FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14096

FusionGeneSummary for FUT10_GAB2

check button Fusion gene summary
Fusion gene informationFusion gene name: FUT10_GAB2
Fusion gene ID: 14096
HgeneTgene
Gene symbol

FUT10

GAB2

Gene ID

84750

9846

Gene namefucosyltransferase 10GRB2 associated binding protein 2
SynonymsFUCTX-
Cytomap

8p12

11q14.1

Type of geneprotein-codingprotein-coding
Descriptionalpha-(1,3)-fucosyltransferase 10alpha (1,3) fucosyltransferasealpha 1,3-fucosyl transferasefuc-TXfucT-Xfucosyltransferase Xgalactoside 3-L-fucosyltransferase 10GRB2-associated-binding protein 2Grb2-associated binder 2growth factor receptor bound protein 2-associated protein 2pp100
Modification date2018052320180527
UniProtAcc

Q6P4F1

Q9UQC2

Ensembl transtripts involved in fusion geneENST00000327671, ENST00000518672, 
ENST00000524021, ENST00000335589, 
ENST00000518076, 
ENST00000340149, 
ENST00000361507, ENST00000526030, 
Fusion gene scores* DoF score5 X 4 X 4=8011 X 6 X 3=198
# samples 514
** MAII scorelog2(5/80*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(14/198*10)=-0.500073603134643
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FUT10 [Title/Abstract] AND GAB2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneGAB2

GO:0008284

positive regulation of cell proliferation

19172738


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-AR-A250-01AFUT10chr8

33310734

-GAB2chr11

77961446

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000327671ENST00000340149FUT10chr8

33310734

-GAB2chr11

77961446

-
Frame-shitENST00000327671ENST00000361507FUT10chr8

33310734

-GAB2chr11

77961446

-
5CDS-intronENST00000327671ENST00000526030FUT10chr8

33310734

-GAB2chr11

77961446

-
In-frameENST00000518672ENST00000340149FUT10chr8

33310734

-GAB2chr11

77961446

-
In-frameENST00000518672ENST00000361507FUT10chr8

33310734

-GAB2chr11

77961446

-
5CDS-intronENST00000518672ENST00000526030FUT10chr8

33310734

-GAB2chr11

77961446

-
In-frameENST00000524021ENST00000340149FUT10chr8

33310734

-GAB2chr11

77961446

-
In-frameENST00000524021ENST00000361507FUT10chr8

33310734

-GAB2chr11

77961446

-
5CDS-intronENST00000524021ENST00000526030FUT10chr8

33310734

-GAB2chr11

77961446

-
Frame-shitENST00000335589ENST00000340149FUT10chr8

33310734

-GAB2chr11

77961446

-
Frame-shitENST00000335589ENST00000361507FUT10chr8

33310734

-GAB2chr11

77961446

-
5CDS-intronENST00000335589ENST00000526030FUT10chr8

33310734

-GAB2chr11

77961446

-
5UTR-3CDSENST00000518076ENST00000340149FUT10chr8

33310734

-GAB2chr11

77961446

-
5UTR-3CDSENST00000518076ENST00000361507FUT10chr8

33310734

-GAB2chr11

77961446

-
5UTR-intronENST00000518076ENST00000526030FUT10chr8

33310734

-GAB2chr11

77961446

-

Top

FusionProtFeatures for FUT10_GAB2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FUT10

Q6P4F1

GAB2

Q9UQC2

Probable fucosyltransferase. {ECO:0000250}. Adapter protein which acts downstream of severalmembrane receptors including cytokine, antigen, hormone, cellmatrix and growth factor receptors to regulate multiple signalingpathways. Regulates osteoclast differentiation mediating theTNFRSF11A/RANK signaling. In allergic response, it plays a role inmast cells activation and degranulation through PI-3-kinaseregulation. Also involved in the regulation of cell proliferationand hematopoiesis. {ECO:0000269|PubMed:15750601,ECO:0000269|PubMed:19172738}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for FUT10_GAB2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FUT10_ENST00000518672_chr8_33310734_-_GAB2_ENST00000340149_chr11_77961446_-_649aa
MVELGKFERKEFKSSSLQDGHTKMEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHM
TKAFLFTDSLRNVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQETLYLHQCISRRAENARS
ASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFTSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVYTFKTP
SNTLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPSQAETPRWGSPQQRPPISENSRSVAATIPR
RNTLPAMDNSRLHRASSCETYEYPQRGGESAGRSAESMSDGVGSFLPGKMIVGRSDSTNSEDNTVPMNPGSSTLLAMERAGDNSQSVYIP
MSPGAHHFDSLGYPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELPFKSPITKSWSRANHTFNSSSSQYCRPIS
TQSITSTDSGDSEENTVPMQNPVSASPVPSGTNSPAPKKSTGSVDTLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTM

>In-frame_FUT10_ENST00000518672_chr8_33310734_-_GAB2_ENST00000361507_chr11_77961446_-_649aa
MVELGKFERKEFKSSSLQDGHTKMEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHM
TKAFLFTDSLRNVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQETLYLHQCISRRAENARS
ASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFTSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVYTFKTP
SNTLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPSQAETPRWGSPQQRPPISENSRSVAATIPR
RNTLPAMDNSRLHRASSCETYEYPQRGGESAGRSAESMSDGVGSFLPGKMIVGRSDSTNSEDNTVPMNPGSSTLLAMERAGDNSQSVYIP
MSPGAHHFDSLGYPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELPFKSPITKSWSRANHTFNSSSSQYCRPIS
TQSITSTDSGDSEENTVPMQNPVSASPVPSGTNSPAPKKSTGSVDTLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTM

>In-frame_FUT10_ENST00000524021_chr8_33310734_-_GAB2_ENST00000340149_chr11_77961446_-_649aa
MVELGKFERKEFKSSSLQDGHTKMEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHM
TKAFLFTDSLRNVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQETLYLHQCISRRAENARS
ASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFTSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVYTFKTP
SNTLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPSQAETPRWGSPQQRPPISENSRSVAATIPR
RNTLPAMDNSRLHRASSCETYEYPQRGGESAGRSAESMSDGVGSFLPGKMIVGRSDSTNSEDNTVPMNPGSSTLLAMERAGDNSQSVYIP
MSPGAHHFDSLGYPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELPFKSPITKSWSRANHTFNSSSSQYCRPIS
TQSITSTDSGDSEENTVPMQNPVSASPVPSGTNSPAPKKSTGSVDTLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTM

>In-frame_FUT10_ENST00000524021_chr8_33310734_-_GAB2_ENST00000361507_chr11_77961446_-_649aa
MVELGKFERKEFKSSSLQDGHTKMEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHM
TKAFLFTDSLRNVSSAGHGPRSSPAELSSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSNHMQPTLSTSAPQETLYLHQCISRRAENARS
ASFSQGTRASFLMRSDTAVQKLAQGNGHCVNGISGQVHGFTSLPKPSRHNTEFRDSTYDLPRSLASHGHTKGSLTGSETDNEDVYTFKTP
SNTLCREFGDLLVDNMDVPATPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPSQAETPRWGSPQQRPPISENSRSVAATIPR
RNTLPAMDNSRLHRASSCETYEYPQRGGESAGRSAESMSDGVGSFLPGKMIVGRSDSTNSEDNTVPMNPGSSTLLAMERAGDNSQSVYIP
MSPGAHHFDSLGYPSTTLPVHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELPFKSPITKSWSRANHTFNSSSSQYCRPIS
TQSITSTDSGDSEENTVPMQNPVSASPVPSGTNSPAPKKSTGSVDTLALDFQPSSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FUT10_ENST00000518672_chr8_33310734_-_GAB2_ENST00000340149_chr11_77961446_-_1947nt
ATGGTTGAGCTGGGGAAGTTTGAAAGGAAGGAGTTTAAAAGTTCCAGTTTGCAAGATGGACATACAAAAATGGAGGAAGCACCTACGCAT
CTTAATTCATTTCTTAAGAAAGAAGGATTGACCTTCAACAGGAAAAGAAAATGGGAATTGGACAGCTACCCCATTATGCTCTGGTGGTCC
CCGCTGACGGGGGAGACTGGGAGGTTAGGCCAATGTGGAGCAGATGCTTGTTTCTTCACCATCAACCGGACCTACCTCCATCATCACATG
ACCAAAGCATTCCTCTTCTATGACTCCCTGAGAAATGTTTCCTCAGCCGGTCATGGCCCCCGCTCTTCTCCAGCTGAGCTCAGCAGCTCT
AGCCAGCACCTTCTCCGAGAGCGCAAGTCCTCAGCCCCATCACACTCCAGCCAGCCAACTCTGTTCACGTTTGAACCCCCTGTGTCAAAC
CACATGCAGCCCACCTTGTCCACCAGCGCACCTCAGGAGTATCTCTACTTGCACCAGTGCATAAGCCGAAGAGCAGAAAATGCAAGGAGT
GCCAGCTTCTCTCAGGGCACCAGAGCCTCTTTTCTCATGAGGAGTGACACAGCTGTACAAAAACTTGCCCAGGGCAATGGACACTGTGTC
AACGGGATCAGTGGTCAAGTCCATGGCTTCTATAGCCTTCCCAAGCCGAGCCGGCACAATACAGAATTCAGAGACAGTACCTACGACCTC
CCCCGCAGCCTGGCCTCCCATGGCCACACCAAGGGCAGCCTCACAGGCTCCGAGACAGATAATGAGGATGTGTACACCTTCAAGACGCCC
AGCAACACCCTGTGCAGGGAGTTCGGGGACCTCCTGGTAGACAATATGGATGTTCCGGCCACCCCACTCTCAGCCTACCAGATCCCTAGG
ACATTCACTCTGGACAAAAACCACAATGCCATGACAGTGGCCACTCCTGGGGACTCAGCCATAGCTCCCCCACCCCGCCCCCCCAAGCCA
AGTCAGGCAGAAACACCTCGATGGGGCAGTCCTCAGCAGAGACCGCCAATCAGTGAAAATAGCAGATCTGTCGCTGCCACCATCCCCAGA
CGCAACACCCTCCCTGCAATGGACAACAGCCGACTTCACCGAGCTTCTTCCTGTGAGACCTACGAGTACCCACAGCGTGGTGGAGAGAGT
GCAGGCCGGTCTGCTGAATCCATGAGTGATGGAGTTGGCTCTTTCCTGCCAGGGAAAATGATTGTGGGCCGATCGGACAGCACCAATTCT
GAAGACAACTATGTGCCCATGAATCCAGGTTCTTCCACCCTGTTGGCCATGGAACGAGCAGGTGATAATTCCCAGAGCGTCTACATCCCA
ATGAGCCCAGGGGCCCATCACTTTGACTCACTTGGCTACCCATCAACAACCCTTCCTGTGCACCGAGGCCCCAGCAGAGGAAGTGAGATT
CAGCCACCCCCTGTCAACCGCAACCTCAAACCTGATCGGAAAGCAAAGCCAACACCACTTGACCTGAGGAACAACACCGTCATCGATGAA
CTCCCCTTCAAGTCACCTATCACCAAGTCTTGGTCTAGGGCCAACCACACCTTCAACTCCAGCTCCTCCCAGTACTGCCGCCCCATCTCC
ACCCAGAGCATCACCAGCACAGACTCAGGAGACAGCGAAGAGAACTATGTCCCTATGCAAAACCCAGTGTCTGCATCTCCCGTTCCCAGT
GGCACGAACAGTCCTGCCCCTAAGAAGAGCACCGGCAGCGTTGATTATCTGGCCCTGGACTTCCAGCCGAGCTCCCCAAGCCCCCACCGC
AAGCCATCTACTTCATCCGTCACCTCTGATGAGAAGGTGGACTACGTTCAGGTGGACAAGGAGAAGACCCAGGCCCTGCAGAACACCATG

