FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14168

FusionGeneSummary for FZR1_CNN1

check button Fusion gene summary
Fusion gene informationFusion gene name: FZR1_CNN1
Fusion gene ID: 14168
HgeneTgene
Gene symbol

FZR1

CNN1

Gene ID

51343

1264

Gene namefizzy and cell division cycle 20 related 1calponin 1
SynonymsCDC20C|CDH1|FZR|FZR2|HCDH|HCDH1HEL-S-14|SMCC|Sm-Calp
Cytomap

19p13.3

19p13.2

Type of geneprotein-codingprotein-coding
Descriptionfizzy-related protein homologCDC20 homolog 1CDC20-like 1bCDC20-like protein 1cdh1/Hct1 homologfizzy/cell division cycle 20 related 1calponin-1basic calponincalponin 1, basic, smooth musclecalponin H1, smooth musclecalponins, basicepididymis secretory protein Li 14
Modification date2018051920180519
UniProtAcc

Q9UM11

P51911

Ensembl transtripts involved in fusion geneENST00000441788, ENST00000313639, 
ENST00000395095, 
ENST00000252456, 
ENST00000592923, ENST00000535659, 
ENST00000588468, ENST00000544952, 
Fusion gene scores* DoF score7 X 5 X 7=2453 X 1 X 2=6
# samples 83
** MAII scorelog2(8/245*10)=-1.61470984411521
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/6*10)=2.32192809488736
Context

PubMed: FZR1 [Title/Abstract] AND CNN1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFZR1

GO:0031145

anaphase-promoting complex-dependent catabolic process

18662541|21596315

HgeneFZR1

GO:0072425

signal transduction involved in G2 DNA damage checkpoint

18662541

HgeneFZR1

GO:1904668

positive regulation of ubiquitin protein ligase activity

11459826


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-39-5019-01AFZR1chr19

3523056

+CNN1chr19

11651891

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000441788ENST00000252456FZR1chr19

3523056

+CNN1chr19

11651891

+
5CDS-5UTRENST00000441788ENST00000592923FZR1chr19

3523056

+CNN1chr19

11651891

+
5CDS-5UTRENST00000441788ENST00000535659FZR1chr19

3523056

+CNN1chr19

11651891

+
5CDS-3UTRENST00000441788ENST00000588468FZR1chr19

3523056

+CNN1chr19

11651891

+
5CDS-3UTRENST00000441788ENST00000544952FZR1chr19

3523056

+CNN1chr19

11651891

+
In-frameENST00000313639ENST00000252456FZR1chr19

3523056

+CNN1chr19

11651891

+
5CDS-5UTRENST00000313639ENST00000592923FZR1chr19

3523056

+CNN1chr19

11651891

+
5CDS-5UTRENST00000313639ENST00000535659FZR1chr19

3523056

+CNN1chr19

11651891

+
5CDS-3UTRENST00000313639ENST00000588468FZR1chr19

3523056

+CNN1chr19

11651891

+
5CDS-3UTRENST00000313639ENST00000544952FZR1chr19

3523056

+CNN1chr19

11651891

+
In-frameENST00000395095ENST00000252456FZR1chr19

3523056

+CNN1chr19

11651891

+
5CDS-5UTRENST00000395095ENST00000592923FZR1chr19

3523056

+CNN1chr19

11651891

+
5CDS-5UTRENST00000395095ENST00000535659FZR1chr19

3523056

+CNN1chr19

11651891

+
5CDS-3UTRENST00000395095ENST00000588468FZR1chr19

3523056

+CNN1chr19

11651891

+
5CDS-3UTRENST00000395095ENST00000544952FZR1chr19

3523056

+CNN1chr19

11651891

+

Top

FusionProtFeatures for FZR1_CNN1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FZR1

