FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14081

FusionGeneSummary for FUS_IL9R

check button Fusion gene summary
Fusion gene informationFusion gene name: FUS_IL9R
Fusion gene ID: 14081
HgeneTgene
Gene symbol

FUS

IL9R

Gene ID

2521

3581

Gene nameFUS RNA binding proteininterleukin 9 receptor
SynonymsALS6|ETM4|FUS1|HNRNPP2|POMP75|TLSCD129|IL-9R
Cytomap

16p11.2

Xq28 and Yq12

Type of geneprotein-codingprotein-coding
DescriptionRNA-binding protein FUS75 kDa DNA-pairing proteinFUS/ERG chimeric proteinFUS/ERG fusion proteinfus-like proteinfused in sarcomafusion gene in myxoid liposarcomaheterogeneous nuclear ribonucleoprotein P2oncogene FUSoncogene TLStranslocated in lipinterleukin-9 receptorIL-9 receptor
Modification date2018052720180522
UniProtAcc

P35637

Q01113

Ensembl transtripts involved in fusion geneENST00000254108, ENST00000380244, 
ENST00000568685, ENST00000474990, 
ENST00000244174, ENST00000424344, 
ENST00000369423, ENST00000540897, 
ENST00000494962, 
Fusion gene scores* DoF score21 X 23 X 7=33812 X 2 X 2=8
# samples 272
** MAII scorelog2(27/3381*10)=-3.64641870384255
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: FUS [Title/Abstract] AND IL9R [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDESCATCGA-IG-A51D-01AFUSchr16

31193985

+IL9RchrY

59335577

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000254108ENST00000244174FUSchr16