>In-frame_FUT10_ENST00000518672_chr8_33310734_-_GAB2_ENST00000361507_chr11_77961446_-_1947nt
ATGGTTGAGCTGGGGAAGTTTGAAAGGAAGGAGTTTAAAAGTTCCAGTTTGCAAGATGGACATACAAAAATGGAGGAAGCACCTACGCAT
CTTAATTCATTTCTTAAGAAAGAAGGATTGACCTTCAACAGGAAAAGAAAATGGGAATTGGACAGCTACCCCATTATGCTCTGGTGGTCC
CCGCTGACGGGGGAGACTGGGAGGTTAGGCCAATGTGGAGCAGATGCTTGTTTCTTCACCATCAACCGGACCTACCTCCATCATCACATG
ACCAAAGCATTCCTCTTCTATGACTCCCTGAGAAATGTTTCCTCAGCCGGTCATGGCCCCCGCTCTTCTCCAGCTGAGCTCAGCAGCTCT
AGCCAGCACCTTCTCCGAGAGCGCAAGTCCTCAGCCCCATCACACTCCAGCCAGCCAACTCTGTTCACGTTTGAACCCCCTGTGTCAAAC
CACATGCAGCCCACCTTGTCCACCAGCGCACCTCAGGAGTATCTCTACTTGCACCAGTGCATAAGCCGAAGAGCAGAAAATGCAAGGAGT
GCCAGCTTCTCTCAGGGCACCAGAGCCTCTTTTCTCATGAGGAGTGACACAGCTGTACAAAAACTTGCCCAGGGCAATGGACACTGTGTC
AACGGGATCAGTGGTCAAGTCCATGGCTTCTATAGCCTTCCCAAGCCGAGCCGGCACAATACAGAATTCAGAGACAGTACCTACGACCTC
CCCCGCAGCCTGGCCTCCCATGGCCACACCAAGGGCAGCCTCACAGGCTCCGAGACAGATAATGAGGATGTGTACACCTTCAAGACGCCC
AGCAACACCCTGTGCAGGGAGTTCGGGGACCTCCTGGTAGACAATATGGATGTTCCGGCCACCCCACTCTCAGCCTACCAGATCCCTAGG
ACATTCACTCTGGACAAAAACCACAATGCCATGACAGTGGCCACTCCTGGGGACTCAGCCATAGCTCCCCCACCCCGCCCCCCCAAGCCA
AGTCAGGCAGAAACACCTCGATGGGGCAGTCCTCAGCAGAGACCGCCAATCAGTGAAAATAGCAGATCTGTCGCTGCCACCATCCCCAGA
CGCAACACCCTCCCTGCAATGGACAACAGCCGACTTCACCGAGCTTCTTCCTGTGAGACCTACGAGTACCCACAGCGTGGTGGAGAGAGT
GCAGGCCGGTCTGCTGAATCCATGAGTGATGGAGTTGGCTCTTTCCTGCCAGGGAAAATGATTGTGGGCCGATCGGACAGCACCAATTCT
GAAGACAACTATGTGCCCATGAATCCAGGTTCTTCCACCCTGTTGGCCATGGAACGAGCAGGTGATAATTCCCAGAGCGTCTACATCCCA
ATGAGCCCAGGGGCCCATCACTTTGACTCACTTGGCTACCCATCAACAACCCTTCCTGTGCACCGAGGCCCCAGCAGAGGAAGTGAGATT
CAGCCACCCCCTGTCAACCGCAACCTCAAACCTGATCGGAAAGCAAAGCCAACACCACTTGACCTGAGGAACAACACCGTCATCGATGAA
CTCCCCTTCAAGTCACCTATCACCAAGTCTTGGTCTAGGGCCAACCACACCTTCAACTCCAGCTCCTCCCAGTACTGCCGCCCCATCTCC
ACCCAGAGCATCACCAGCACAGACTCAGGAGACAGCGAAGAGAACTATGTCCCTATGCAAAACCCAGTGTCTGCATCTCCCGTTCCCAGT
GGCACGAACAGTCCTGCCCCTAAGAAGAGCACCGGCAGCGTTGATTATCTGGCCCTGGACTTCCAGCCGAGCTCCCCAAGCCCCCACCGC
AAGCCATCTACTTCATCCGTCACCTCTGATGAGAAGGTGGACTACGTTCAGGTGGACAAGGAGAAGACCCAGGCCCTGCAGAACACCATG

>In-frame_FUT10_ENST00000524021_chr8_33310734_-_GAB2_ENST00000340149_chr11_77961446_-_1947nt
ATGGTTGAGCTGGGGAAGTTTGAAAGGAAGGAGTTTAAAAGTTCCAGTTTGCAAGATGGACATACAAAAATGGAGGAAGCACCTACGCAT
CTTAATTCATTTCTTAAGAAAGAAGGATTGACCTTCAACAGGAAAAGAAAATGGGAATTGGACAGCTACCCCATTATGCTCTGGTGGTCC
CCGCTGACGGGGGAGACTGGGAGGTTAGGCCAATGTGGAGCAGATGCTTGTTTCTTCACCATCAACCGGACCTACCTCCATCATCACATG
ACCAAAGCATTCCTCTTCTATGACTCCCTGAGAAATGTTTCCTCAGCCGGTCATGGCCCCCGCTCTTCTCCAGCTGAGCTCAGCAGCTCT
AGCCAGCACCTTCTCCGAGAGCGCAAGTCCTCAGCCCCATCACACTCCAGCCAGCCAACTCTGTTCACGTTTGAACCCCCTGTGTCAAAC
CACATGCAGCCCACCTTGTCCACCAGCGCACCTCAGGAGTATCTCTACTTGCACCAGTGCATAAGCCGAAGAGCAGAAAATGCAAGGAGT
GCCAGCTTCTCTCAGGGCACCAGAGCCTCTTTTCTCATGAGGAGTGACACAGCTGTACAAAAACTTGCCCAGGGCAATGGACACTGTGTC
AACGGGATCAGTGGTCAAGTCCATGGCTTCTATAGCCTTCCCAAGCCGAGCCGGCACAATACAGAATTCAGAGACAGTACCTACGACCTC
CCCCGCAGCCTGGCCTCCCATGGCCACACCAAGGGCAGCCTCACAGGCTCCGAGACAGATAATGAGGATGTGTACACCTTCAAGACGCCC
AGCAACACCCTGTGCAGGGAGTTCGGGGACCTCCTGGTAGACAATATGGATGTTCCGGCCACCCCACTCTCAGCCTACCAGATCCCTAGG
ACATTCACTCTGGACAAAAACCACAATGCCATGACAGTGGCCACTCCTGGGGACTCAGCCATAGCTCCCCCACCCCGCCCCCCCAAGCCA
AGTCAGGCAGAAACACCTCGATGGGGCAGTCCTCAGCAGAGACCGCCAATCAGTGAAAATAGCAGATCTGTCGCTGCCACCATCCCCAGA
CGCAACACCCTCCCTGCAATGGACAACAGCCGACTTCACCGAGCTTCTTCCTGTGAGACCTACGAGTACCCACAGCGTGGTGGAGAGAGT
GCAGGCCGGTCTGCTGAATCCATGAGTGATGGAGTTGGCTCTTTCCTGCCAGGGAAAATGATTGTGGGCCGATCGGACAGCACCAATTCT
GAAGACAACTATGTGCCCATGAATCCAGGTTCTTCCACCCTGTTGGCCATGGAACGAGCAGGTGATAATTCCCAGAGCGTCTACATCCCA
ATGAGCCCAGGGGCCCATCACTTTGACTCACTTGGCTACCCATCAACAACCCTTCCTGTGCACCGAGGCCCCAGCAGAGGAAGTGAGATT
CAGCCACCCCCTGTCAACCGCAACCTCAAACCTGATCGGAAAGCAAAGCCAACACCACTTGACCTGAGGAACAACACCGTCATCGATGAA
CTCCCCTTCAAGTCACCTATCACCAAGTCTTGGTCTAGGGCCAACCACACCTTCAACTCCAGCTCCTCCCAGTACTGCCGCCCCATCTCC
ACCCAGAGCATCACCAGCACAGACTCAGGAGACAGCGAAGAGAACTATGTCCCTATGCAAAACCCAGTGTCTGCATCTCCCGTTCCCAGT
GGCACGAACAGTCCTGCCCCTAAGAAGAGCACCGGCAGCGTTGATTATCTGGCCCTGGACTTCCAGCCGAGCTCCCCAAGCCCCCACCGC
AAGCCATCTACTTCATCCGTCACCTCTGATGAGAAGGTGGACTACGTTCAGGTGGACAAGGAGAAGACCCAGGCCCTGCAGAACACCATG