Q9UM11

CNN1

P51911

Thin filament-associated protein that is implicated inthe regulation and modulation of smooth muscle contraction. It iscapable of binding to actin, calmodulin, troponin C andtropomyosin. The interaction of calponin with actin inhibits theactomyosin Mg-ATPase activity (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCNN1chr19:3523056chr19:11651891ENST00000252456+0728_13121298DomainCalponin-homology (CH)
TgeneCNN1chr19:3523056chr19:11651891ENST00000252456+07164_18921298RepeatNote=Calponin-like 1
TgeneCNN1chr19:3523056chr19:11651891ENST00000252456+07204_22921298RepeatNote=Calponin-like 2
TgeneCNN1chr19:3523056chr19:11651891ENST00000252456+07243_26821298RepeatNote=Calponin-like 3

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFZR1chr19:3523056chr19:11651891ENST00000313639+111182_22223405RepeatNote=WD 1
HgeneFZR1chr19:3523056chr19:11651891ENST00000313639+111227_26623405RepeatNote=WD 2
HgeneFZR1chr19:3523056chr19:11651891ENST00000313639+111269_30623405RepeatNote=WD 3
HgeneFZR1chr19:3523056chr19:11651891ENST00000313639+111311_35023405RepeatNote=WD 4
HgeneFZR1chr19:3523056chr19:11651891ENST00000313639+111353_39523405RepeatNote=WD 5
HgeneFZR1chr19:3523056chr19:11651891ENST00000313639+111397_43823405RepeatNote=WD 6
HgeneFZR1chr19:3523056chr19:11651891ENST00000313639+111441_48023405RepeatNote=WD 7
HgeneFZR1chr19:3523056chr19:11651891ENST00000395095+113182_22223497RepeatNote=WD 1
HgeneFZR1chr19:3523056chr19:11651891ENST00000395095+113227_26623497RepeatNote=WD 2
HgeneFZR1chr19:3523056chr19:11651891ENST00000395095+113269_30623497RepeatNote=WD 3
HgeneFZR1chr19:3523056chr19:11651891ENST00000395095+113311_35023497RepeatNote=WD 4
HgeneFZR1chr19:3523056chr19:11651891ENST00000395095+113353_39523497RepeatNote=WD 5
HgeneFZR1chr19:3523056chr19:11651891ENST00000395095+113397_43823497RepeatNote=WD 6
HgeneFZR1chr19:3523056chr19:11651891ENST00000395095+113441_48023497RepeatNote=WD 7
HgeneFZR1chr19:3523056chr19:11651891ENST00000441788+214182_22223494RepeatNote=WD 1
HgeneFZR1chr19:3523056chr19:11651891ENST00000441788+214227_26623494RepeatNote=WD 2
HgeneFZR1chr19:3523056chr19:11651891ENST00000441788+214269_30623494RepeatNote=WD 3
HgeneFZR1chr19:3523056chr19:11651891ENST00000441788+214311_35023494RepeatNote=WD 4
HgeneFZR1chr19:3523056chr19:11651891ENST00000441788+214353_39523494RepeatNote=WD 5
HgeneFZR1chr19:3523056chr19:11651891ENST00000441788+214397_43823494RepeatNote=WD 6
HgeneFZR1chr19:3523056chr19:11651891ENST00000441788+214441_48023494RepeatNote=WD 7


Top

FusionGeneSequence for FZR1_CNN1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FZR1_ENST00000441788_chr19_3523056_+_CNN1_ENST00000252456_chr19_11651891_+_300aa
MDQDYERRLLRQIVIQNENTMPRLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIILCEFINKLQPGSVKKINESTQNWHQLENI
GNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQG
MTAYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVY

>In-frame_FZR1_ENST00000313639_chr19_3523056_+_CNN1_ENST00000252456_chr19_11651891_+_300aa
MDQDYERRLLRQIVIQNENTMPRLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIILCEFINKLQPGSVKKINESTQNWHQLENI
GNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQG
MTAYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVY

>In-frame_FZR1_ENST00000395095_chr19_3523056_+_CNN1_ENST00000252456_chr19_11651891_+_300aa
MDQDYERRLLRQIVIQNENTMPRLAQKYDHQREQELREWIEGVTGRRIGNNFMDGLKDGIILCEFINKLQPGSVKKINESTQNWHQLENI
GNFIKAITKYGVKPHDIFEANDLFENTNHTQVQSTLLALASMAKTKGNKVNVGVKYAEKQERKFEPGKLREGRNIIGLQMGTNKFASQQG
MTAYGTRRHLYDPKLGTDQPLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVY


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FZR1_ENST00000441788_chr19_3523056_+_CNN1_ENST00000252456_chr19_11651891_+_900nt
ATGGACCAGGACTATGAGCGGCGCCTGCTTCGCCAGATCGTCATCCAGAATGAGAACACGATGCCACGCCTGGCCCAGAAGTATGACCAC
CAGCGGGAGCAGGAGCTGAGAGAGTGGATCGAGGGGGTGACAGGCCGTCGCATCGGCAACAACTTCATGGACGGCCTCAAAGATGGCATC
ATTCTTTGCGAATTCATCAATAAGCTGCAGCCAGGCTCCGTGAAGAAGATCAATGAGTCAACCCAAAATTGGCACCAGCTGGAGAACATC
GGCAACTTCATCAAGGCCATCACCAAGTATGGGGTGAAGCCCCACGACATTTTTGAGGCCAACGACCTGTTTGAGAACACCAACCATACA
CAGGTGCAGTCCACCCTCCTGGCTTTGGCCAGCATGGCGAAGACGAAAGGAAACAAGGTGAACGTGGGAGTGAAGTACGCAGAGAAGCAG
GAGCGGAAATTCGAGCCGGGGAAGCTAAGAGAAGGGCGGAACATCATTGGGCTGCAGATGGGCACCAACAAGTTTGCCAGCCAGCAGGGC
ATGACGGCCTATGGCACCCGGCGCCACCTCTACGACCCCAAGCTGGGCACAGACCAGCCTCTGGACCAGGCGACCATCAGCCTGCAGATG
GGCACCAACAAAGGAGCCAGCCAGGCTGGCATGACTGCGCCAGGGACCAAGCGGCAGATCTTCGAGCCGGGGCTGGGCATGGAGCACTGC
GACACGCTCAATGTCAGCCTGCAGATGGGCAGCAACAAGGGCGCCTCGCAGCGGGGCATGACGGTGTATGGGCTGCCACGCCAGGTCTAC
GACCCCAAGTACTGTCTGACTCCCGAGTACCCAGAGCTGGGTGAGCCCGCCCACAACCACCACGCACACAACTACTACAATTCCGCCTAG

>In-frame_FZR1_ENST00000313639_chr19_3523056_+_CNN1_ENST00000252456_chr19_11651891_+_900nt
ATGGACCAGGACTATGAGCGGCGCCTGCTTCGCCAGATCGTCATCCAGAATGAGAACACGATGCCACGCCTGGCCCAGAAGTATGACCAC
CAGCGGGAGCAGGAGCTGAGAGAGTGGATCGAGGGGGTGACAGGCCGTCGCATCGGCAACAACTTCATGGACGGCCTCAAAGATGGCATC
ATTCTTTGCGAATTCATCAATAAGCTGCAGCCAGGCTCCGTGAAGAAGATCAATGAGTCAACCCAAAATTGGCACCAGCTGGAGAACATC
GGCAACTTCATCAAGGCCATCACCAAGTATGGGGTGAAGCCCCACGACATTTTTGAGGCCAACGACCTGTTTGAGAACACCAACCATACA
CAGGTGCAGTCCACCCTCCTGGCTTTGGCCAGCATGGCGAAGACGAAAGGAAACAAGGTGAACGTGGGAGTGAAGTACGCAGAGAAGCAG
GAGCGGAAATTCGAGCCGGGGAAGCTAAGAGAAGGGCGGAACATCATTGGGCTGCAGATGGGCACCAACAAGTTTGCCAGCCAGCAGGGC
ATGACGGCCTATGGCACCCGGCGCCACCTCTACGACCCCAAGCTGGGCACAGACCAGCCTCTGGACCAGGCGACCATCAGCCTGCAGATG
GGCACCAACAAAGGAGCCAGCCAGGCTGGCATGACTGCGCCAGGGACCAAGCGGCAGATCTTCGAGCCGGGGCTGGGCATGGAGCACTGC
GACACGCTCAATGTCAGCCTGCAGATGGGCAGCAACAAGGGCGCCTCGCAGCGGGGCATGACGGTGTATGGGCTGCCACGCCAGGTCTAC
GACCCCAAGTACTGTCTGACTCCCGAGTACCCAGAGCTGGGTGAGCCCGCCCACAACCACCACGCACACAACTACTACAATTCCGCCTAG