31193985

+IL9RchrY

59335577

+
5CDS-5UTRENST00000254108ENST00000424344FUSchr16

31193985

+IL9RchrY

59335577

+
5CDS-5UTRENST00000254108ENST00000369423FUSchr16

31193985

+IL9RchrY

59335577

+
5CDS-5UTRENST00000254108ENST00000540897FUSchr16

31193985

+IL9RchrY

59335577

+
5CDS-intronENST00000254108ENST00000494962FUSchr16

31193985

+IL9RchrY

59335577

+
In-frameENST00000380244ENST00000244174FUSchr16

31193985

+IL9RchrY

59335577

+
5CDS-5UTRENST00000380244ENST00000424344FUSchr16

31193985

+IL9RchrY

59335577

+
5CDS-5UTRENST00000380244ENST00000369423FUSchr16

31193985

+IL9RchrY

59335577

+
5CDS-5UTRENST00000380244ENST00000540897FUSchr16

31193985

+IL9RchrY

59335577

+
5CDS-intronENST00000380244ENST00000494962FUSchr16

31193985

+IL9RchrY

59335577

+
In-frameENST00000568685ENST00000244174FUSchr16

31193985

+IL9RchrY

59335577

+
5CDS-5UTRENST00000568685ENST00000424344FUSchr16

31193985

+IL9RchrY

59335577

+
5CDS-5UTRENST00000568685ENST00000369423FUSchr16

31193985

+IL9RchrY

59335577

+
5CDS-5UTRENST00000568685ENST00000540897FUSchr16

31193985

+IL9RchrY

59335577

+
5CDS-intronENST00000568685ENST00000494962FUSchr16

31193985

+IL9RchrY

59335577

+
intron-3CDSENST00000474990ENST00000244174FUSchr16

31193985

+IL9RchrY

59335577

+
intron-5UTRENST00000474990ENST00000424344FUSchr16

31193985

+IL9RchrY

59335577

+
intron-5UTRENST00000474990ENST00000369423FUSchr16

31193985

+IL9RchrY

59335577

+
intron-5UTRENST00000474990ENST00000540897FUSchr16

31193985

+IL9RchrY

59335577

+
intron-intronENST00000474990ENST00000494962FUSchr16

31193985

+IL9RchrY

59335577

+

Top

FusionProtFeatures for FUS_IL9R


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FUS

P35637

IL9R

Q01113

Binds both single-stranded and double-stranded DNA andpromotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-strandedDNA. May play a role in maintenance of genomic integrity. This is a receptor for interleukin-9.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneIL9Rchr16:31193985chrY:59335577ENST00000244174+09429_4389522Compositional biasNote=Poly-Ser
TgeneIL9Rchr16:31193985chrY:59335577ENST00000244174+09439_4429522Compositional biasNote=Poly-Asn
TgeneIL9Rchr16:31193985chrY:59335577ENST00000369423+09429_438-13343Compositional biasNote=Poly-Ser
TgeneIL9Rchr16:31193985chrY:59335577ENST00000369423+09439_442-13343Compositional biasNote=Poly-Asn
TgeneIL9Rchr16:31193985chrY:59335577ENST00000424344+010429_438-123501Compositional biasNote=Poly-Ser
TgeneIL9Rchr16:31193985chrY:59335577ENST00000424344+010439_442-123501Compositional biasNote=Poly-Asn
TgeneIL9Rchr16:31193985chrY:59335577ENST00000244174+09149_2599522DomainFibronectin type-III
TgeneIL9Rchr16:31193985chrY:59335577ENST00000369423+09149_259-13343DomainFibronectin type-III
TgeneIL9Rchr16:31193985chrY:59335577ENST00000424344+010149_259-123501DomainFibronectin type-III
TgeneIL9Rchr16:31193985chrY:59335577ENST00000244174+09245_2499522MotifNote=WSXWS motif
TgeneIL9Rchr16:31193985chrY:59335577ENST00000244174+09301_3099522MotifNote=Box 1 motif
TgeneIL9Rchr16:31193985chrY:59335577ENST00000369423+09245_249-13343MotifNote=WSXWS motif
TgeneIL9Rchr16:31193985chrY:59335577ENST00000369423+09301_309-13343MotifNote=Box 1 motif
TgeneIL9Rchr16:31193985chrY:59335577ENST00000424344+010245_249-123501MotifNote=WSXWS motif
TgeneIL9Rchr16:31193985chrY:59335577ENST00000424344+010301_309-123501MotifNote=Box 1 motif
TgeneIL9Rchr16:31193985chrY:59335577ENST00000244174+09292_5219522Topological domainCytoplasmic
TgeneIL9Rchr16:31193985chrY:59335577ENST00000244174+0941_2709522Topological domainExtracellular
TgeneIL9Rchr16:31193985chrY:59335577ENST00000369423+09292_521-13343Topological domainCytoplasmic
TgeneIL9Rchr16:31193985chrY:59335577ENST00000369423+0941_270-13343Topological domainExtracellular
TgeneIL9Rchr16:31193985chrY:59335577ENST00000424344+010292_521-123501Topological domainCytoplasmic
TgeneIL9Rchr16:31193985chrY:59335577ENST00000424344+01041_270-123501Topological domainExtracellular
TgeneIL9Rchr16:31193985chrY:59335577ENST00000244174+09271_2919522TransmembraneHelical
TgeneIL9Rchr16:31193985chrY:59335577ENST00000369423+09271_291-13343TransmembraneHelical
TgeneIL9Rchr16:31193985chrY:59335577ENST00000424344+010271_291-123501TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFUSchr16:31193985chrY:59335577ENST00000254108+315166_26763527Compositional biasNote=Gly-rich
HgeneFUSchr16:31193985chrY:59335577ENST00000254108+3151_16563527Compositional biasNote=Gln/Gly/Ser/Tyr-rich
HgeneFUSchr16:31193985chrY:59335577ENST00000254108+315371_52663527Compositional biasNote=Arg/Gly-rich
HgeneFUSchr16:31193985chrY:59335577ENST00000380244+315166_26763526Compositional biasNote=Gly-rich
HgeneFUSchr16:31193985chrY:59335577ENST00000380244+3151_16563526Compositional biasNote=Gln/Gly/Ser/Tyr-rich
HgeneFUSchr16:31193985chrY:59335577ENST00000380244+315371_52663526Compositional biasNote=Arg/Gly-rich
HgeneFUSchr16:31193985chrY:59335577ENST00000254108+315285_37163527DomainRRM
HgeneFUSchr16:31193985chrY:59335577ENST00000380244+315285_37163526DomainRRM
HgeneFUSchr16:31193985chrY:59335577ENST00000254108+315422_45363527Zinc fingerRanBP2-type
HgeneFUSchr16:31193985chrY:59335577ENST00000380244+315422_45363526Zinc fingerRanBP2-type


Top

FusionGeneSequence for FUS_IL9R


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FUS_ENST00000254108_chr16_31193985_+_IL9R_ENST00000244174_chrY_59335577_+_576aa
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNSWTLESEALRRDMGTWLLACICICTCV
CLGVSVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCM
SGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDP
GFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWPGNTLVAVSIFLLLTGPTYLLFKLSPRVKRIFYQNVP
SPAMFFQPLYSVHNGNFQTWMGAHGAGVLLSQDCAGTPQGALEPCVQEATALLTCGPARPWKSVALEEEQEGPGTRLPGNLSSEDVLPAG
CTEWRVQTLAYLPQEDWAPTSLTRPAPPDSEGSRSSSSSSSSNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQGLETQQG

>In-frame_FUS_ENST00000380244_chr16_31193985_+_IL9R_ENST00000244174_chrY_59335577_+_576aa
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNSWTLESEALRRDMGTWLLACICICTCV
CLGVSVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCM
SGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDP
GFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWPGNTLVAVSIFLLLTGPTYLLFKLSPRVKRIFYQNVP
SPAMFFQPLYSVHNGNFQTWMGAHGAGVLLSQDCAGTPQGALEPCVQEATALLTCGPARPWKSVALEEEQEGPGTRLPGNLSSEDVLPAG
CTEWRVQTLAYLPQEDWAPTSLTRPAPPDSEGSRSSSSSSSSNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQGLETQQG

>In-frame_FUS_ENST00000568685_chr16_31193985_+_IL9R_ENST00000244174_chrY_59335577_+_576aa
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNSWTLESEALRRDMGTWLLACICICTCV
CLGVSVTGEGQGPRSRTFTCLTNNILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILRGSECTVVLPPEAVLVPSDNFTITFHHCM
SGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLSYELAFKKQEEAWEQAQHRDHIVGVTWLILEAFELDP
GFIHEARLRVQMATLEDDVVEEERYTGQWSEWSQPVCFQAPQRQGPLIPPWGWPGNTLVAVSIFLLLTGPTYLLFKLSPRVKRIFYQNVP
SPAMFFQPLYSVHNGNFQTWMGAHGAGVLLSQDCAGTPQGALEPCVQEATALLTCGPARPWKSVALEEEQEGPGTRLPGNLSSEDVLPAG
CTEWRVQTLAYLPQEDWAPTSLTRPAPPDSEGSRSSSSSSSSNNNNYCALGCYGGWHLSALPGNTQSSGPIPALACGLSCDHQGLETQQG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FUS_ENST00000254108_chr16_31193985_+_IL9R_ENST00000244174_chrY_59335577_+_1728nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACAGCTGGACCTTGGAGAGTGAGGCCCTGAGGCGAGACATGGGCACCTGGCTCCTGGCCTGCATCTGCATCTGCACCTGTGTC
TGCTTGGGAGTCTCTGTCACAGGGGAAGGACAAGGGCCAAGGTCTAGAACCTTCACCTGCCTCACCAACAACATTCTCAGGATCGATTGC
CACTGGTCTGCCCCAGAGCTGGGACAGGGCTCCAGCCCCTGGCTCCTCTTCACCAGCAACCAGGCTCCTGGCGGCACACATAAGTGCATC
TTGCGGGGCAGTGAGTGCACCGTCGTGCTGCCACCTGAGGCAGTGCTCGTGCCATCTGACAATTTCACCATCACTTTCCACCACTGCATG
TCTGGGAGGGAGCAGGTCAGCCTGGTGGACCCGGAGTACCTGCCCCGGAGACACGTTAAGCTGGACCCGCCCTCTGACTTGCAGAGCAAC
ATCAGTTCTGGCCACTGCATCCTGACCTGGAGCATCAGTCCTGCCTTGGAGCCAATGACCACACTTCTCAGCTATGAGCTGGCCTTCAAG
AAGCAGGAAGAGGCCTGGGAGCAGGCCCAGCACAGGGATCACATTGTCGGGGTGACCTGGCTTATACTTGAAGCCTTTGAGCTGGACCCT
GGCTTTATCCATGAGGCCAGGCTGCGTGTCCAGATGGCCACACTGGAGGATGATGTGGTAGAGGAGGAGCGTTATACAGGCCAGTGGAGT
GAGTGGAGCCAGCCTGTGTGCTTCCAGGCTCCCCAGAGACAAGGCCCTCTGATCCCACCCTGGGGGTGGCCAGGCAACACCCTTGTTGCT
GTGTCCATCTTTCTCCTGCTGACTGGCCCGACCTACCTCCTGTTCAAGCTGTCGCCCAGGGTGAAGAGAATCTTCTACCAGAACGTGCCC
TCTCCAGCGATGTTCTTCCAGCCCCTCTACAGTGTACACAATGGGAACTTCCAGACTTGGATGGGGGCCCACGGGGCCGGTGTGCTGTTG
AGCCAGGACTGTGCTGGCACCCCACAGGGAGCCTTGGAGCCCTGCGTCCAGGAGGCCACTGCACTGCTCACTTGTGGCCCAGCGCGTCCT
TGGAAATCTGTGGCCCTGGAGGAGGAACAGGAGGGCCCTGGGACCAGGCTCCCGGGGAACCTGAGCTCAGAGGATGTGCTGCCAGCAGGG
TGTACGGAGTGGAGGGTACAGACGCTTGCCTATCTGCCACAGGAGGACTGGGCCCCCACGTCCCTGACTAGGCCGGCTCCCCCAGACTCA
GAGGGCAGCAGGAGCAGCAGCAGCAGCAGCAGCAGCAACAACAACAACTACTGTGCCTTGGGCTGCTATGGGGGATGGCACCTCTCAGCC
CTCCCAGGAAACACACAGAGCTCTGGGCCCATCCCAGCCCTGGCCTGTGGCCTTTCTTGTGACCATCAGGGCCTGGAGACCCAGCAAGGA
GTTGCCTGGGTGCTGGCTGGTCACTGCCAGAGGCCTGGGCTGCATGAGGACCTCCAGGGCATGTTGCTCCCTTCTGTCCTCAGCAAGGCT