>In-frame_FUT10_ENST00000524021_chr8_33310734_-_GAB2_ENST00000361507_chr11_77961446_-_1947nt
ATGGTTGAGCTGGGGAAGTTTGAAAGGAAGGAGTTTAAAAGTTCCAGTTTGCAAGATGGACATACAAAAATGGAGGAAGCACCTACGCAT
CTTAATTCATTTCTTAAGAAAGAAGGATTGACCTTCAACAGGAAAAGAAAATGGGAATTGGACAGCTACCCCATTATGCTCTGGTGGTCC
CCGCTGACGGGGGAGACTGGGAGGTTAGGCCAATGTGGAGCAGATGCTTGTTTCTTCACCATCAACCGGACCTACCTCCATCATCACATG
ACCAAAGCATTCCTCTTCTATGACTCCCTGAGAAATGTTTCCTCAGCCGGTCATGGCCCCCGCTCTTCTCCAGCTGAGCTCAGCAGCTCT
AGCCAGCACCTTCTCCGAGAGCGCAAGTCCTCAGCCCCATCACACTCCAGCCAGCCAACTCTGTTCACGTTTGAACCCCCTGTGTCAAAC
CACATGCAGCCCACCTTGTCCACCAGCGCACCTCAGGAGTATCTCTACTTGCACCAGTGCATAAGCCGAAGAGCAGAAAATGCAAGGAGT
GCCAGCTTCTCTCAGGGCACCAGAGCCTCTTTTCTCATGAGGAGTGACACAGCTGTACAAAAACTTGCCCAGGGCAATGGACACTGTGTC
AACGGGATCAGTGGTCAAGTCCATGGCTTCTATAGCCTTCCCAAGCCGAGCCGGCACAATACAGAATTCAGAGACAGTACCTACGACCTC
CCCCGCAGCCTGGCCTCCCATGGCCACACCAAGGGCAGCCTCACAGGCTCCGAGACAGATAATGAGGATGTGTACACCTTCAAGACGCCC
AGCAACACCCTGTGCAGGGAGTTCGGGGACCTCCTGGTAGACAATATGGATGTTCCGGCCACCCCACTCTCAGCCTACCAGATCCCTAGG
ACATTCACTCTGGACAAAAACCACAATGCCATGACAGTGGCCACTCCTGGGGACTCAGCCATAGCTCCCCCACCCCGCCCCCCCAAGCCA
AGTCAGGCAGAAACACCTCGATGGGGCAGTCCTCAGCAGAGACCGCCAATCAGTGAAAATAGCAGATCTGTCGCTGCCACCATCCCCAGA
CGCAACACCCTCCCTGCAATGGACAACAGCCGACTTCACCGAGCTTCTTCCTGTGAGACCTACGAGTACCCACAGCGTGGTGGAGAGAGT
GCAGGCCGGTCTGCTGAATCCATGAGTGATGGAGTTGGCTCTTTCCTGCCAGGGAAAATGATTGTGGGCCGATCGGACAGCACCAATTCT
GAAGACAACTATGTGCCCATGAATCCAGGTTCTTCCACCCTGTTGGCCATGGAACGAGCAGGTGATAATTCCCAGAGCGTCTACATCCCA
ATGAGCCCAGGGGCCCATCACTTTGACTCACTTGGCTACCCATCAACAACCCTTCCTGTGCACCGAGGCCCCAGCAGAGGAAGTGAGATT
CAGCCACCCCCTGTCAACCGCAACCTCAAACCTGATCGGAAAGCAAAGCCAACACCACTTGACCTGAGGAACAACACCGTCATCGATGAA
CTCCCCTTCAAGTCACCTATCACCAAGTCTTGGTCTAGGGCCAACCACACCTTCAACTCCAGCTCCTCCCAGTACTGCCGCCCCATCTCC
ACCCAGAGCATCACCAGCACAGACTCAGGAGACAGCGAAGAGAACTATGTCCCTATGCAAAACCCAGTGTCTGCATCTCCCGTTCCCAGT
GGCACGAACAGTCCTGCCCCTAAGAAGAGCACCGGCAGCGTTGATTATCTGGCCCTGGACTTCCAGCCGAGCTCCCCAAGCCCCCACCGC
AAGCCATCTACTTCATCCGTCACCTCTGATGAGAAGGTGGACTACGTTCAGGTGGACAAGGAGAAGACCCAGGCCCTGCAGAACACCATG