>In-frame_FZR1_ENST00000395095_chr19_3523056_+_CNN1_ENST00000252456_chr19_11651891_+_900nt
ATGGACCAGGACTATGAGCGGCGCCTGCTTCGCCAGATCGTCATCCAGAATGAGAACACGATGCCACGCCTGGCCCAGAAGTATGACCAC
CAGCGGGAGCAGGAGCTGAGAGAGTGGATCGAGGGGGTGACAGGCCGTCGCATCGGCAACAACTTCATGGACGGCCTCAAAGATGGCATC
ATTCTTTGCGAATTCATCAATAAGCTGCAGCCAGGCTCCGTGAAGAAGATCAATGAGTCAACCCAAAATTGGCACCAGCTGGAGAACATC
GGCAACTTCATCAAGGCCATCACCAAGTATGGGGTGAAGCCCCACGACATTTTTGAGGCCAACGACCTGTTTGAGAACACCAACCATACA
CAGGTGCAGTCCACCCTCCTGGCTTTGGCCAGCATGGCGAAGACGAAAGGAAACAAGGTGAACGTGGGAGTGAAGTACGCAGAGAAGCAG
GAGCGGAAATTCGAGCCGGGGAAGCTAAGAGAAGGGCGGAACATCATTGGGCTGCAGATGGGCACCAACAAGTTTGCCAGCCAGCAGGGC
ATGACGGCCTATGGCACCCGGCGCCACCTCTACGACCCCAAGCTGGGCACAGACCAGCCTCTGGACCAGGCGACCATCAGCCTGCAGATG
GGCACCAACAAAGGAGCCAGCCAGGCTGGCATGACTGCGCCAGGGACCAAGCGGCAGATCTTCGAGCCGGGGCTGGGCATGGAGCACTGC
GACACGCTCAATGTCAGCCTGCAGATGGGCAGCAACAAGGGCGCCTCGCAGCGGGGCATGACGGTGTATGGGCTGCCACGCCAGGTCTAC
GACCCCAAGTACTGTCTGACTCCCGAGTACCCAGAGCTGGGTGAGCCCGCCCACAACCACCACGCACACAACTACTACAATTCCGCCTAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_FZR1_ENST00000441788_chr19_3523056_+_CNN1_ENST00000252456_chr19_11651891_+_1664nt
GGCCGGGCGCGCGCGGCGGAGGGAGGGAGCCGGGAGGCAGCGGAGGAGCGACCGCCGCCATATTAGGGACCGCGGAGCCCGGGATCCCGT
CAGCGGCGGCCGCGGCCGGGCCTGCGGGAGCTGCGGAGGCCGGAGGCGGGCGCTGTGCGGTGCCAGGAGAGGCGGGGTCGGCGGGAGCCA
GCGAGCCACGGGAGCGAGCCAGGCTAACCTTGCCGCGGGCCGAGCCCTGCCTCGCCATGGACCAGGACTATGAGCGGCGCCTGCTTCGCC
AGATCGTCATCCAGAATGAGAACACGATGCCACGCCTGGCCCAGAAGTATGACCACCAGCGGGAGCAGGAGCTGAGAGAGTGGATCGAGG
GGGTGACAGGCCGTCGCATCGGCAACAACTTCATGGACGGCCTCAAAGATGGCATCATTCTTTGCGAATTCATCAATAAGCTGCAGCCAG
GCTCCGTGAAGAAGATCAATGAGTCAACCCAAAATTGGCACCAGCTGGAGAACATCGGCAACTTCATCAAGGCCATCACCAAGTATGGGG
TGAAGCCCCACGACATTTTTGAGGCCAACGACCTGTTTGAGAACACCAACCATACACAGGTGCAGTCCACCCTCCTGGCTTTGGCCAGCA
TGGCGAAGACGAAAGGAAACAAGGTGAACGTGGGAGTGAAGTACGCAGAGAAGCAGGAGCGGAAATTCGAGCCGGGGAAGCTAAGAGAAG
GGCGGAACATCATTGGGCTGCAGATGGGCACCAACAAGTTTGCCAGCCAGCAGGGCATGACGGCCTATGGCACCCGGCGCCACCTCTACG
ACCCCAAGCTGGGCACAGACCAGCCTCTGGACCAGGCGACCATCAGCCTGCAGATGGGCACCAACAAAGGAGCCAGCCAGGCTGGCATGA
CTGCGCCAGGGACCAAGCGGCAGATCTTCGAGCCGGGGCTGGGCATGGAGCACTGCGACACGCTCAATGTCAGCCTGCAGATGGGCAGCA
ACAAGGGCGCCTCGCAGCGGGGCATGACGGTGTATGGGCTGCCACGCCAGGTCTACGACCCCAAGTACTGTCTGACTCCCGAGTACCCAG
AGCTGGGTGAGCCCGCCCACAACCACCACGCACACAACTACTACAATTCCGCCTAGGGCCACAAGGCCTTCCCTGTTTTCCCCCCAAGGG
AGGCTGCTGCTGCTCTTGGCTGGACCCAGCCAGGCCCAGCCGACCCCCTCTCCCTGCATGGCATCCTCCAGCCCCTGTAGAACTCAACCT
CTACAGGGTTAGAGTTTGGAGAGAGCAGACTGGCGGGGGGCCCATTGGGGGGAAGGGGACCCTCCGCTCTGTAGTGCTACAGGGTCCAAC
ATAGAGCCGGGTGTCCCCAACAGCGCCCAAAGGACGCACTGAGCAACGCTATTCCAGCTGTCCCCCCACTCCCTCACAAGTGGGTACCCC
CAGGACCAGAAGCTCCCCCAGCAAAGCCCCCAGAGCCCAGGCTCGGCCTGCCCCCACCCCATTCCCGCAGTGGGAGCAAACTGCATGCCC
AGAGACCCAGCGGACACACGCGGTTTGGTTTGCAGCGACTGGCATACTATGTGGATGTGACAGTGGCGTTTGTAATGAGAGCACTTTCTT