>In-frame_FUS_ENST00000380244_chr16_31193985_+_IL9R_ENST00000244174_chrY_59335577_+_1728nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACAGCTGGACCTTGGAGAGTGAGGCCCTGAGGCGAGACATGGGCACCTGGCTCCTGGCCTGCATCTGCATCTGCACCTGTGTC
TGCTTGGGAGTCTCTGTCACAGGGGAAGGACAAGGGCCAAGGTCTAGAACCTTCACCTGCCTCACCAACAACATTCTCAGGATCGATTGC
CACTGGTCTGCCCCAGAGCTGGGACAGGGCTCCAGCCCCTGGCTCCTCTTCACCAGCAACCAGGCTCCTGGCGGCACACATAAGTGCATC
TTGCGGGGCAGTGAGTGCACCGTCGTGCTGCCACCTGAGGCAGTGCTCGTGCCATCTGACAATTTCACCATCACTTTCCACCACTGCATG
TCTGGGAGGGAGCAGGTCAGCCTGGTGGACCCGGAGTACCTGCCCCGGAGACACGTTAAGCTGGACCCGCCCTCTGACTTGCAGAGCAAC
ATCAGTTCTGGCCACTGCATCCTGACCTGGAGCATCAGTCCTGCCTTGGAGCCAATGACCACACTTCTCAGCTATGAGCTGGCCTTCAAG
AAGCAGGAAGAGGCCTGGGAGCAGGCCCAGCACAGGGATCACATTGTCGGGGTGACCTGGCTTATACTTGAAGCCTTTGAGCTGGACCCT
GGCTTTATCCATGAGGCCAGGCTGCGTGTCCAGATGGCCACACTGGAGGATGATGTGGTAGAGGAGGAGCGTTATACAGGCCAGTGGAGT
GAGTGGAGCCAGCCTGTGTGCTTCCAGGCTCCCCAGAGACAAGGCCCTCTGATCCCACCCTGGGGGTGGCCAGGCAACACCCTTGTTGCT
GTGTCCATCTTTCTCCTGCTGACTGGCCCGACCTACCTCCTGTTCAAGCTGTCGCCCAGGGTGAAGAGAATCTTCTACCAGAACGTGCCC
TCTCCAGCGATGTTCTTCCAGCCCCTCTACAGTGTACACAATGGGAACTTCCAGACTTGGATGGGGGCCCACGGGGCCGGTGTGCTGTTG
AGCCAGGACTGTGCTGGCACCCCACAGGGAGCCTTGGAGCCCTGCGTCCAGGAGGCCACTGCACTGCTCACTTGTGGCCCAGCGCGTCCT
TGGAAATCTGTGGCCCTGGAGGAGGAACAGGAGGGCCCTGGGACCAGGCTCCCGGGGAACCTGAGCTCAGAGGATGTGCTGCCAGCAGGG
TGTACGGAGTGGAGGGTACAGACGCTTGCCTATCTGCCACAGGAGGACTGGGCCCCCACGTCCCTGACTAGGCCGGCTCCCCCAGACTCA
GAGGGCAGCAGGAGCAGCAGCAGCAGCAGCAGCAGCAACAACAACAACTACTGTGCCTTGGGCTGCTATGGGGGATGGCACCTCTCAGCC
CTCCCAGGAAACACACAGAGCTCTGGGCCCATCCCAGCCCTGGCCTGTGGCCTTTCTTGTGACCATCAGGGCCTGGAGACCCAGCAAGGA
GTTGCCTGGGTGCTGGCTGGTCACTGCCAGAGGCCTGGGCTGCATGAGGACCTCCAGGGCATGTTGCTCCCTTCTGTCCTCAGCAAGGCT