* Fusion transcript sequences (Full-length transcript).
>In-frame_FUT10_ENST00000518672_chr8_33310734_-_GAB2_ENST00000340149_chr11_77961446_-_6165nt
AGAATTTTTTTGATTCCTTCTTATTTGGAGAAATCTCCAGCTGCTCTGATGATAGCCTAAGAAGACTGCATGCTGCTTCCTCTCGATGCC
AAGCCAGACCCTCTCACAACCTCGGATCTCAGTCCTTCATGGAGACCTGGTCCCAGCAGGAATGGCAGTGCAGGAAATTGGCGCCCAGAT
GGTTCTTCCATGTGAAGTTGTCTCGGGCTCTGGGCTGACGAGAGAACACCTGGTAACCAGGTCATGGTTGAGCTGGGGAAGTTTGAAAGG
AAGGAGTTTAAAAGTTCCAGTTTGCAAGATGGACATACAAAAATGGAGGAAGCACCTACGCATCTTAATTCATTTCTTAAGAAAGAAGGA
TTGACCTTCAACAGGAAAAGAAAATGGGAATTGGACAGCTACCCCATTATGCTCTGGTGGTCCCCGCTGACGGGGGAGACTGGGAGGTTA
GGCCAATGTGGAGCAGATGCTTGTTTCTTCACCATCAACCGGACCTACCTCCATCATCACATGACCAAAGCATTCCTCTTCTATGACTCC
CTGAGAAATGTTTCCTCAGCCGGTCATGGCCCCCGCTCTTCTCCAGCTGAGCTCAGCAGCTCTAGCCAGCACCTTCTCCGAGAGCGCAAG
TCCTCAGCCCCATCACACTCCAGCCAGCCAACTCTGTTCACGTTTGAACCCCCTGTGTCAAACCACATGCAGCCCACCTTGTCCACCAGC
GCACCTCAGGAGTATCTCTACTTGCACCAGTGCATAAGCCGAAGAGCAGAAAATGCAAGGAGTGCCAGCTTCTCTCAGGGCACCAGAGCC
TCTTTTCTCATGAGGAGTGACACAGCTGTACAAAAACTTGCCCAGGGCAATGGACACTGTGTCAACGGGATCAGTGGTCAAGTCCATGGC
TTCTATAGCCTTCCCAAGCCGAGCCGGCACAATACAGAATTCAGAGACAGTACCTACGACCTCCCCCGCAGCCTGGCCTCCCATGGCCAC
ACCAAGGGCAGCCTCACAGGCTCCGAGACAGATAATGAGGATGTGTACACCTTCAAGACGCCCAGCAACACCCTGTGCAGGGAGTTCGGG
GACCTCCTGGTAGACAATATGGATGTTCCGGCCACCCCACTCTCAGCCTACCAGATCCCTAGGACATTCACTCTGGACAAAAACCACAAT
GCCATGACAGTGGCCACTCCTGGGGACTCAGCCATAGCTCCCCCACCCCGCCCCCCCAAGCCAAGTCAGGCAGAAACACCTCGATGGGGC
AGTCCTCAGCAGAGACCGCCAATCAGTGAAAATAGCAGATCTGTCGCTGCCACCATCCCCAGACGCAACACCCTCCCTGCAATGGACAAC
AGCCGACTTCACCGAGCTTCTTCCTGTGAGACCTACGAGTACCCACAGCGTGGTGGAGAGAGTGCAGGCCGGTCTGCTGAATCCATGAGT
GATGGAGTTGGCTCTTTCCTGCCAGGGAAAATGATTGTGGGCCGATCGGACAGCACCAATTCTGAAGACAACTATGTGCCCATGAATCCA
GGTTCTTCCACCCTGTTGGCCATGGAACGAGCAGGTGATAATTCCCAGAGCGTCTACATCCCAATGAGCCCAGGGGCCCATCACTTTGAC
TCACTTGGCTACCCATCAACAACCCTTCCTGTGCACCGAGGCCCCAGCAGAGGAAGTGAGATTCAGCCACCCCCTGTCAACCGCAACCTC
AAACCTGATCGGAAAGCAAAGCCAACACCACTTGACCTGAGGAACAACACCGTCATCGATGAACTCCCCTTCAAGTCACCTATCACCAAG
TCTTGGTCTAGGGCCAACCACACCTTCAACTCCAGCTCCTCCCAGTACTGCCGCCCCATCTCCACCCAGAGCATCACCAGCACAGACTCA
GGAGACAGCGAAGAGAACTATGTCCCTATGCAAAACCCAGTGTCTGCATCTCCCGTTCCCAGTGGCACGAACAGTCCTGCCCCTAAGAAG
AGCACCGGCAGCGTTGATTATCTGGCCCTGGACTTCCAGCCGAGCTCCCCAAGCCCCCACCGCAAGCCATCTACTTCATCCGTCACCTCT
GATGAGAAGGTGGACTACGTTCAGGTGGACAAGGAGAAGACCCAGGCCCTGCAGAACACCATGCAGGAGTGGACAGACGTGCGGCAGTCC
TCAGAGCCTTCCAAGGGTGCCAAGCTGTGATGAGAGGGCCACCGCAGAGCCCAGGAGGCAGCATCTCCAGAGCTGGCCCTTCCCATCTCC
CCTCTCCCCTCTCCCGTTCTTCCTCCCATCCACCTCCTCTCTACTCTGCCAGTCTCAGCCTTCAAAGCACTTGACATCAGGGACCCTGAA
CCCTTCCCCTGGGAGGTGAGGGCCTGATCAAGGCACCTCCTCTGCCCACTCGGGGCCCAGCTGTGATTTTTATCAGTAATGGCCATGCCT
CCACCCACCTTAGTTAGGAGCTACTTCCAAAAAGCATCCTTCAGCCTCTTCCTGTCCTTTAGACCTGACTCTCTACCAGATGTTTGGAGG
GAAGGGCTGGGGCTCTGAGCCAGATTCCACACCTCACGTTCAGTCACAGCCCTCAGCTATCTTCCCTCCGGCCACTGGGCTACCTCTCCT
TCAGTCCCAGAAGACAAGTCTCACCAACCCAGGGAGTCAAGGACCAGCAAACCAAAGTGGATAATGGACTTTTTCATTCCTGTTTTTCTT
GGCAGGAGAGAAGCAAGGCCACTAAAAGAGGAGATGGTGGAGACGGAGGCTCAGCAGTGGTCTTGAGGGGTAAAGGACTTAGATGCCCAG
ATGAAGAGGGAAAGCTGACATCTGCAGGGAACCCACTTTGAGGCTGAGGCCATGGCAGGACAGCTGCTGTGGGGTGCAGAGGCAGAAGAT
GAAGGACAAAAGGAAGGGAAAACTGATGGCCAACCTAGAGCAGCAAGGAGCAGGGCTTGGAGCTCGGGTGGTGGAGATGACAAGGACACT
GTGGGGTCTGGGTCCCCAGAACTCTGGAGCTACAGGCCACTCTAGGCCCAAGGGCTAGTCCTCTTCCCCAGTCCCCTCAGAGGCCCCCGC
CAGCCCCACCTTGAAAGCAGCATACAGGGGAAGGCTTGGACCAAGCTGGGCGACCAAGCACATGGGGCAGGAACACATGGTAAAGGGGTG
GGGAATATGGGAGGGAGTGTGGTGTGGATGGGGGTGATGCAGGGACTGAGGGGAACCCTGGGACAGGCACAGGCTGGGCAGAGGCACAGG
GCAGTGCAGGGGACTCTGCAGTGGGGTCGGGAAGTGAGTTTCTTTGCAGTGAGCAGTGCAGTGGAAGTCGGGCACAGAGGTAGCAGACAG
ATGTGAAGCAGTGGTGAAGGCCATGTAGCAAGTGGGGAAATACATCCAAAGGGCCTGGGAGTTGGGGGGTGCCCAACGCAATCCTTGGGG
GTGCAGGGTGGAGCAGAAAGTGAAGGAGGGACACGTGCAAGAGTGGTGTGCATGGTGGTGTGACATGAGGACCGTTCCTAGGATGGGACA
GTGGGTCAGGCAGGACAAGGAGAAAGCAGGGCAGAATGATGCCTAGAGGACCACATCAGGCATGGCTGACAGCTTGTGCCCATGGGCTGT
GGCGTATGTCAGATCGCAGGGTAGGAACGAGTCTGGCCTGGTGCCGGCCCAGTGTTTCCTCAGCTCATCCGCCCTCTGTTGCTCCCTAGC
ATTCCAGGAGCCATCTTGGACTCTCCTCCCCAGGTTTGAAAGGCCATCAGATTAGCAGGGACGGGGTGTAGGGCATCACCCAAGGTTCCT
TCTCTTAAACTAAGGGTGGGGGATCTGAATGTTTTTATGTTGACTGTTCTTGACTAAATTTTCAAGAGTTTCAGAAGCAACAGGACAGAC
CAGACGTTTCATTCTACCCTGGGGCGAACAGAACTTCTTCCTCCCAAACAATGACTTCCTGCCATGTTTGATGGGGACAGCTACCACTGT
CCTCTGCCCCCATTCCCCTTTCAGCTCCCATGAGCATGCATAGTTCACCAGACCAATGGCCTAGCCATTCTCTAAGTCCCATCCTGGAAG
AAGTTATTTCTTCAAGAGCTGCACCTCTCCTCCTAGCATTAGTTTAGATCAACTCAAGGAGTATTTATTAATGGCTGCTGTCTCCAGTTT
CTGGGGTTAAGCACTAAGGACACAAGAATCAATCAGACCTTCTCCCTGAACTTAAGATAGCCACAATCAGAAAAAGGACAAGGACATGAG
ACAGTGGTGATGGCCATCAGACAGAGACTTCAAATGCTGATGGAGGGCAGAGGAAGTACTTAGGGAGGTTGGTGTCAGAGGCAGGAGTGG
GGGATCAGGGAAGGTGGATTCTAGGAAAAGGGAGTGCCTGAGGTAGGCCTTAGAAGGGGATGAGTCAGATTTTTACAGAGGAGGAGGGCA
GGGCTTGGGTCCAGTGGAGGAAGAAGGAAGGAGAGGCTTGGAAAGCCTTGTGTCTTGGGAACAAAAGGCCTTTGAGCATATGGGTCCAGC
CACTCAGAAGTGTAGGGGCCATGCCTTGGTGTTCCAATAAGTGAATGGAAGCAGTGGTGGTAGCTACACTGGGCAGAGTTGGCAGGGTGC
TGGTTCACTCTGCCCAGCCCTGAATGTGTGCCTTAAAGGCCCCCTACAAGGGGCCCCATACGACAGAGCTTTTAACTGGTGCCTTCCCTG
TACCCGCAGCAGCCACAAGTGGGCCCAGACTATTGCAGCCTCCCATAAACATGTGAGCATGTTCTGAGTGTGCCATGATGTGAGTGGACC
TGGCTGGAATCTTCGGAGAGCGACTGAGGTGTTCAAATCGAATCTCCCAGGAGGCTTCCTTCCAGCCCCCTATTCTGGTAACTACCAGGA
GGCTTCCTTCCAGCCCCCTATTCTGGTAACTACCAAAATCCCTCGGGTGCAAGTGTAGGGGTAGAGATGGAAGGATGAGAGGTGAAATTG
ACCTTTTGAAAGCAAAGCTCTGGCTCACAGGCCCCAAACTACCAGCCGTATCTAGCATATCCCCACCCTCCACCCACTACCTCCTCCAAC
AAAGGAGTCAACTCAGTTGAAAAAACTGGTCCTTTGGCCTATCCATGGGTCAAAGTCCACCTCTCCTGGGGGCCTGGAGAGGACTGAGCC
TACGGAAAGGGGATACCTTCCCACTCAGCACTGCTTCACACAGGCCCCCTGCCTGGGGCTCTCCAAGGAGCCTTCTTCACCCACTTCCAG
CTCCACTTCTGCAAGGTTAAGTCAAGTGAGAACGATGAGAAATAGGGAGATGGTGTCTCCTTAAGTCCTTGATCTGCCTGTCTGTGGAAT
GGGAGGTTGGATTAGCTGCGCTGAGGTCCCATCCACAGCTGGTGCTCAGCTGCTTGAAGGGGAGACTCCCTCCTCTGTAACTTCTTTCTG
GGGGATTGGGGTGGGCAGTACCTATCCCCAGTCCCCTCCTAGCTTGACTTTAGTGGTTTCCAATGTAGAAGTTAACAAAGTATGCCCCAT
TCCTGTGACAAAAGCACAACCATTCTGAAGTTACTGGAGCATGGGCTCAGCTCATCCTCCCTCTGGCCCCTTCTCCCATGGGGACATCTC
GGCCCAGCACCCCTATCCCATTTCCAGAGTTCTTCCTTCCCCATCTGGGCCTTCATAAAATGCAGGGGAAGCCAGACTGGTCTCAGGAGC
GCTAAAGCCCTTCCGTGGGGGGTCGTCTTTCTGGGACTAGCCCTGCTGTTTAGGACCTGGGACCACAATGGGGTACCTGCCGAGGGGGTC
CCCAAGAGATCCAGGCTGTCATGTGATTTATGGTGGCATGTGTTGTGTATTTGTTGGCTACTTGTGTCTTGAAATCTAGAATTATTTCAC
GCAGAATTGTCACTGTTTGTCAGGAAGAGAAAATGGGCTAGTGGAAGCCCAGTCTTGAGTTCTTGTCTTGTTACCATTTAAAATTGACAT
TTAATTTTCAAATCACTGTTGGTGCCTAATCACTTAAGTTATTAATTTATTCTGTTGTATTCTTTTTTTTAAATTGTAACATATTTATCC
GGTGGGTGGGACAGGAGTGTGTTCAAGTGGGTCATGTTTTTGCTGTGGTGACACATGGTACAGGCTTGGAGCTTGCAGGTCCCTTTCTAC

