGAAGCTATCCAGGCTGTAGCAGACAGACTGCAGAGGCAAGAAGAGGAGAGAATGAATTGTAGT
CCAACTTCACAAATTGATAATATAGGAGAGGAAGAGATGGATGCCTCTACAACCCATCATAAAAGAAAGACAATGAATGATTTTGACTAT
TTGAAACTACTAGGTAAAGGCACTTTTGGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAG
AAAGAAGTCATTATTGCAAAGGATGAAGTGGCACACACTCTAACTGAAAGCAGAGTATTAAAGAACACTAGACATCCCTTTTTAACATCC
TTGAAATATTCCTTCCAGACAAAAGACCGTTTGTGTTTTGTGATGGAATATGTTAATGGGGGCGAGGGCTACAGTGGCAAGGAGAAAGCC
TTCATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATC
ACAAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGT
GTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCA
TGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGA
GGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAA
GGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCAC

>In-frame_AKT3_ENST00000263826_chr1_243776973_-_PTPRR_ENST00000440835_chr12_71078044_-_1311nt
ATGAGCGATGTTACCATTGTGAAAGAAGGTTGGGTTCAGAAGAGGGGAGAATATATAAAAAACTGGAGGCCAAGATACTTCCTTTTGAAG
ACAGATGGCTCATTCATAGGATATAAAGAGAAACCTCAAGATGTGGATTTACCTTATCCCCTCAACAACTTTTCAGTGGCAAAATGCCAG
TTAATGAAAACAGAACGACCAAAGCCAAACACATTTATAATCAGATGTCTCCAGTGGACTACTGTTATAGAGAGAACATTTCATGTAGAT
ACTCCAGAGGAAAGGGAAGAATGGACAGAAGCTATCCAGGCTGTAGCAGACAGACTGCAGAGGCAAGAAGAGGAGAGAATGAATTGTAGT
CCAACTTCACAAATTGATAATATAGGAGAGGAAGAGATGGATGCCTCTACAACCCATCATAAAAGAAAGACAATGAATGATTTTGACTAT
TTGAAACTACTAGGTAAAGGCACTTTTGGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAG
AAAGAAGTCATTATTGCAAAGGATGAAGTGGCACACACTCTAACTGAAAGCAGAGTATTAAAGAACACTAGACATCCCTTTTTAACATCC
TTGAAATATTCCTTCCAGACAAAAGACCGTTTGTGTTTTGTGATGGAATATGTTAATGGGGGCGAGGGCTACAGTGGCAAGGAGAAAGCC
TTCATTGCCACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATC
ACAAAACTCAAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGT
GTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCA
TGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGA
GGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAA
GGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_AKT3_ENST00000336199_chr1_243776973_-_PTPRR_ENST00000283228_chr12_71078044_-_2479nt
CCAAACCCTAAAGCTGATATCACAAAGTACCATTTCTCCAAGTTGGGGGCTCAGAGGGGAGTCATCATGAGCGATGTTACCATTGTGAAA
GAAGGTTGGGTTCAGAAGAGGGGAGAATATATAAAAAACTGGAGGCCAAGATACTTCCTTTTGAAGACAGATGGCTCATTCATAGGATAT
AAAGAGAAACCTCAAGATGTGGATTTACCTTATCCCCTCAACAACTTTTCAGTGGCAAAATGCCAGTTAATGAAAACAGAACGACCAAAG
CCAAACACATTTATAATCAGATGTCTCCAGTGGACTACTGTTATAGAGAGAACATTTCATGTAGATACTCCAGAGGAAAGGGAAGAATGG
ACAGAAGCTATCCAGGCTGTAGCAGACAGACTGCAGAGGCAAGAAGAGGAGAGAATGAATTGTAGTCCAACTTCACAAATTGATAATATA
GGAGAGGAAGAGATGGATGCCTCTACAACCCATCATAAAAGAAAGACAATGAATGATTTTGACTATTTGAAACTACTAGGTAAAGGCACT
TTTGGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAGAAAGAAGTCATTATTGCAAAGGAT
GAAGTGGCACACACTCTAACTGAAAGCAGAGTATTAAAGAACACTAGACATCCCTTTTTAACATCCTTGAAATATTCCTTCCAGACAAAA
GACCGTTTGTGTTTTGTGATGGAATATGTTAATGGGGGCGAGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAGGGCCCCATG
ATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAAGAAAAAAATGAG
AAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTACACC
ATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAGACTCCAGAC
AGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTGCAGT
GCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATT
GTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGAGAGC
AGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGGGTGATTAATCAAATTACCCACCCAAGG
CTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGGATTGTGGAAGACTGGGCAACATATTTA
AGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGTTTTTTGATGATGGAGGTATGATAGGTT
TATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGTATGTATGTAATATTCAGTAATAAATGT
CATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGTTTGCAAAATCTGTCTTGTGAATGGACT
GTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGCTGCTAAAGTTGCAAGTGATTGATAATG
GATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATATGGAAATGTGTCTTGATAATATTACCT
ATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGGTATATATGTATTTACTCTCTATTATTG
GGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTTACTTTAAAAGGGAAAAACAAATTTGTA
GCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGAATATGCTATCTACCTGGAATCTCTCTC
TCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAAGGACATTTCCATGTATGTCCTTACATT
TCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTAGCTGTTCTGCTCATATATGAATTTTTA

>In-frame_AKT3_ENST00000336199_chr1_243776973_-_PTPRR_ENST00000440835_chr12_71078044_-_2488nt
CCAAACCCTAAAGCTGATATCACAAAGTACCATTTCTCCAAGTTGGGGGCTCAGAGGGGAGTCATCATGAGCGATGTTACCATTGTGAAA
GAAGGTTGGGTTCAGAAGAGGGGAGAATATATAAAAAACTGGAGGCCAAGATACTTCCTTTTGAAGACAGATGGCTCATTCATAGGATAT
AAAGAGAAACCTCAAGATGTGGATTTACCTTATCCCCTCAACAACTTTTCAGTGGCAAAATGCCAGTTAATGAAAACAGAACGACCAAAG
CCAAACACATTTATAATCAGATGTCTCCAGTGGACTACTGTTATAGAGAGAACATTTCATGTAGATACTCCAGAGGAAAGGGAAGAATGG
ACAGAAGCTATCCAGGCTGTAGCAGACAGACTGCAGAGGCAAGAAGAGGAGAGAATGAATTGTAGTCCAACTTCACAAATTGATAATATA
GGAGAGGAAGAGATGGATGCCTCTACAACCCATCATAAAAGAAAGACAATGAATGATTTTGACTATTTGAAACTACTAGGTAAAGGCACT
TTTGGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAGAAAGAAGTCATTATTGCAAAGGAT
GAAGTGGCACACACTCTAACTGAAAGCAGAGTATTAAAGAACACTAGACATCCCTTTTTAACATCCTTGAAATATTCCTTCCAGACAAAA
GACCGTTTGTGTTTTGTGATGGAATATGTTAATGGGGGCGAGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAGGGCCCCATG
ATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAAGAAAAAAATGAG
AAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTACACC
ATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAGACTCCAGAC
AGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTGCAGT
GCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATT
GTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGAGAGC
AGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGGGTGATTAATCAAATTACCCACCCAAGG
CTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGGATTGTGGAAGACTGGGCAACATATTTA
AGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGTTTTTTGATGATGGAGGTATGATAGGTT
TATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGTATGTATGTAATATTCAGTAATAAATGT
CATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGTTTGCAAAATCTGTCTTGTGAATGGACT
GTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGCTGCTAAAGTTGCAAGTGATTGATAATG
GATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATATGGAAATGTGTCTTGATAATATTACCT
ATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGGTATATATGTATTTACTCTCTATTATTG
GGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTTACTTTAAAAGGGAAAAACAAATTTGTA
GCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGAATATGCTATCTACCTGGAATCTCTCTC
TCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAAGGACATTTCCATGTATGTCCTTACATT
TCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTAGCTGTTCTGCTCATATATGAATTTTTA

>In-frame_AKT3_ENST00000366540_chr1_243776973_-_PTPRR_ENST00000283228_chr12_71078044_-_2566nt
CTCAAATACACATCACCAAACAAATTTTCTCTATTATTTGGGCTGAGTCATCACTAGAGAGTGGGAAGGGCAGCAGCAGCAGAGAATCCA
AACCCTAAAGCTGATATCACAAAGTACCATTTCTCCAAGTTGGGGGCTCAGAGGGGAGTCATCATGAGCGATGTTACCATTGTGAAAGAA