>In-frame_FUS_ENST00000568685_chr16_31193985_+_IL9R_ENST00000244174_chrY_59335577_+_1728nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACAGCTGGACCTTGGAGAGTGAGGCCCTGAGGCGAGACATGGGCACCTGGCTCCTGGCCTGCATCTGCATCTGCACCTGTGTC
TGCTTGGGAGTCTCTGTCACAGGGGAAGGACAAGGGCCAAGGTCTAGAACCTTCACCTGCCTCACCAACAACATTCTCAGGATCGATTGC
CACTGGTCTGCCCCAGAGCTGGGACAGGGCTCCAGCCCCTGGCTCCTCTTCACCAGCAACCAGGCTCCTGGCGGCACACATAAGTGCATC
TTGCGGGGCAGTGAGTGCACCGTCGTGCTGCCACCTGAGGCAGTGCTCGTGCCATCTGACAATTTCACCATCACTTTCCACCACTGCATG
TCTGGGAGGGAGCAGGTCAGCCTGGTGGACCCGGAGTACCTGCCCCGGAGACACGTTAAGCTGGACCCGCCCTCTGACTTGCAGAGCAAC
ATCAGTTCTGGCCACTGCATCCTGACCTGGAGCATCAGTCCTGCCTTGGAGCCAATGACCACACTTCTCAGCTATGAGCTGGCCTTCAAG
AAGCAGGAAGAGGCCTGGGAGCAGGCCCAGCACAGGGATCACATTGTCGGGGTGACCTGGCTTATACTTGAAGCCTTTGAGCTGGACCCT
GGCTTTATCCATGAGGCCAGGCTGCGTGTCCAGATGGCCACACTGGAGGATGATGTGGTAGAGGAGGAGCGTTATACAGGCCAGTGGAGT
GAGTGGAGCCAGCCTGTGTGCTTCCAGGCTCCCCAGAGACAAGGCCCTCTGATCCCACCCTGGGGGTGGCCAGGCAACACCCTTGTTGCT
GTGTCCATCTTTCTCCTGCTGACTGGCCCGACCTACCTCCTGTTCAAGCTGTCGCCCAGGGTGAAGAGAATCTTCTACCAGAACGTGCCC
TCTCCAGCGATGTTCTTCCAGCCCCTCTACAGTGTACACAATGGGAACTTCCAGACTTGGATGGGGGCCCACGGGGCCGGTGTGCTGTTG
AGCCAGGACTGTGCTGGCACCCCACAGGGAGCCTTGGAGCCCTGCGTCCAGGAGGCCACTGCACTGCTCACTTGTGGCCCAGCGCGTCCT
TGGAAATCTGTGGCCCTGGAGGAGGAACAGGAGGGCCCTGGGACCAGGCTCCCGGGGAACCTGAGCTCAGAGGATGTGCTGCCAGCAGGG
TGTACGGAGTGGAGGGTACAGACGCTTGCCTATCTGCCACAGGAGGACTGGGCCCCCACGTCCCTGACTAGGCCGGCTCCCCCAGACTCA
GAGGGCAGCAGGAGCAGCAGCAGCAGCAGCAGCAGCAACAACAACAACTACTGTGCCTTGGGCTGCTATGGGGGATGGCACCTCTCAGCC
CTCCCAGGAAACACACAGAGCTCTGGGCCCATCCCAGCCCTGGCCTGTGGCCTTTCTTGTGACCATCAGGGCCTGGAGACCCAGCAAGGA
GTTGCCTGGGTGCTGGCTGGTCACTGCCAGAGGCCTGGGCTGCATGAGGACCTCCAGGGCATGTTGCTCCCTTCTGTCCTCAGCAAGGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_FUS_ENST00000254108_chr16_31193985_+_IL9R_ENST00000244174_chrY_59335577_+_2032nt
ACTTAAGCTTCGACGCAGGAGGCGGGGCTGCTCAGTCCTCCAGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTG
CGCGCGTGCGCGGACATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTAT
TCCCAGCAGAGCAGTCAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTAT
TCTTCTTATGGCCAGAGCCAGAACAGCTGGACCTTGGAGAGTGAGGCCCTGAGGCGAGACATGGGCACCTGGCTCCTGGCCTGCATCTGC
ATCTGCACCTGTGTCTGCTTGGGAGTCTCTGTCACAGGGGAAGGACAAGGGCCAAGGTCTAGAACCTTCACCTGCCTCACCAACAACATT
CTCAGGATCGATTGCCACTGGTCTGCCCCAGAGCTGGGACAGGGCTCCAGCCCCTGGCTCCTCTTCACCAGCAACCAGGCTCCTGGCGGC
ACACATAAGTGCATCTTGCGGGGCAGTGAGTGCACCGTCGTGCTGCCACCTGAGGCAGTGCTCGTGCCATCTGACAATTTCACCATCACT
TTCCACCACTGCATGTCTGGGAGGGAGCAGGTCAGCCTGGTGGACCCGGAGTACCTGCCCCGGAGACACGTTAAGCTGGACCCGCCCTCT
GACTTGCAGAGCAACATCAGTTCTGGCCACTGCATCCTGACCTGGAGCATCAGTCCTGCCTTGGAGCCAATGACCACACTTCTCAGCTAT
GAGCTGGCCTTCAAGAAGCAGGAAGAGGCCTGGGAGCAGGCCCAGCACAGGGATCACATTGTCGGGGTGACCTGGCTTATACTTGAAGCC
TTTGAGCTGGACCCTGGCTTTATCCATGAGGCCAGGCTGCGTGTCCAGATGGCCACACTGGAGGATGATGTGGTAGAGGAGGAGCGTTAT
ACAGGCCAGTGGAGTGAGTGGAGCCAGCCTGTGTGCTTCCAGGCTCCCCAGAGACAAGGCCCTCTGATCCCACCCTGGGGGTGGCCAGGC
AACACCCTTGTTGCTGTGTCCATCTTTCTCCTGCTGACTGGCCCGACCTACCTCCTGTTCAAGCTGTCGCCCAGGGTGAAGAGAATCTTC
TACCAGAACGTGCCCTCTCCAGCGATGTTCTTCCAGCCCCTCTACAGTGTACACAATGGGAACTTCCAGACTTGGATGGGGGCCCACGGG
GCCGGTGTGCTGTTGAGCCAGGACTGTGCTGGCACCCCACAGGGAGCCTTGGAGCCCTGCGTCCAGGAGGCCACTGCACTGCTCACTTGT
GGCCCAGCGCGTCCTTGGAAATCTGTGGCCCTGGAGGAGGAACAGGAGGGCCCTGGGACCAGGCTCCCGGGGAACCTGAGCTCAGAGGAT
GTGCTGCCAGCAGGGTGTACGGAGTGGAGGGTACAGACGCTTGCCTATCTGCCACAGGAGGACTGGGCCCCCACGTCCCTGACTAGGCCG
GCTCCCCCAGACTCAGAGGGCAGCAGGAGCAGCAGCAGCAGCAGCAGCAGCAACAACAACAACTACTGTGCCTTGGGCTGCTATGGGGGA
TGGCACCTCTCAGCCCTCCCAGGAAACACACAGAGCTCTGGGCCCATCCCAGCCCTGGCCTGTGGCCTTTCTTGTGACCATCAGGGCCTG
GAGACCCAGCAAGGAGTTGCCTGGGTGCTGGCTGGTCACTGCCAGAGGCCTGGGCTGCATGAGGACCTCCAGGGCATGTTGCTCCCTTCT
GTCCTCAGCAAGGCTCGGTCCTGGACATTCTAGGTCCCTGACTCGCCAGATGCATCATGTCCATTTTGGGAAAATGGACTGAAGTTTCTG
GAGCCCTTGTCTGAGACTGAACCTCCTGAGAAGGGGCCCCTAGCAGCGGTCAGAGGTCCTGTCTGGATGGAGGCTGGAGGCTCCCCCCTC