>In-frame_FUT10_ENST00000518672_chr8_33310734_-_GAB2_ENST00000361507_chr11_77961446_-_6165nt
AGAATTTTTTTGATTCCTTCTTATTTGGAGAAATCTCCAGCTGCTCTGATGATAGCCTAAGAAGACTGCATGCTGCTTCCTCTCGATGCC
AAGCCAGACCCTCTCACAACCTCGGATCTCAGTCCTTCATGGAGACCTGGTCCCAGCAGGAATGGCAGTGCAGGAAATTGGCGCCCAGAT
GGTTCTTCCATGTGAAGTTGTCTCGGGCTCTGGGCTGACGAGAGAACACCTGGTAACCAGGTCATGGTTGAGCTGGGGAAGTTTGAAAGG
AAGGAGTTTAAAAGTTCCAGTTTGCAAGATGGACATACAAAAATGGAGGAAGCACCTACGCATCTTAATTCATTTCTTAAGAAAGAAGGA
TTGACCTTCAACAGGAAAAGAAAATGGGAATTGGACAGCTACCCCATTATGCTCTGGTGGTCCCCGCTGACGGGGGAGACTGGGAGGTTA
GGCCAATGTGGAGCAGATGCTTGTTTCTTCACCATCAACCGGACCTACCTCCATCATCACATGACCAAAGCATTCCTCTTCTATGACTCC
CTGAGAAATGTTTCCTCAGCCGGTCATGGCCCCCGCTCTTCTCCAGCTGAGCTCAGCAGCTCTAGCCAGCACCTTCTCCGAGAGCGCAAG
TCCTCAGCCCCATCACACTCCAGCCAGCCAACTCTGTTCACGTTTGAACCCCCTGTGTCAAACCACATGCAGCCCACCTTGTCCACCAGC
GCACCTCAGGAGTATCTCTACTTGCACCAGTGCATAAGCCGAAGAGCAGAAAATGCAAGGAGTGCCAGCTTCTCTCAGGGCACCAGAGCC
TCTTTTCTCATGAGGAGTGACACAGCTGTACAAAAACTTGCCCAGGGCAATGGACACTGTGTCAACGGGATCAGTGGTCAAGTCCATGGC
TTCTATAGCCTTCCCAAGCCGAGCCGGCACAATACAGAATTCAGAGACAGTACCTACGACCTCCCCCGCAGCCTGGCCTCCCATGGCCAC
ACCAAGGGCAGCCTCACAGGCTCCGAGACAGATAATGAGGATGTGTACACCTTCAAGACGCCCAGCAACACCCTGTGCAGGGAGTTCGGG
GACCTCCTGGTAGACAATATGGATGTTCCGGCCACCCCACTCTCAGCCTACCAGATCCCTAGGACATTCACTCTGGACAAAAACCACAAT
GCCATGACAGTGGCCACTCCTGGGGACTCAGCCATAGCTCCCCCACCCCGCCCCCCCAAGCCAAGTCAGGCAGAAACACCTCGATGGGGC
AGTCCTCAGCAGAGACCGCCAATCAGTGAAAATAGCAGATCTGTCGCTGCCACCATCCCCAGACGCAACACCCTCCCTGCAATGGACAAC
AGCCGACTTCACCGAGCTTCTTCCTGTGAGACCTACGAGTACCCACAGCGTGGTGGAGAGAGTGCAGGCCGGTCTGCTGAATCCATGAGT
GATGGAGTTGGCTCTTTCCTGCCAGGGAAAATGATTGTGGGCCGATCGGACAGCACCAATTCTGAAGACAACTATGTGCCCATGAATCCA
GGTTCTTCCACCCTGTTGGCCATGGAACGAGCAGGTGATAATTCCCAGAGCGTCTACATCCCAATGAGCCCAGGGGCCCATCACTTTGAC
TCACTTGGCTACCCATCAACAACCCTTCCTGTGCACCGAGGCCCCAGCAGAGGAAGTGAGATTCAGCCACCCCCTGTCAACCGCAACCTC
AAACCTGATCGGAAAGCAAAGCCAACACCACTTGACCTGAGGAACAACACCGTCATCGATGAACTCCCCTTCAAGTCACCTATCACCAAG
TCTTGGTCTAGGGCCAACCACACCTTCAACTCCAGCTCCTCCCAGTACTGCCGCCCCATCTCCACCCAGAGCATCACCAGCACAGACTCA
GGAGACAGCGAAGAGAACTATGTCCCTATGCAAAACCCAGTGTCTGCATCTCCCGTTCCCAGTGGCACGAACAGTCCTGCCCCTAAGAAG
AGCACCGGCAGCGTTGATTATCTGGCCCTGGACTTCCAGCCGAGCTCCCCAAGCCCCCACCGCAAGCCATCTACTTCATCCGTCACCTCT
GATGAGAAGGTGGACTACGTTCAGGTGGACAAGGAGAAGACCCAGGCCCTGCAGAACACCATGCAGGAGTGGACAGACGTGCGGCAGTCC
TCAGAGCCTTCCAAGGGTGCCAAGCTGTGATGAGAGGGCCACCGCAGAGCCCAGGAGGCAGCATCTCCAGAGCTGGCCCTTCCCATCTCC
CCTCTCCCCTCTCCCGTTCTTCCTCCCATCCACCTCCTCTCTACTCTGCCAGTCTCAGCCTTCAAAGCACTTGACATCAGGGACCCTGAA
CCCTTCCCCTGGGAGGTGAGGGCCTGATCAAGGCACCTCCTCTGCCCACTCGGGGCCCAGCTGTGATTTTTATCAGTAATGGCCATGCCT
CCACCCACCTTAGTTAGGAGCTACTTCCAAAAAGCATCCTTCAGCCTCTTCCTGTCCTTTAGACCTGACTCTCTACCAGATGTTTGGAGG
GAAGGGCTGGGGCTCTGAGCCAGATTCCACACCTCACGTTCAGTCACAGCCCTCAGCTATCTTCCCTCCGGCCACTGGGCTACCTCTCCT
TCAGTCCCAGAAGACAAGTCTCACCAACCCAGGGAGTCAAGGACCAGCAAACCAAAGTGGATAATGGACTTTTTCATTCCTGTTTTTCTT
GGCAGGAGAGAAGCAAGGCCACTAAAAGAGGAGATGGTGGAGACGGAGGCTCAGCAGTGGTCTTGAGGGGTAAAGGACTTAGATGCCCAG
ATGAAGAGGGAAAGCTGACATCTGCAGGGAACCCACTTTGAGGCTGAGGCCATGGCAGGACAGCTGCTGTGGGGTGCAGAGGCAGAAGAT
GAAGGACAAAAGGAAGGGAAAACTGATGGCCAACCTAGAGCAGCAAGGAGCAGGGCTTGGAGCTCGGGTGGTGGAGATGACAAGGACACT
GTGGGGTCTGGGTCCCCAGAACTCTGGAGCTACAGGCCACTCTAGGCCCAAGGGCTAGTCCTCTTCCCCAGTCCCCTCAGAGGCCCCCGC
CAGCCCCACCTTGAAAGCAGCATACAGGGGAAGGCTTGGACCAAGCTGGGCGACCAAGCACATGGGGCAGGAACACATGGTAAAGGGGTG
GGGAATATGGGAGGGAGTGTGGTGTGGATGGGGGTGATGCAGGGACTGAGGGGAACCCTGGGACAGGCACAGGCTGGGCAGAGGCACAGG
GCAGTGCAGGGGACTCTGCAGTGGGGTCGGGAAGTGAGTTTCTTTGCAGTGAGCAGTGCAGTGGAAGTCGGGCACAGAGGTAGCAGACAG
ATGTGAAGCAGTGGTGAAGGCCATGTAGCAAGTGGGGAAATACATCCAAAGGGCCTGGGAGTTGGGGGGTGCCCAACGCAATCCTTGGGG
GTGCAGGGTGGAGCAGAAAGTGAAGGAGGGACACGTGCAAGAGTGGTGTGCATGGTGGTGTGACATGAGGACCGTTCCTAGGATGGGACA
GTGGGTCAGGCAGGACAAGGAGAAAGCAGGGCAGAATGATGCCTAGAGGACCACATCAGGCATGGCTGACAGCTTGTGCCCATGGGCTGT
GGCGTATGTCAGATCGCAGGGTAGGAACGAGTCTGGCCTGGTGCCGGCCCAGTGTTTCCTCAGCTCATCCGCCCTCTGTTGCTCCCTAGC
ATTCCAGGAGCCATCTTGGACTCTCCTCCCCAGGTTTGAAAGGCCATCAGATTAGCAGGGACGGGGTGTAGGGCATCACCCAAGGTTCCT
TCTCTTAAACTAAGGGTGGGGGATCTGAATGTTTTTATGTTGACTGTTCTTGACTAAATTTTCAAGAGTTTCAGAAGCAACAGGACAGAC
CAGACGTTTCATTCTACCCTGGGGCGAACAGAACTTCTTCCTCCCAAACAATGACTTCCTGCCATGTTTGATGGGGACAGCTACCACTGT
CCTCTGCCCCCATTCCCCTTTCAGCTCCCATGAGCATGCATAGTTCACCAGACCAATGGCCTAGCCATTCTCTAAGTCCCATCCTGGAAG
AAGTTATTTCTTCAAGAGCTGCACCTCTCCTCCTAGCATTAGTTTAGATCAACTCAAGGAGTATTTATTAATGGCTGCTGTCTCCAGTTT
CTGGGGTTAAGCACTAAGGACACAAGAATCAATCAGACCTTCTCCCTGAACTTAAGATAGCCACAATCAGAAAAAGGACAAGGACATGAG
ACAGTGGTGATGGCCATCAGACAGAGACTTCAAATGCTGATGGAGGGCAGAGGAAGTACTTAGGGAGGTTGGTGTCAGAGGCAGGAGTGG
GGGATCAGGGAAGGTGGATTCTAGGAAAAGGGAGTGCCTGAGGTAGGCCTTAGAAGGGGATGAGTCAGATTTTTACAGAGGAGGAGGGCA
GGGCTTGGGTCCAGTGGAGGAAGAAGGAAGGAGAGGCTTGGAAAGCCTTGTGTCTTGGGAACAAAAGGCCTTTGAGCATATGGGTCCAGC
CACTCAGAAGTGTAGGGGCCATGCCTTGGTGTTCCAATAAGTGAATGGAAGCAGTGGTGGTAGCTACACTGGGCAGAGTTGGCAGGGTGC
TGGTTCACTCTGCCCAGCCCTGAATGTGTGCCTTAAAGGCCCCCTACAAGGGGCCCCATACGACAGAGCTTTTAACTGGTGCCTTCCCTG
TACCCGCAGCAGCCACAAGTGGGCCCAGACTATTGCAGCCTCCCATAAACATGTGAGCATGTTCTGAGTGTGCCATGATGTGAGTGGACC
TGGCTGGAATCTTCGGAGAGCGACTGAGGTGTTCAAATCGAATCTCCCAGGAGGCTTCCTTCCAGCCCCCTATTCTGGTAACTACCAGGA
GGCTTCCTTCCAGCCCCCTATTCTGGTAACTACCAAAATCCCTCGGGTGCAAGTGTAGGGGTAGAGATGGAAGGATGAGAGGTGAAATTG
ACCTTTTGAAAGCAAAGCTCTGGCTCACAGGCCCCAAACTACCAGCCGTATCTAGCATATCCCCACCCTCCACCCACTACCTCCTCCAAC
AAAGGAGTCAACTCAGTTGAAAAAACTGGTCCTTTGGCCTATCCATGGGTCAAAGTCCACCTCTCCTGGGGGCCTGGAGAGGACTGAGCC
TACGGAAAGGGGATACCTTCCCACTCAGCACTGCTTCACACAGGCCCCCTGCCTGGGGCTCTCCAAGGAGCCTTCTTCACCCACTTCCAG
CTCCACTTCTGCAAGGTTAAGTCAAGTGAGAACGATGAGAAATAGGGAGATGGTGTCTCCTTAAGTCCTTGATCTGCCTGTCTGTGGAAT
GGGAGGTTGGATTAGCTGCGCTGAGGTCCCATCCACAGCTGGTGCTCAGCTGCTTGAAGGGGAGACTCCCTCCTCTGTAACTTCTTTCTG
GGGGATTGGGGTGGGCAGTACCTATCCCCAGTCCCCTCCTAGCTTGACTTTAGTGGTTTCCAATGTAGAAGTTAACAAAGTATGCCCCAT
TCCTGTGACAAAAGCACAACCATTCTGAAGTTACTGGAGCATGGGCTCAGCTCATCCTCCCTCTGGCCCCTTCTCCCATGGGGACATCTC
GGCCCAGCACCCCTATCCCATTTCCAGAGTTCTTCCTTCCCCATCTGGGCCTTCATAAAATGCAGGGGAAGCCAGACTGGTCTCAGGAGC
GCTAAAGCCCTTCCGTGGGGGGTCGTCTTTCTGGGACTAGCCCTGCTGTTTAGGACCTGGGACCACAATGGGGTACCTGCCGAGGGGGTC
CCCAAGAGATCCAGGCTGTCATGTGATTTATGGTGGCATGTGTTGTGTATTTGTTGGCTACTTGTGTCTTGAAATCTAGAATTATTTCAC
GCAGAATTGTCACTGTTTGTCAGGAAGAGAAAATGGGCTAGTGGAAGCCCAGTCTTGAGTTCTTGTCTTGTTACCATTTAAAATTGACAT
TTAATTTTCAAATCACTGTTGGTGCCTAATCACTTAAGTTATTAATTTATTCTGTTGTATTCTTTTTTTTAAATTGTAACATATTTATCC
GGTGGGTGGGACAGGAGTGTGTTCAAGTGGGTCATGTTTTTGCTGTGGTGACACATGGTACAGGCTTGGAGCTTGCAGGTCCCTTTCTAC