>In-frame_FZR1_ENST00000313639_chr19_3523056_+_CNN1_ENST00000252456_chr19_11651891_+_1428nt
ATGGACCAGGACTATGAGCGGCGCCTGCTTCGCCAGATCGTCATCCAGAATGAGAACACGATGCCACGCCTGGCCCAGAAGTATGACCAC
CAGCGGGAGCAGGAGCTGAGAGAGTGGATCGAGGGGGTGACAGGCCGTCGCATCGGCAACAACTTCATGGACGGCCTCAAAGATGGCATC
ATTCTTTGCGAATTCATCAATAAGCTGCAGCCAGGCTCCGTGAAGAAGATCAATGAGTCAACCCAAAATTGGCACCAGCTGGAGAACATC
GGCAACTTCATCAAGGCCATCACCAAGTATGGGGTGAAGCCCCACGACATTTTTGAGGCCAACGACCTGTTTGAGAACACCAACCATACA
CAGGTGCAGTCCACCCTCCTGGCTTTGGCCAGCATGGCGAAGACGAAAGGAAACAAGGTGAACGTGGGAGTGAAGTACGCAGAGAAGCAG
GAGCGGAAATTCGAGCCGGGGAAGCTAAGAGAAGGGCGGAACATCATTGGGCTGCAGATGGGCACCAACAAGTTTGCCAGCCAGCAGGGC
ATGACGGCCTATGGCACCCGGCGCCACCTCTACGACCCCAAGCTGGGCACAGACCAGCCTCTGGACCAGGCGACCATCAGCCTGCAGATG
GGCACCAACAAAGGAGCCAGCCAGGCTGGCATGACTGCGCCAGGGACCAAGCGGCAGATCTTCGAGCCGGGGCTGGGCATGGAGCACTGC
GACACGCTCAATGTCAGCCTGCAGATGGGCAGCAACAAGGGCGCCTCGCAGCGGGGCATGACGGTGTATGGGCTGCCACGCCAGGTCTAC
GACCCCAAGTACTGTCTGACTCCCGAGTACCCAGAGCTGGGTGAGCCCGCCCACAACCACCACGCACACAACTACTACAATTCCGCCTAG
GGCCACAAGGCCTTCCCTGTTTTCCCCCCAAGGGAGGCTGCTGCTGCTCTTGGCTGGACCCAGCCAGGCCCAGCCGACCCCCTCTCCCTG
CATGGCATCCTCCAGCCCCTGTAGAACTCAACCTCTACAGGGTTAGAGTTTGGAGAGAGCAGACTGGCGGGGGGCCCATTGGGGGGAAGG
GGACCCTCCGCTCTGTAGTGCTACAGGGTCCAACATAGAGCCGGGTGTCCCCAACAGCGCCCAAAGGACGCACTGAGCAACGCTATTCCA
GCTGTCCCCCCACTCCCTCACAAGTGGGTACCCCCAGGACCAGAAGCTCCCCCAGCAAAGCCCCCAGAGCCCAGGCTCGGCCTGCCCCCA
CCCCATTCCCGCAGTGGGAGCAAACTGCATGCCCAGAGACCCAGCGGACACACGCGGTTTGGTTTGCAGCGACTGGCATACTATGTGGAT