>In-frame_FUS_ENST00000380244_chr16_31193985_+_IL9R_ENST00000244174_chrY_59335577_+_2003nt
GCTCAGTCCTCCAGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTGCGCGCGTGCGCGGACATGGCCTCAAACGA
TTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGTCAGCCCTACGGACA
GCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAGAGCCAGAACAGCTG
GACCTTGGAGAGTGAGGCCCTGAGGCGAGACATGGGCACCTGGCTCCTGGCCTGCATCTGCATCTGCACCTGTGTCTGCTTGGGAGTCTC
TGTCACAGGGGAAGGACAAGGGCCAAGGTCTAGAACCTTCACCTGCCTCACCAACAACATTCTCAGGATCGATTGCCACTGGTCTGCCCC
AGAGCTGGGACAGGGCTCCAGCCCCTGGCTCCTCTTCACCAGCAACCAGGCTCCTGGCGGCACACATAAGTGCATCTTGCGGGGCAGTGA
GTGCACCGTCGTGCTGCCACCTGAGGCAGTGCTCGTGCCATCTGACAATTTCACCATCACTTTCCACCACTGCATGTCTGGGAGGGAGCA
GGTCAGCCTGGTGGACCCGGAGTACCTGCCCCGGAGACACGTTAAGCTGGACCCGCCCTCTGACTTGCAGAGCAACATCAGTTCTGGCCA
CTGCATCCTGACCTGGAGCATCAGTCCTGCCTTGGAGCCAATGACCACACTTCTCAGCTATGAGCTGGCCTTCAAGAAGCAGGAAGAGGC
CTGGGAGCAGGCCCAGCACAGGGATCACATTGTCGGGGTGACCTGGCTTATACTTGAAGCCTTTGAGCTGGACCCTGGCTTTATCCATGA
GGCCAGGCTGCGTGTCCAGATGGCCACACTGGAGGATGATGTGGTAGAGGAGGAGCGTTATACAGGCCAGTGGAGTGAGTGGAGCCAGCC
TGTGTGCTTCCAGGCTCCCCAGAGACAAGGCCCTCTGATCCCACCCTGGGGGTGGCCAGGCAACACCCTTGTTGCTGTGTCCATCTTTCT
CCTGCTGACTGGCCCGACCTACCTCCTGTTCAAGCTGTCGCCCAGGGTGAAGAGAATCTTCTACCAGAACGTGCCCTCTCCAGCGATGTT
CTTCCAGCCCCTCTACAGTGTACACAATGGGAACTTCCAGACTTGGATGGGGGCCCACGGGGCCGGTGTGCTGTTGAGCCAGGACTGTGC
TGGCACCCCACAGGGAGCCTTGGAGCCCTGCGTCCAGGAGGCCACTGCACTGCTCACTTGTGGCCCAGCGCGTCCTTGGAAATCTGTGGC
CCTGGAGGAGGAACAGGAGGGCCCTGGGACCAGGCTCCCGGGGAACCTGAGCTCAGAGGATGTGCTGCCAGCAGGGTGTACGGAGTGGAG
GGTACAGACGCTTGCCTATCTGCCACAGGAGGACTGGGCCCCCACGTCCCTGACTAGGCCGGCTCCCCCAGACTCAGAGGGCAGCAGGAG
CAGCAGCAGCAGCAGCAGCAGCAACAACAACAACTACTGTGCCTTGGGCTGCTATGGGGGATGGCACCTCTCAGCCCTCCCAGGAAACAC
ACAGAGCTCTGGGCCCATCCCAGCCCTGGCCTGTGGCCTTTCTTGTGACCATCAGGGCCTGGAGACCCAGCAAGGAGTTGCCTGGGTGCT
GGCTGGTCACTGCCAGAGGCCTGGGCTGCATGAGGACCTCCAGGGCATGTTGCTCCCTTCTGTCCTCAGCAAGGCTCGGTCCTGGACATT
CTAGGTCCCTGACTCGCCAGATGCATCATGTCCATTTTGGGAAAATGGACTGAAGTTTCTGGAGCCCTTGTCTGAGACTGAACCTCCTGA
GAAGGGGCCCCTAGCAGCGGTCAGAGGTCCTGTCTGGATGGAGGCTGGAGGCTCCCCCCTCAACCCCTCTGCTCAGTGCCTGTGGGGAGC