>In-frame_FUT10_ENST00000524021_chr8_33310734_-_GAB2_ENST00000340149_chr11_77961446_-_6295nt
ATAGGGAGAAAGGAAGCTGCGCTGCATTCTGCGGGACGAACCCTGCTCCGCGCGAGAATTTTTTTGATTCCTTCTTATTTGGAGAAATCT
CCAGCTGCTCTGATGATAGCCTAAGAAGACTGCATGCTGCTTCCTCTCGATGCCAAGCCAGACCCTCTCACAACCTCGGATCTCAGTCCT
TCATGGAGACCTGGTCCCAGCAGGAATGGCAGTGCAGGAAATTGGCGCCCAGATGGTTCTTCCATGTGAAGTTGTCTCGGGCTCTGGGCT
GACGAGAGAACACCTGGTAACCAGGTTAGCCCTCTGTCAGTCACCCAGGGCAGGGCAGCATGGTGCGGATTCAGAGGAGGAAGCTTTTGG
CATCTTGCCTGTCATGGTTGAGCTGGGGAAGTTTGAAAGGAAGGAGTTTAAAAGTTCCAGTTTGCAAGATGGACATACAAAAATGGAGGA
AGCACCTACGCATCTTAATTCATTTCTTAAGAAAGAAGGATTGACCTTCAACAGGAAAAGAAAATGGGAATTGGACAGCTACCCCATTAT
GCTCTGGTGGTCCCCGCTGACGGGGGAGACTGGGAGGTTAGGCCAATGTGGAGCAGATGCTTGTTTCTTCACCATCAACCGGACCTACCT
CCATCATCACATGACCAAAGCATTCCTCTTCTATGACTCCCTGAGAAATGTTTCCTCAGCCGGTCATGGCCCCCGCTCTTCTCCAGCTGA
GCTCAGCAGCTCTAGCCAGCACCTTCTCCGAGAGCGCAAGTCCTCAGCCCCATCACACTCCAGCCAGCCAACTCTGTTCACGTTTGAACC
CCCTGTGTCAAACCACATGCAGCCCACCTTGTCCACCAGCGCACCTCAGGAGTATCTCTACTTGCACCAGTGCATAAGCCGAAGAGCAGA
AAATGCAAGGAGTGCCAGCTTCTCTCAGGGCACCAGAGCCTCTTTTCTCATGAGGAGTGACACAGCTGTACAAAAACTTGCCCAGGGCAA
TGGACACTGTGTCAACGGGATCAGTGGTCAAGTCCATGGCTTCTATAGCCTTCCCAAGCCGAGCCGGCACAATACAGAATTCAGAGACAG
TACCTACGACCTCCCCCGCAGCCTGGCCTCCCATGGCCACACCAAGGGCAGCCTCACAGGCTCCGAGACAGATAATGAGGATGTGTACAC
CTTCAAGACGCCCAGCAACACCCTGTGCAGGGAGTTCGGGGACCTCCTGGTAGACAATATGGATGTTCCGGCCACCCCACTCTCAGCCTA
CCAGATCCCTAGGACATTCACTCTGGACAAAAACCACAATGCCATGACAGTGGCCACTCCTGGGGACTCAGCCATAGCTCCCCCACCCCG
CCCCCCCAAGCCAAGTCAGGCAGAAACACCTCGATGGGGCAGTCCTCAGCAGAGACCGCCAATCAGTGAAAATAGCAGATCTGTCGCTGC
CACCATCCCCAGACGCAACACCCTCCCTGCAATGGACAACAGCCGACTTCACCGAGCTTCTTCCTGTGAGACCTACGAGTACCCACAGCG
TGGTGGAGAGAGTGCAGGCCGGTCTGCTGAATCCATGAGTGATGGAGTTGGCTCTTTCCTGCCAGGGAAAATGATTGTGGGCCGATCGGA
CAGCACCAATTCTGAAGACAACTATGTGCCCATGAATCCAGGTTCTTCCACCCTGTTGGCCATGGAACGAGCAGGTGATAATTCCCAGAG
CGTCTACATCCCAATGAGCCCAGGGGCCCATCACTTTGACTCACTTGGCTACCCATCAACAACCCTTCCTGTGCACCGAGGCCCCAGCAG
AGGAAGTGAGATTCAGCCACCCCCTGTCAACCGCAACCTCAAACCTGATCGGAAAGCAAAGCCAACACCACTTGACCTGAGGAACAACAC
CGTCATCGATGAACTCCCCTTCAAGTCACCTATCACCAAGTCTTGGTCTAGGGCCAACCACACCTTCAACTCCAGCTCCTCCCAGTACTG
CCGCCCCATCTCCACCCAGAGCATCACCAGCACAGACTCAGGAGACAGCGAAGAGAACTATGTCCCTATGCAAAACCCAGTGTCTGCATC
TCCCGTTCCCAGTGGCACGAACAGTCCTGCCCCTAAGAAGAGCACCGGCAGCGTTGATTATCTGGCCCTGGACTTCCAGCCGAGCTCCCC
AAGCCCCCACCGCAAGCCATCTACTTCATCCGTCACCTCTGATGAGAAGGTGGACTACGTTCAGGTGGACAAGGAGAAGACCCAGGCCCT
GCAGAACACCATGCAGGAGTGGACAGACGTGCGGCAGTCCTCAGAGCCTTCCAAGGGTGCCAAGCTGTGATGAGAGGGCCACCGCAGAGC
CCAGGAGGCAGCATCTCCAGAGCTGGCCCTTCCCATCTCCCCTCTCCCCTCTCCCGTTCTTCCTCCCATCCACCTCCTCTCTACTCTGCC
AGTCTCAGCCTTCAAAGCACTTGACATCAGGGACCCTGAACCCTTCCCCTGGGAGGTGAGGGCCTGATCAAGGCACCTCCTCTGCCCACT
CGGGGCCCAGCTGTGATTTTTATCAGTAATGGCCATGCCTCCACCCACCTTAGTTAGGAGCTACTTCCAAAAAGCATCCTTCAGCCTCTT
CCTGTCCTTTAGACCTGACTCTCTACCAGATGTTTGGAGGGAAGGGCTGGGGCTCTGAGCCAGATTCCACACCTCACGTTCAGTCACAGC
CCTCAGCTATCTTCCCTCCGGCCACTGGGCTACCTCTCCTTCAGTCCCAGAAGACAAGTCTCACCAACCCAGGGAGTCAAGGACCAGCAA
ACCAAAGTGGATAATGGACTTTTTCATTCCTGTTTTTCTTGGCAGGAGAGAAGCAAGGCCACTAAAAGAGGAGATGGTGGAGACGGAGGC
TCAGCAGTGGTCTTGAGGGGTAAAGGACTTAGATGCCCAGATGAAGAGGGAAAGCTGACATCTGCAGGGAACCCACTTTGAGGCTGAGGC
CATGGCAGGACAGCTGCTGTGGGGTGCAGAGGCAGAAGATGAAGGACAAAAGGAAGGGAAAACTGATGGCCAACCTAGAGCAGCAAGGAG
CAGGGCTTGGAGCTCGGGTGGTGGAGATGACAAGGACACTGTGGGGTCTGGGTCCCCAGAACTCTGGAGCTACAGGCCACTCTAGGCCCA
AGGGCTAGTCCTCTTCCCCAGTCCCCTCAGAGGCCCCCGCCAGCCCCACCTTGAAAGCAGCATACAGGGGAAGGCTTGGACCAAGCTGGG
CGACCAAGCACATGGGGCAGGAACACATGGTAAAGGGGTGGGGAATATGGGAGGGAGTGTGGTGTGGATGGGGGTGATGCAGGGACTGAG
GGGAACCCTGGGACAGGCACAGGCTGGGCAGAGGCACAGGGCAGTGCAGGGGACTCTGCAGTGGGGTCGGGAAGTGAGTTTCTTTGCAGT
GAGCAGTGCAGTGGAAGTCGGGCACAGAGGTAGCAGACAGATGTGAAGCAGTGGTGAAGGCCATGTAGCAAGTGGGGAAATACATCCAAA
GGGCCTGGGAGTTGGGGGGTGCCCAACGCAATCCTTGGGGGTGCAGGGTGGAGCAGAAAGTGAAGGAGGGACACGTGCAAGAGTGGTGTG
CATGGTGGTGTGACATGAGGACCGTTCCTAGGATGGGACAGTGGGTCAGGCAGGACAAGGAGAAAGCAGGGCAGAATGATGCCTAGAGGA
CCACATCAGGCATGGCTGACAGCTTGTGCCCATGGGCTGTGGCGTATGTCAGATCGCAGGGTAGGAACGAGTCTGGCCTGGTGCCGGCCC
AGTGTTTCCTCAGCTCATCCGCCCTCTGTTGCTCCCTAGCATTCCAGGAGCCATCTTGGACTCTCCTCCCCAGGTTTGAAAGGCCATCAG
ATTAGCAGGGACGGGGTGTAGGGCATCACCCAAGGTTCCTTCTCTTAAACTAAGGGTGGGGGATCTGAATGTTTTTATGTTGACTGTTCT
TGACTAAATTTTCAAGAGTTTCAGAAGCAACAGGACAGACCAGACGTTTCATTCTACCCTGGGGCGAACAGAACTTCTTCCTCCCAAACA
ATGACTTCCTGCCATGTTTGATGGGGACAGCTACCACTGTCCTCTGCCCCCATTCCCCTTTCAGCTCCCATGAGCATGCATAGTTCACCA
GACCAATGGCCTAGCCATTCTCTAAGTCCCATCCTGGAAGAAGTTATTTCTTCAAGAGCTGCACCTCTCCTCCTAGCATTAGTTTAGATC
AACTCAAGGAGTATTTATTAATGGCTGCTGTCTCCAGTTTCTGGGGTTAAGCACTAAGGACACAAGAATCAATCAGACCTTCTCCCTGAA
CTTAAGATAGCCACAATCAGAAAAAGGACAAGGACATGAGACAGTGGTGATGGCCATCAGACAGAGACTTCAAATGCTGATGGAGGGCAG
AGGAAGTACTTAGGGAGGTTGGTGTCAGAGGCAGGAGTGGGGGATCAGGGAAGGTGGATTCTAGGAAAAGGGAGTGCCTGAGGTAGGCCT
TAGAAGGGGATGAGTCAGATTTTTACAGAGGAGGAGGGCAGGGCTTGGGTCCAGTGGAGGAAGAAGGAAGGAGAGGCTTGGAAAGCCTTG
TGTCTTGGGAACAAAAGGCCTTTGAGCATATGGGTCCAGCCACTCAGAAGTGTAGGGGCCATGCCTTGGTGTTCCAATAAGTGAATGGAA
GCAGTGGTGGTAGCTACACTGGGCAGAGTTGGCAGGGTGCTGGTTCACTCTGCCCAGCCCTGAATGTGTGCCTTAAAGGCCCCCTACAAG
GGGCCCCATACGACAGAGCTTTTAACTGGTGCCTTCCCTGTACCCGCAGCAGCCACAAGTGGGCCCAGACTATTGCAGCCTCCCATAAAC
ATGTGAGCATGTTCTGAGTGTGCCATGATGTGAGTGGACCTGGCTGGAATCTTCGGAGAGCGACTGAGGTGTTCAAATCGAATCTCCCAG
GAGGCTTCCTTCCAGCCCCCTATTCTGGTAACTACCAGGAGGCTTCCTTCCAGCCCCCTATTCTGGTAACTACCAAAATCCCTCGGGTGC
AAGTGTAGGGGTAGAGATGGAAGGATGAGAGGTGAAATTGACCTTTTGAAAGCAAAGCTCTGGCTCACAGGCCCCAAACTACCAGCCGTA
TCTAGCATATCCCCACCCTCCACCCACTACCTCCTCCAACAAAGGAGTCAACTCAGTTGAAAAAACTGGTCCTTTGGCCTATCCATGGGT
CAAAGTCCACCTCTCCTGGGGGCCTGGAGAGGACTGAGCCTACGGAAAGGGGATACCTTCCCACTCAGCACTGCTTCACACAGGCCCCCT
GCCTGGGGCTCTCCAAGGAGCCTTCTTCACCCACTTCCAGCTCCACTTCTGCAAGGTTAAGTCAAGTGAGAACGATGAGAAATAGGGAGA
TGGTGTCTCCTTAAGTCCTTGATCTGCCTGTCTGTGGAATGGGAGGTTGGATTAGCTGCGCTGAGGTCCCATCCACAGCTGGTGCTCAGC
TGCTTGAAGGGGAGACTCCCTCCTCTGTAACTTCTTTCTGGGGGATTGGGGTGGGCAGTACCTATCCCCAGTCCCCTCCTAGCTTGACTT
TAGTGGTTTCCAATGTAGAAGTTAACAAAGTATGCCCCATTCCTGTGACAAAAGCACAACCATTCTGAAGTTACTGGAGCATGGGCTCAG
CTCATCCTCCCTCTGGCCCCTTCTCCCATGGGGACATCTCGGCCCAGCACCCCTATCCCATTTCCAGAGTTCTTCCTTCCCCATCTGGGC
CTTCATAAAATGCAGGGGAAGCCAGACTGGTCTCAGGAGCGCTAAAGCCCTTCCGTGGGGGGTCGTCTTTCTGGGACTAGCCCTGCTGTT
TAGGACCTGGGACCACAATGGGGTACCTGCCGAGGGGGTCCCCAAGAGATCCAGGCTGTCATGTGATTTATGGTGGCATGTGTTGTGTAT
TTGTTGGCTACTTGTGTCTTGAAATCTAGAATTATTTCACGCAGAATTGTCACTGTTTGTCAGGAAGAGAAAATGGGCTAGTGGAAGCCC
AGTCTTGAGTTCTTGTCTTGTTACCATTTAAAATTGACATTTAATTTTCAAATCACTGTTGGTGCCTAATCACTTAAGTTATTAATTTAT
TCTGTTGTATTCTTTTTTTTAAATTGTAACATATTTATCCGGTGGGTGGGACAGGAGTGTGTTCAAGTGGGTCATGTTTTTGCTGTGGTG