GGTTGGGTTCAGAAGAGGGGAGAATATATAAAAAACTGGAGGCCAAGATACTTCCTTTTGAAGACAGATGGCTCATTCATAGGATATAAA
GAGAAACCTCAAGATGTGGATTTACCTTATCCCCTCAACAACTTTTCAGTGGCAAAATGCCAGTTAATGAAAACAGAACGACCAAAGCCA
AACACATTTATAATCAGATGTCTCCAGTGGACTACTGTTATAGAGAGAACATTTCATGTAGATACTCCAGAGGAAAGGGAAGAATGGACA
GAAGCTATCCAGGCTGTAGCAGACAGACTGCAGAGGCAAGAAGAGGAGAGAATGAATTGTAGTCCAACTTCACAAATTGATAATATAGGA
GAGGAAGAGATGGATGCCTCTACAACCCATCATAAAAGAAAGACAATGAATGATTTTGACTATTTGAAACTACTAGGTAAAGGCACTTTT
GGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAGAAAGAAGTCATTATTGCAAAGGATGAA
GTGGCACACACTCTAACTGAAAGCAGAGTATTAAAGAACACTAGACATCCCTTTTTAACATCCTTGAAATATTCCTTCCAGACAAAAGAC
CGTTTGTGTTTTGTGATGGAATATGTTAATGGGGGCGAGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAGGGCCCCATGATC
AACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAAGAAAAAAATGAGAAA
TGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTACACCATT
CGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAGACTCCAGACAGT
GCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTGCAGTGCA
GGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTC
TGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGAGAGCAGA
CTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGGGTGATTAATCAAATTACCCACCCAAGGCTT
CTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGGATTGTGGAAGACTGGGCAACATATTTAAGA
TTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGTTTTTTGATGATGGAGGTATGATAGGTTTAT
CACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGTATGTATGTAATATTCAGTAATAAATGTCAT
CAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGTTTGCAAAATCTGTCTTGTGAATGGACTGTC
AGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGCTGCTAAAGTTGCAAGTGATTGATAATGGAT
TTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATATGGAAATGTGTCTTGATAATATTACCTATT
AAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGGTATATATGTATTTACTCTCTATTATTGGGC
ATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTTACTTTAAAAGGGAAAAACAAATTTGTAGCA
ACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGAATATGCTATCTACCTGGAATCTCTCTCTCA
ACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAAGGACATTTCCATGTATGTCCTTACATTTCT
GAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTAGCTGTTCTGCTCATATATGAATTTTTAATG

>In-frame_AKT3_ENST00000366540_chr1_243776973_-_PTPRR_ENST00000440835_chr12_71078044_-_2575nt
CTCAAATACACATCACCAAACAAATTTTCTCTATTATTTGGGCTGAGTCATCACTAGAGAGTGGGAAGGGCAGCAGCAGCAGAGAATCCA
AACCCTAAAGCTGATATCACAAAGTACCATTTCTCCAAGTTGGGGGCTCAGAGGGGAGTCATCATGAGCGATGTTACCATTGTGAAAGAA
GGTTGGGTTCAGAAGAGGGGAGAATATATAAAAAACTGGAGGCCAAGATACTTCCTTTTGAAGACAGATGGCTCATTCATAGGATATAAA
GAGAAACCTCAAGATGTGGATTTACCTTATCCCCTCAACAACTTTTCAGTGGCAAAATGCCAGTTAATGAAAACAGAACGACCAAAGCCA
AACACATTTATAATCAGATGTCTCCAGTGGACTACTGTTATAGAGAGAACATTTCATGTAGATACTCCAGAGGAAAGGGAAGAATGGACA
GAAGCTATCCAGGCTGTAGCAGACAGACTGCAGAGGCAAGAAGAGGAGAGAATGAATTGTAGTCCAACTTCACAAATTGATAATATAGGA
GAGGAAGAGATGGATGCCTCTACAACCCATCATAAAAGAAAGACAATGAATGATTTTGACTATTTGAAACTACTAGGTAAAGGCACTTTT
GGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAGAAAGAAGTCATTATTGCAAAGGATGAA
GTGGCACACACTCTAACTGAAAGCAGAGTATTAAAGAACACTAGACATCCCTTTTTAACATCCTTGAAATATTCCTTCCAGACAAAAGAC
CGTTTGTGTTTTGTGATGGAATATGTTAATGGGGGCGAGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCCACGCAGGGCCCCATGATC
AACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTCAAAGAAAAAAATGAGAAA
TGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTACACCATT
CGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAGACTCCAGACAGT
GCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTGCAGTGCA
GGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTC
TGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGAGAGCAGA
CTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGGGTGATTAATCAAATTACCCACCCAAGGCTT
CTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGGATTGTGGAAGACTGGGCAACATATTTAAGA
TTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGTTTTTTGATGATGGAGGTATGATAGGTTTAT
CACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGTATGTATGTAATATTCAGTAATAAATGTCAT
CAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGTTTGCAAAATCTGTCTTGTGAATGGACTGTC
AGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGCTGCTAAAGTTGCAAGTGATTGATAATGGAT
TTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATATGGAAATGTGTCTTGATAATATTACCTATT
AAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGGTATATATGTATTTACTCTCTATTATTGGGC
ATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTTACTTTAAAAGGGAAAAACAAATTTGTAGCA
ACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGAATATGCTATCTACCTGGAATCTCTCTCTCA
ACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAAGGACATTTCCATGTATGTCCTTACATTTCT
GAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTAGCTGTTCTGCTCATATATGAATTTTTAATG

>In-frame_AKT3_ENST00000263826_chr1_243776973_-_PTPRR_ENST00000283228_chr12_71078044_-_2494nt
GCAGCAGCAGAGAATCCAAACCCTAAAGCTGATATCACAAAGTACCATTTCTCCAAGTTGGGGGCTCAGAGGGGAGTCATCATGAGCGAT
GTTACCATTGTGAAAGAAGGTTGGGTTCAGAAGAGGGGAGAATATATAAAAAACTGGAGGCCAAGATACTTCCTTTTGAAGACAGATGGC
TCATTCATAGGATATAAAGAGAAACCTCAAGATGTGGATTTACCTTATCCCCTCAACAACTTTTCAGTGGCAAAATGCCAGTTAATGAAA
ACAGAACGACCAAAGCCAAACACATTTATAATCAGATGTCTCCAGTGGACTACTGTTATAGAGAGAACATTTCATGTAGATACTCCAGAG
GAAAGGGAAGAATGGACAGAAGCTATCCAGGCTGTAGCAGACAGACTGCAGAGGCAAGAAGAGGAGAGAATGAATTGTAGTCCAACTTCA
CAAATTGATAATATAGGAGAGGAAGAGATGGATGCCTCTACAACCCATCATAAAAGAAAGACAATGAATGATTTTGACTATTTGAAACTA
CTAGGTAAAGGCACTTTTGGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAGAAAGAAGTC
ATTATTGCAAAGGATGAAGTGGCACACACTCTAACTGAAAGCAGAGTATTAAAGAACACTAGACATCCCTTTTTAACATCCTTGAAATAT
TCCTTCCAGACAAAAGACCGTTTGTGTTTTGTGATGGAATATGTTAATGGGGGCGAGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCC
ACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTC
AAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAA
TGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGAT
CACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTG
GTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTG
GATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTG
TGCCTGTATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGGGTGATTAATCAA
ATTACCCACCCAAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGGATTGTGGAAGAC
TGGGCAACATATTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGTTTTTTGATGATG
GAGGTATGATAGGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGTATGTATGTAATA
TTCAGTAATAAATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGTTTGCAAAATCTG
TCTTGTGAATGGACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGCTGCTAAAGTTGC
AAGTGATTGATAATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATATGGAAATGTGTC
TTGATAATATTACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGGTATATATGTATT
TACTCTCTATTATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTTACTTTAAAAGGG
AAAAACAAATTTGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGAATATGCTATCTA
CCTGGAATCTCTCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAAGGACATTTCCAT
GTATGTCCTTACATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTAGCTGTTCTGCTC

>In-frame_AKT3_ENST00000263826_chr1_243776973_-_PTPRR_ENST00000440835_chr12_71078044_-_2503nt
GCAGCAGCAGAGAATCCAAACCCTAAAGCTGATATCACAAAGTACCATTTCTCCAAGTTGGGGGCTCAGAGGGGAGTCATCATGAGCGAT
GTTACCATTGTGAAAGAAGGTTGGGTTCAGAAGAGGGGAGAATATATAAAAAACTGGAGGCCAAGATACTTCCTTTTGAAGACAGATGGC
TCATTCATAGGATATAAAGAGAAACCTCAAGATGTGGATTTACCTTATCCCCTCAACAACTTTTCAGTGGCAAAATGCCAGTTAATGAAA
ACAGAACGACCAAAGCCAAACACATTTATAATCAGATGTCTCCAGTGGACTACTGTTATAGAGAGAACATTTCATGTAGATACTCCAGAG
GAAAGGGAAGAATGGACAGAAGCTATCCAGGCTGTAGCAGACAGACTGCAGAGGCAAGAAGAGGAGAGAATGAATTGTAGTCCAACTTCA
CAAATTGATAATATAGGAGAGGAAGAGATGGATGCCTCTACAACCCATCATAAAAGAAAGACAATGAATGATTTTGACTATTTGAAACTA
CTAGGTAAAGGCACTTTTGGGAAAGTTATTTTGGTTCGAGAGAAGGCAAGTGGAAAATACTATGCTATGAAGATTCTGAAGAAAGAAGTC
ATTATTGCAAAGGATGAAGTGGCACACACTCTAACTGAAAGCAGAGTATTAAAGAACACTAGACATCCCTTTTTAACATCCTTGAAATAT
TCCTTCCAGACAAAAGACCGTTTGTGTTTTGTGATGGAATATGTTAATGGGGGCGAGGGCTACAGTGGCAAGGAGAAAGCCTTCATTGCC
ACGCAGGGCCCCATGATCAACACCGTGGATGATTTCTGGCAGATGGTTTGGCAGGAAGACAGCCCTGTGATTGTTATGATCACAAAACTC
AAAGAAAAAAATGAGAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAA
TGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGAT
CACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTG
GTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTG
GATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTG
TGCCTGTATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGGGTGATTAATCAA
ATTACCCACCCAAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGGATTGTGGAAGAC
TGGGCAACATATTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGTTTTTTGATGATG
GAGGTATGATAGGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGTATGTATGTAATA
TTCAGTAATAAATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGTTTGCAAAATCTG
TCTTGTGAATGGACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGCTGCTAAAGTTGC
AAGTGATTGATAATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATATGGAAATGTGTC
TTGATAATATTACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGGTATATATGTATT
TACTCTCTATTATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTTACTTTAAAAGGG
AAAAACAAATTTGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGAATATGCTATCTA
CCTGGAATCTCTCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAAGGACATTTCCAT
GTATGTCCTTACATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTAGCTGTTCTGCTC


Top

FusionGenePPI for AKT3_PTPRR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AKT3TCL1A, PRKCZ, NEDD4, TTC3, NEDD4L, GSK3B, PLEKHO1, EIF4EBP1, RPE, CASP3, AKT1, HSP90AB4P, HSP90AB3P, HSP90AA4P, HSP90AA5P, PIANP, HSP90AB1, FKBP5, HSP90AA1, CDC37, SNX8, TOX2, PRMT6, PPP2CAPTPRRMAPK1, MAPK3, MAPK7, MAPK14, NTRK1, CEP290, EGFR, ERBB2, IGF1R, RET, MST1R, ERBB4, FGFR2, FGFR4, KDR, TEK, INSR, ALDH18A1, DHPS, PNMA2, TRIM11, KIAA0196, TBC1D5, DNAJC13, SNX6, PTPRR, MAPK1IP1L, MAPKAPK3, MAD2L1BP, CBS, MAPK11, CCT8L1P, HSPA4L, LMTK2, AATK, ERBB3, RYK, ROR1, ROR2, PTK7, EPHA2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AKT3_PTPRR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for AKT3_PTPRR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneAKT3C4014738MEGALENCEPHALY-POLYMICROGYRIA-POLYDACTYLY-HYDROCEPHALUS SYNDROME 23UNIPROT
HgeneAKT3C1863924Megalanecephaly Polymicrogyria-Polydactyly Hydrocephalus Syndrome1CTD_human
HgeneAKT3C1955869Malformations of Cortical Development1CTD_human
TgenePTPRRC0041696Unipolar Depression1PSYGENET
TgenePTPRRC1269683Major Depressive Disorder1PSYGENET