>In-frame_FUS_ENST00000568685_chr16_31193985_+_IL9R_ENST00000244174_chrY_59335577_+_1991nt
AGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTGCGCGCGTGCGCGGACATGGCCTCAAACGATTATACCCAACA
AGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGTCAGCCCTACGGACAGCAGAGTTACAG
TGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAGAGCCAGAACAGCTGGACCTTGGAGAG
TGAGGCCCTGAGGCGAGACATGGGCACCTGGCTCCTGGCCTGCATCTGCATCTGCACCTGTGTCTGCTTGGGAGTCTCTGTCACAGGGGA
AGGACAAGGGCCAAGGTCTAGAACCTTCACCTGCCTCACCAACAACATTCTCAGGATCGATTGCCACTGGTCTGCCCCAGAGCTGGGACA
GGGCTCCAGCCCCTGGCTCCTCTTCACCAGCAACCAGGCTCCTGGCGGCACACATAAGTGCATCTTGCGGGGCAGTGAGTGCACCGTCGT
GCTGCCACCTGAGGCAGTGCTCGTGCCATCTGACAATTTCACCATCACTTTCCACCACTGCATGTCTGGGAGGGAGCAGGTCAGCCTGGT
GGACCCGGAGTACCTGCCCCGGAGACACGTTAAGCTGGACCCGCCCTCTGACTTGCAGAGCAACATCAGTTCTGGCCACTGCATCCTGAC
CTGGAGCATCAGTCCTGCCTTGGAGCCAATGACCACACTTCTCAGCTATGAGCTGGCCTTCAAGAAGCAGGAAGAGGCCTGGGAGCAGGC
CCAGCACAGGGATCACATTGTCGGGGTGACCTGGCTTATACTTGAAGCCTTTGAGCTGGACCCTGGCTTTATCCATGAGGCCAGGCTGCG
TGTCCAGATGGCCACACTGGAGGATGATGTGGTAGAGGAGGAGCGTTATACAGGCCAGTGGAGTGAGTGGAGCCAGCCTGTGTGCTTCCA
GGCTCCCCAGAGACAAGGCCCTCTGATCCCACCCTGGGGGTGGCCAGGCAACACCCTTGTTGCTGTGTCCATCTTTCTCCTGCTGACTGG
CCCGACCTACCTCCTGTTCAAGCTGTCGCCCAGGGTGAAGAGAATCTTCTACCAGAACGTGCCCTCTCCAGCGATGTTCTTCCAGCCCCT
CTACAGTGTACACAATGGGAACTTCCAGACTTGGATGGGGGCCCACGGGGCCGGTGTGCTGTTGAGCCAGGACTGTGCTGGCACCCCACA
GGGAGCCTTGGAGCCCTGCGTCCAGGAGGCCACTGCACTGCTCACTTGTGGCCCAGCGCGTCCTTGGAAATCTGTGGCCCTGGAGGAGGA
ACAGGAGGGCCCTGGGACCAGGCTCCCGGGGAACCTGAGCTCAGAGGATGTGCTGCCAGCAGGGTGTACGGAGTGGAGGGTACAGACGCT
TGCCTATCTGCCACAGGAGGACTGGGCCCCCACGTCCCTGACTAGGCCGGCTCCCCCAGACTCAGAGGGCAGCAGGAGCAGCAGCAGCAG
CAGCAGCAGCAACAACAACAACTACTGTGCCTTGGGCTGCTATGGGGGATGGCACCTCTCAGCCCTCCCAGGAAACACACAGAGCTCTGG
GCCCATCCCAGCCCTGGCCTGTGGCCTTTCTTGTGACCATCAGGGCCTGGAGACCCAGCAAGGAGTTGCCTGGGTGCTGGCTGGTCACTG
CCAGAGGCCTGGGCTGCATGAGGACCTCCAGGGCATGTTGCTCCCTTCTGTCCTCAGCAAGGCTCGGTCCTGGACATTCTAGGTCCCTGA
CTCGCCAGATGCATCATGTCCATTTTGGGAAAATGGACTGAAGTTTCTGGAGCCCTTGTCTGAGACTGAACCTCCTGAGAAGGGGCCCCT
AGCAGCGGTCAGAGGTCCTGTCTGGATGGAGGCTGGAGGCTCCCCCCTCAACCCCTCTGCTCAGTGCCTGTGGGGAGCAGCCTCTACCCT