>In-frame_FUT10_ENST00000524021_chr8_33310734_-_GAB2_ENST00000361507_chr11_77961446_-_6295nt
ATAGGGAGAAAGGAAGCTGCGCTGCATTCTGCGGGACGAACCCTGCTCCGCGCGAGAATTTTTTTGATTCCTTCTTATTTGGAGAAATCT
CCAGCTGCTCTGATGATAGCCTAAGAAGACTGCATGCTGCTTCCTCTCGATGCCAAGCCAGACCCTCTCACAACCTCGGATCTCAGTCCT
TCATGGAGACCTGGTCCCAGCAGGAATGGCAGTGCAGGAAATTGGCGCCCAGATGGTTCTTCCATGTGAAGTTGTCTCGGGCTCTGGGCT
GACGAGAGAACACCTGGTAACCAGGTTAGCCCTCTGTCAGTCACCCAGGGCAGGGCAGCATGGTGCGGATTCAGAGGAGGAAGCTTTTGG
CATCTTGCCTGTCATGGTTGAGCTGGGGAAGTTTGAAAGGAAGGAGTTTAAAAGTTCCAGTTTGCAAGATGGACATACAAAAATGGAGGA
AGCACCTACGCATCTTAATTCATTTCTTAAGAAAGAAGGATTGACCTTCAACAGGAAAAGAAAATGGGAATTGGACAGCTACCCCATTAT
GCTCTGGTGGTCCCCGCTGACGGGGGAGACTGGGAGGTTAGGCCAATGTGGAGCAGATGCTTGTTTCTTCACCATCAACCGGACCTACCT
CCATCATCACATGACCAAAGCATTCCTCTTCTATGACTCCCTGAGAAATGTTTCCTCAGCCGGTCATGGCCCCCGCTCTTCTCCAGCTGA
GCTCAGCAGCTCTAGCCAGCACCTTCTCCGAGAGCGCAAGTCCTCAGCCCCATCACACTCCAGCCAGCCAACTCTGTTCACGTTTGAACC
CCCTGTGTCAAACCACATGCAGCCCACCTTGTCCACCAGCGCACCTCAGGAGTATCTCTACTTGCACCAGTGCATAAGCCGAAGAGCAGA
AAATGCAAGGAGTGCCAGCTTCTCTCAGGGCACCAGAGCCTCTTTTCTCATGAGGAGTGACACAGCTGTACAAAAACTTGCCCAGGGCAA
TGGACACTGTGTCAACGGGATCAGTGGTCAAGTCCATGGCTTCTATAGCCTTCCCAAGCCGAGCCGGCACAATACAGAATTCAGAGACAG
TACCTACGACCTCCCCCGCAGCCTGGCCTCCCATGGCCACACCAAGGGCAGCCTCACAGGCTCCGAGACAGATAATGAGGATGTGTACAC
CTTCAAGACGCCCAGCAACACCCTGTGCAGGGAGTTCGGGGACCTCCTGGTAGACAATATGGATGTTCCGGCCACCCCACTCTCAGCCTA
CCAGATCCCTAGGACATTCACTCTGGACAAAAACCACAATGCCATGACAGTGGCCACTCCTGGGGACTCAGCCATAGCTCCCCCACCCCG
CCCCCCCAAGCCAAGTCAGGCAGAAACACCTCGATGGGGCAGTCCTCAGCAGAGACCGCCAATCAGTGAAAATAGCAGATCTGTCGCTGC
CACCATCCCCAGACGCAACACCCTCCCTGCAATGGACAACAGCCGACTTCACCGAGCTTCTTCCTGTGAGACCTACGAGTACCCACAGCG
TGGTGGAGAGAGTGCAGGCCGGTCTGCTGAATCCATGAGTGATGGAGTTGGCTCTTTCCTGCCAGGGAAAATGATTGTGGGCCGATCGGA
CAGCACCAATTCTGAAGACAACTATGTGCCCATGAATCCAGGTTCTTCCACCCTGTTGGCCATGGAACGAGCAGGTGATAATTCCCAGAG
CGTCTACATCCCAATGAGCCCAGGGGCCCATCACTTTGACTCACTTGGCTACCCATCAACAACCCTTCCTGTGCACCGAGGCCCCAGCAG
AGGAAGTGAGATTCAGCCACCCCCTGTCAACCGCAACCTCAAACCTGATCGGAAAGCAAAGCCAACACCACTTGACCTGAGGAACAACAC
CGTCATCGATGAACTCCCCTTCAAGTCACCTATCACCAAGTCTTGGTCTAGGGCCAACCACACCTTCAACTCCAGCTCCTCCCAGTACTG
CCGCCCCATCTCCACCCAGAGCATCACCAGCACAGACTCAGGAGACAGCGAAGAGAACTATGTCCCTATGCAAAACCCAGTGTCTGCATC
TCCCGTTCCCAGTGGCACGAACAGTCCTGCCCCTAAGAAGAGCACCGGCAGCGTTGATTATCTGGCCCTGGACTTCCAGCCGAGCTCCCC
AAGCCCCCACCGCAAGCCATCTACTTCATCCGTCACCTCTGATGAGAAGGTGGACTACGTTCAGGTGGACAAGGAGAAGACCCAGGCCCT
GCAGAACACCATGCAGGAGTGGACAGACGTGCGGCAGTCCTCAGAGCCTTCCAAGGGTGCCAAGCTGTGATGAGAGGGCCACCGCAGAGC
CCAGGAGGCAGCATCTCCAGAGCTGGCCCTTCCCATCTCCCCTCTCCCCTCTCCCGTTCTTCCTCCCATCCACCTCCTCTCTACTCTGCC
AGTCTCAGCCTTCAAAGCACTTGACATCAGGGACCCTGAACCCTTCCCCTGGGAGGTGAGGGCCTGATCAAGGCACCTCCTCTGCCCACT
CGGGGCCCAGCTGTGATTTTTATCAGTAATGGCCATGCCTCCACCCACCTTAGTTAGGAGCTACTTCCAAAAAGCATCCTTCAGCCTCTT
CCTGTCCTTTAGACCTGACTCTCTACCAGATGTTTGGAGGGAAGGGCTGGGGCTCTGAGCCAGATTCCACACCTCACGTTCAGTCACAGC
CCTCAGCTATCTTCCCTCCGGCCACTGGGCTACCTCTCCTTCAGTCCCAGAAGACAAGTCTCACCAACCCAGGGAGTCAAGGACCAGCAA
ACCAAAGTGGATAATGGACTTTTTCATTCCTGTTTTTCTTGGCAGGAGAGAAGCAAGGCCACTAAAAGAGGAGATGGTGGAGACGGAGGC
TCAGCAGTGGTCTTGAGGGGTAAAGGACTTAGATGCCCAGATGAAGAGGGAAAGCTGACATCTGCAGGGAACCCACTTTGAGGCTGAGGC
CATGGCAGGACAGCTGCTGTGGGGTGCAGAGGCAGAAGATGAAGGACAAAAGGAAGGGAAAACTGATGGCCAACCTAGAGCAGCAAGGAG
CAGGGCTTGGAGCTCGGGTGGTGGAGATGACAAGGACACTGTGGGGTCTGGGTCCCCAGAACTCTGGAGCTACAGGCCACTCTAGGCCCA
AGGGCTAGTCCTCTTCCCCAGTCCCCTCAGAGGCCCCCGCCAGCCCCACCTTGAAAGCAGCATACAGGGGAAGGCTTGGACCAAGCTGGG
CGACCAAGCACATGGGGCAGGAACACATGGTAAAGGGGTGGGGAATATGGGAGGGAGTGTGGTGTGGATGGGGGTGATGCAGGGACTGAG
GGGAACCCTGGGACAGGCACAGGCTGGGCAGAGGCACAGGGCAGTGCAGGGGACTCTGCAGTGGGGTCGGGAAGTGAGTTTCTTTGCAGT
GAGCAGTGCAGTGGAAGTCGGGCACAGAGGTAGCAGACAGATGTGAAGCAGTGGTGAAGGCCATGTAGCAAGTGGGGAAATACATCCAAA
GGGCCTGGGAGTTGGGGGGTGCCCAACGCAATCCTTGGGGGTGCAGGGTGGAGCAGAAAGTGAAGGAGGGACACGTGCAAGAGTGGTGTG
CATGGTGGTGTGACATGAGGACCGTTCCTAGGATGGGACAGTGGGTCAGGCAGGACAAGGAGAAAGCAGGGCAGAATGATGCCTAGAGGA
CCACATCAGGCATGGCTGACAGCTTGTGCCCATGGGCTGTGGCGTATGTCAGATCGCAGGGTAGGAACGAGTCTGGCCTGGTGCCGGCCC
AGTGTTTCCTCAGCTCATCCGCCCTCTGTTGCTCCCTAGCATTCCAGGAGCCATCTTGGACTCTCCTCCCCAGGTTTGAAAGGCCATCAG
ATTAGCAGGGACGGGGTGTAGGGCATCACCCAAGGTTCCTTCTCTTAAACTAAGGGTGGGGGATCTGAATGTTTTTATGTTGACTGTTCT
TGACTAAATTTTCAAGAGTTTCAGAAGCAACAGGACAGACCAGACGTTTCATTCTACCCTGGGGCGAACAGAACTTCTTCCTCCCAAACA
ATGACTTCCTGCCATGTTTGATGGGGACAGCTACCACTGTCCTCTGCCCCCATTCCCCTTTCAGCTCCCATGAGCATGCATAGTTCACCA
GACCAATGGCCTAGCCATTCTCTAAGTCCCATCCTGGAAGAAGTTATTTCTTCAAGAGCTGCACCTCTCCTCCTAGCATTAGTTTAGATC
AACTCAAGGAGTATTTATTAATGGCTGCTGTCTCCAGTTTCTGGGGTTAAGCACTAAGGACACAAGAATCAATCAGACCTTCTCCCTGAA
CTTAAGATAGCCACAATCAGAAAAAGGACAAGGACATGAGACAGTGGTGATGGCCATCAGACAGAGACTTCAAATGCTGATGGAGGGCAG
AGGAAGTACTTAGGGAGGTTGGTGTCAGAGGCAGGAGTGGGGGATCAGGGAAGGTGGATTCTAGGAAAAGGGAGTGCCTGAGGTAGGCCT
TAGAAGGGGATGAGTCAGATTTTTACAGAGGAGGAGGGCAGGGCTTGGGTCCAGTGGAGGAAGAAGGAAGGAGAGGCTTGGAAAGCCTTG
TGTCTTGGGAACAAAAGGCCTTTGAGCATATGGGTCCAGCCACTCAGAAGTGTAGGGGCCATGCCTTGGTGTTCCAATAAGTGAATGGAA
GCAGTGGTGGTAGCTACACTGGGCAGAGTTGGCAGGGTGCTGGTTCACTCTGCCCAGCCCTGAATGTGTGCCTTAAAGGCCCCCTACAAG
GGGCCCCATACGACAGAGCTTTTAACTGGTGCCTTCCCTGTACCCGCAGCAGCCACAAGTGGGCCCAGACTATTGCAGCCTCCCATAAAC
ATGTGAGCATGTTCTGAGTGTGCCATGATGTGAGTGGACCTGGCTGGAATCTTCGGAGAGCGACTGAGGTGTTCAAATCGAATCTCCCAG
GAGGCTTCCTTCCAGCCCCCTATTCTGGTAACTACCAGGAGGCTTCCTTCCAGCCCCCTATTCTGGTAACTACCAAAATCCCTCGGGTGC
AAGTGTAGGGGTAGAGATGGAAGGATGAGAGGTGAAATTGACCTTTTGAAAGCAAAGCTCTGGCTCACAGGCCCCAAACTACCAGCCGTA
TCTAGCATATCCCCACCCTCCACCCACTACCTCCTCCAACAAAGGAGTCAACTCAGTTGAAAAAACTGGTCCTTTGGCCTATCCATGGGT
CAAAGTCCACCTCTCCTGGGGGCCTGGAGAGGACTGAGCCTACGGAAAGGGGATACCTTCCCACTCAGCACTGCTTCACACAGGCCCCCT
GCCTGGGGCTCTCCAAGGAGCCTTCTTCACCCACTTCCAGCTCCACTTCTGCAAGGTTAAGTCAAGTGAGAACGATGAGAAATAGGGAGA
TGGTGTCTCCTTAAGTCCTTGATCTGCCTGTCTGTGGAATGGGAGGTTGGATTAGCTGCGCTGAGGTCCCATCCACAGCTGGTGCTCAGC
TGCTTGAAGGGGAGACTCCCTCCTCTGTAACTTCTTTCTGGGGGATTGGGGTGGGCAGTACCTATCCCCAGTCCCCTCCTAGCTTGACTT
TAGTGGTTTCCAATGTAGAAGTTAACAAAGTATGCCCCATTCCTGTGACAAAAGCACAACCATTCTGAAGTTACTGGAGCATGGGCTCAG
CTCATCCTCCCTCTGGCCCCTTCTCCCATGGGGACATCTCGGCCCAGCACCCCTATCCCATTTCCAGAGTTCTTCCTTCCCCATCTGGGC
CTTCATAAAATGCAGGGGAAGCCAGACTGGTCTCAGGAGCGCTAAAGCCCTTCCGTGGGGGGTCGTCTTTCTGGGACTAGCCCTGCTGTT
TAGGACCTGGGACCACAATGGGGTACCTGCCGAGGGGGTCCCCAAGAGATCCAGGCTGTCATGTGATTTATGGTGGCATGTGTTGTGTAT
TTGTTGGCTACTTGTGTCTTGAAATCTAGAATTATTTCACGCAGAATTGTCACTGTTTGTCAGGAAGAGAAAATGGGCTAGTGGAAGCCC
AGTCTTGAGTTCTTGTCTTGTTACCATTTAAAATTGACATTTAATTTTCAAATCACTGTTGGTGCCTAATCACTTAAGTTATTAATTTAT
TCTGTTGTATTCTTTTTTTTAAATTGTAACATATTTATCCGGTGGGTGGGACAGGAGTGTGTTCAAGTGGGTCATGTTTTTGCTGTGGTG