>In-frame_FZR1_ENST00000395095_chr19_3523056_+_CNN1_ENST00000252456_chr19_11651891_+_1428nt
ATGGACCAGGACTATGAGCGGCGCCTGCTTCGCCAGATCGTCATCCAGAATGAGAACACGATGCCACGCCTGGCCCAGAAGTATGACCAC
CAGCGGGAGCAGGAGCTGAGAGAGTGGATCGAGGGGGTGACAGGCCGTCGCATCGGCAACAACTTCATGGACGGCCTCAAAGATGGCATC
ATTCTTTGCGAATTCATCAATAAGCTGCAGCCAGGCTCCGTGAAGAAGATCAATGAGTCAACCCAAAATTGGCACCAGCTGGAGAACATC
GGCAACTTCATCAAGGCCATCACCAAGTATGGGGTGAAGCCCCACGACATTTTTGAGGCCAACGACCTGTTTGAGAACACCAACCATACA
CAGGTGCAGTCCACCCTCCTGGCTTTGGCCAGCATGGCGAAGACGAAAGGAAACAAGGTGAACGTGGGAGTGAAGTACGCAGAGAAGCAG
GAGCGGAAATTCGAGCCGGGGAAGCTAAGAGAAGGGCGGAACATCATTGGGCTGCAGATGGGCACCAACAAGTTTGCCAGCCAGCAGGGC
ATGACGGCCTATGGCACCCGGCGCCACCTCTACGACCCCAAGCTGGGCACAGACCAGCCTCTGGACCAGGCGACCATCAGCCTGCAGATG
GGCACCAACAAAGGAGCCAGCCAGGCTGGCATGACTGCGCCAGGGACCAAGCGGCAGATCTTCGAGCCGGGGCTGGGCATGGAGCACTGC
GACACGCTCAATGTCAGCCTGCAGATGGGCAGCAACAAGGGCGCCTCGCAGCGGGGCATGACGGTGTATGGGCTGCCACGCCAGGTCTAC
GACCCCAAGTACTGTCTGACTCCCGAGTACCCAGAGCTGGGTGAGCCCGCCCACAACCACCACGCACACAACTACTACAATTCCGCCTAG
GGCCACAAGGCCTTCCCTGTTTTCCCCCCAAGGGAGGCTGCTGCTGCTCTTGGCTGGACCCAGCCAGGCCCAGCCGACCCCCTCTCCCTG
CATGGCATCCTCCAGCCCCTGTAGAACTCAACCTCTACAGGGTTAGAGTTTGGAGAGAGCAGACTGGCGGGGGGCCCATTGGGGGGAAGG
GGACCCTCCGCTCTGTAGTGCTACAGGGTCCAACATAGAGCCGGGTGTCCCCAACAGCGCCCAAAGGACGCACTGAGCAACGCTATTCCA
GCTGTCCCCCCACTCCCTCACAAGTGGGTACCCCCAGGACCAGAAGCTCCCCCAGCAAAGCCCCCAGAGCCCAGGCTCGGCCTGCCCCCA
CCCCATTCCCGCAGTGGGAGCAAACTGCATGCCCAGAGACCCAGCGGACACACGCGGTTTGGTTTGCAGCGACTGGCATACTATGTGGAT