Top

FusionGenePPI for FUS_IL9R


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FUSEIF6, USF2, PRMT1, PTBP2, SRRM1, SPI1, YBX1, ILF3, SF1, SRSF10, THRA, RXRA, RELA, OTUB1, ZMYM2, SARNP, TARDBP, DGCR8, PCM1, SF3A2, SIRT7, SQSTM1, TDRD3, CUL3, CUL4A, CUL4B, CUL5, CUL2, CDK2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, ARHGEF28, PA2G4, UBE2I, ATXN1L, GRB2, PIK3R2, HNRNPA3, NONO, EEF1A1, DYNC1H1, GSE1, MBD3, MRPS18B, SAP30BP, RPLP1, ESR1, FN1, VCAM1, TP63, IL7R, UBL4A, ITGA4, CTNNB1, UPF1, LMNA, EWSR1, RBMX, PSMB7, ESRRA, MDH1, TAF15, SRSF9, SAFB2, TNIP1, KHDRBS3, NKD2, MAX, PARK2, SUV39H1, WBP4, HNRNPU, LARS, RPA3, RPA2, RPA1, WWOX, HSPA5, VCP, SFPQ, YWHAZ, YWHAQ, PFN1, FASN, PGK1, CKB, ENO1, LDHB, PAICS, PHGDH, LDHA, GAPDH, PKM, ATXN2L, MTHFD1, ACACA, CA2, ALDOA, GPI, PYCRL, PFKL, PGM1, ABCA1, HPRT1, PM20D2, TKT, UBA1, PSMD12, CDH4, ANXA2P2, GNAS, PLCE1, TRPM4, SLC1A5, UBAP2, UBAP2L, LYZ, CKAP4, YPEL1, HIST4H4, H3F3A, H3F3B, HIST2H2BE, DDX42, HNRNPD, SYNCRIP, DHX40, SF3A1, SF3B3, SF3B4, SERBP1, FANCM, RAD54B, PCNA, PHB, TP73, RPL18, RPL9, RPS9, TBPL1, TRIP4, DNAJC10, SAE1, DLD, GOT2, ATP5A1, GSTP1, HARS2, SLC25A3, KPNA2, RAB7A, SPATA6, UACA, STATH, ANXA5, MAP3K3, UBC, TUBB, CFL1, TUBA1A, ACTB, HNRNPF, HNRNPH1, DHX15, CPSF6, SF3A3, HNRNPK, PSPC1, HNRNPL, RPS5, RPS8, RPL12, RPN2, EEF2, EEF1G, HSP90AA1, CCT5, CCT6A, HSP90AB1, CCT2, CCT4, HSP90B1, CCT3, CCT7, CCT8, HSPA8, PPIL4, TCP1, PDIA3, PPIA, SSBP1, GLUD1, ATP5B, HSPA9, ERAL1, TUFM, HSPD1, PYCR1, MDH2, ABCF2, KPNB1, PRDX1, ERP44, F7, ALB, ARMC6, ADCK5, CCDC88A, GPR101, ITK, DGKA, SLC22A11, HERC6, TUBA1B, MTSS1L, CEP112, COL18A1, SEC13, NAP1L1, SNRPD2, NCAPG2, RBBP4, FLJ22447, LSM12, NUDT21, DDX1, C14orf166, DDX5, HIVEP3, NCOA6, RAVER1, TCEB1, TXNL4B, TTI2, GEN1, RPL14, RPS14, NPM1, RPL11, RPL4, EIF4A1, PCBP2, ST13, NSDHL, MTAP, MAT2A, AHCY, OAT, BCS1L, SLC25A5, TIMM50, MYH10, GOLIM4, CSE1L, RAN, KLHL40, KLHL5, IGKV1-5, C6, GIMAP8, CDC5L, CEP78, DBF4B, AMOT, FAM71F1, MFGE8, FAM98A, C11orf70, RTCB, UFL1, LRRIQ4, NUPR1, CUL7, OBSL1, EZH2, SUZ12, BMI1, ABL1, CHEK1, SIK2, SRPK1, LUZP4, UPF2, UPF3A, FAM58A, YEATS4, RPS6KB2, HNRNPA1, FBXW11, ACAT1, ARMC1, C2orf49, DDX17, DNAJC7, EIF4H, AURKA, PTBP1, TOMM34, TXLNA, UFD1L, HNRNPDL, MEF2D, NAA50, NPLOC4, PFKP, PICALM, TARS, NTRK1, SCARNA22, TCF7L2, KIF22, EMC2, MATR3, MCM2, SNW1, RC3H1, EGFR, TRAF6, CRBN, KCTD6, RPS27, PSRC1, SMCO3, CYLD, TRIM25, BRCA1, HDAC6IL9RYWHAZ, JAK1, KAT5, CRADD, LSR, CCPG1, SARAF, RETSAT, DHRS7, DGCR2, TTC17, NETO2, TMEM39A, ABCB10, POMT1, EDA, PDE3B, TM2D3, ZDHHC18, TMEM205, UBE4A, TMX4


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FUS_IL9R


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FUS_IL9R


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneFUSC1842675AMYOTROPHIC LATERAL SCLEROSIS 6 (disorder)6UNIPROT
HgeneFUSC0206634Liposarcoma, Myxoid2CTD_human;ORPHANET
HgeneFUSC3539195TREMOR, HEREDITARY ESSENTIAL, 41UNIPROT
TgeneIL9RC0023895Liver diseases1CTD_human
TgeneIL9RC0525045Mood Disorders1PSYGENET