Top

FusionGenePPI for FUT10_GAB2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FUT10PLTP, TMED6GAB2BCR, GRB2, ETV6, ARHGAP32, LYN, PLCG2, PTPN11, SHC1, ZAP70, CD247, LAT, PTPN6, PIK3R1, AKT1, GRAP, SRC, NCK1, PLCG1, CRKL, MET, GRAP2, LRRK1, PIK3R2, CRK, PIK3CB, MAPK1, MAPK3, MARK2, GAB1, GAB2, YWHAE, NTRK1, XPO1, FRS2, TGM4, KCTD3, KIF13B, ZBTB21, KSR1, GIGYF1, LRFN1, DENND1A, SH3PXD2A, SRGAP2, EIF4E2, SIPA1L1, LIMA1, MAGI1, TESK2, DCLK1, ZNF638, SRSF12, RTKN, MAST3, SYDE1, PPM1H, AGAP1, CDC25B, CDK16, FAM110B, USP21, ANKRD34A, FAM53C, CGN, FAM110A, DENND4C, HDAC4, MAPKAP1, TBC1D25, NF1, NADK, CBY1, RAB3IP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FUT10_GAB2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FUT10_GAB2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneGAB2C0025202melanoma1CTD_human
TgeneGAB2C0027626Neoplasm Invasiveness1CTD_human
TgeneGAB2C0027627Neoplasm Metastasis1CTD_human