Top

FusionGenePPI for FZR1_CNN1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FZR1CDC27, SKIL, CDC14A, FBXO5, CDT1, MAD2L2, TPX2, ANAPC2, CDC20, CCNA2, IST1, CSF3R, SKP2, HSF2, SETD8, UBE2S, TK1, CDC6, CCNB1, GRIA1, EPHA4, TAS2R13, PIM1, CCNA1, CDK2, CDK5, E2F1, MAPK8, CDK1, RB1, ID1, NINL, SIX1, CLSPN, CDC25A, FOXM1, E2F3, MAK, RNF34, CKAP2, CKS1B, MOAP1, AURKB, USP37, PTTG1, GMNN, EMILIN1, DDB1, BRSK2, SPRTN, UBE2C, UBE2D1, UBE2D3, UBE2K, SMURF1, MDC1, ARHGAP32, DAXX, EYA1, BUB1B, ANAPC11, CDC14B, PTEN, VHL, SIRT2, CUEDC2, PHF8, CUL1, BTRC, PLK1, SOX2, HECW2, RACGAP1, STAU1, ANAPC4, TP53, ZC3HC1, CDR2, RBBP8, USP1, FANCD2, DCPS, DNM1L, ANAPC1, CDC26, ANAPC7, ANAPC5, CDC16, CDC23, ANAPC10, TACC3, TTK, NEDD9, TRIM33, NEK2, HCCS, CDCA3, LRRC46, RRM2, SENP2, FMR1, BEX1, BLID, CCL5, CYP17A1, DKK3, EPSTI1, MTA3, NAT2, PSMC3IP, THRSP, ANAPC15, PARK2, PRKDC, PAX3, KIAA0101, CCND1, PRR36, ANAPC13, CTGF, C16orf87, SRP68, CKS2, RRM2B, GLB1, HSPA2, HSP90AA1, CHEK2, CHEK1, WEE1, TRIM25, MCPH1, RNF157, CCNF, NUP98, HOXD13, LNP1, HHEXCNN1TPM1, ACTA1, CALM1, MYO1A, TNNC1, DNMBP, TUBB, ADRB2, MTHFD1, MTHFD1L, MYEOV, RNF150


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FZR1_CNN1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FZR1_CNN1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneFZR1C0032578Polyploidy1CTD_human