FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14079

FusionGeneSummary for FUS_ERG

check button Fusion gene summary
Fusion gene informationFusion gene name: FUS_ERG
Fusion gene ID: 14079
HgeneTgene
Gene symbol

FUS

ERG

Gene ID

2521

2078

Gene nameFUS RNA binding proteinERG, ETS transcription factor
SynonymsALS6|ETM4|FUS1|HNRNPP2|POMP75|TLSerg-3|p55
Cytomap

16p11.2

21q22.2

Type of geneprotein-codingprotein-coding
DescriptionRNA-binding protein FUS75 kDa DNA-pairing proteinFUS/ERG chimeric proteinFUS/ERG fusion proteinfus-like proteinfused in sarcomafusion gene in myxoid liposarcomaheterogeneous nuclear ribonucleoprotein P2oncogene FUSoncogene TLStranslocated in liptranscriptional regulator ERGFUS/ERG fusion proteinTMPRSS2/ERG fusionerythroblast transformation-specific transcription factor ERG variant 10ets-relatedtranscriptional regulator ERG (transforming protein ERG)v-ets avian erythroblastosis virus E26 on
Modification date2018052720180523
UniProtAcc

P35637

P11308

Ensembl transtripts involved in fusion geneENST00000254108, ENST00000380244, 
ENST00000568685, ENST00000474990, 
ENST00000398907, ENST00000398905, 
ENST00000288319, ENST00000398897, 
ENST00000398911, ENST00000398910, 
ENST00000417133, ENST00000442448, 
ENST00000453032, ENST00000398919, 
ENST00000429727, ENST00000485493, 
Fusion gene scores* DoF score21 X 23 X 7=338113 X 15 X 8=1560
# samples 27226
** MAII scorelog2(27/3381*10)=-3.64641870384255
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(226/1560*10)=0.53477674355294
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: FUS [Title/Abstract] AND ERG [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneERG

GO:0045944

positive regulation of transcription by RNA polymerase II

18195090|23913826


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1S77574FUSchr16

31198158

+ERGchr21

39755846

-
ChiTaRS3.1Y10001FUSchr16

31198569

+ERGchr21

39758163

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000254108ENST00000398907FUSchr16

31198158

+ERGchr21

39755846

-
Frame-shitENST00000254108ENST00000398905FUSchr16

31198158

+ERGchr21

39755846

-
Frame-shitENST00000254108ENST00000288319FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000254108ENST00000398897FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000254108ENST00000398911FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000254108ENST00000398910FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000254108ENST00000417133FUSchr16

31198158

+ERGchr21

39755846

-
Frame-shitENST00000254108ENST00000442448FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000254108ENST00000453032FUSchr16

31198158

+ERGchr21

39755846

-
Frame-shitENST00000254108ENST00000398919FUSchr16

31198158

+ERGchr21

39755846

-
5CDS-intronENST00000254108ENST00000429727FUSchr16

31198158

+ERGchr21

39755846

-
5CDS-intronENST00000254108ENST00000485493FUSchr16

31198158

+ERGchr21

39755846

-
Frame-shitENST00000380244ENST00000398907FUSchr16

31198158

+ERGchr21

39755846

-
Frame-shitENST00000380244ENST00000398905FUSchr16

31198158

+ERGchr21

39755846

-
Frame-shitENST00000380244ENST00000288319FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000380244ENST00000398897FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000380244ENST00000398911FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000380244ENST00000398910FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000380244ENST00000417133FUSchr16

31198158

+ERGchr21

39755846

-
Frame-shitENST00000380244ENST00000442448FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000380244ENST00000453032FUSchr16

31198158

+ERGchr21

39755846

-
Frame-shitENST00000380244ENST00000398919FUSchr16

31198158

+ERGchr21

39755846

-
5CDS-intronENST00000380244ENST00000429727FUSchr16

31198158

+ERGchr21

39755846

-
5CDS-intronENST00000380244ENST00000485493FUSchr16

31198158

+ERGchr21

39755846

-
Frame-shitENST00000568685ENST00000398907FUSchr16

31198158

+ERGchr21

39755846

-
Frame-shitENST00000568685ENST00000398905FUSchr16

31198158

+ERGchr21

39755846

-
Frame-shitENST00000568685ENST00000288319FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000568685ENST00000398897FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000568685ENST00000398911FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000568685ENST00000398910FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000568685ENST00000417133FUSchr16

31198158

+ERGchr21

39755846

-
Frame-shitENST00000568685ENST00000442448FUSchr16

31198158

+ERGchr21

39755846

-
In-frameENST00000568685ENST00000453032FUSchr16

31198158

+ERGchr21

39755846

-
Frame-shitENST00000568685ENST00000398919FUSchr16

31198158

+ERGchr21

39755846

-
5CDS-intronENST00000568685ENST00000429727FUSchr16

31198158

+ERGchr21

39755846

-
5CDS-intronENST00000568685ENST00000485493FUSchr16

31198158

+ERGchr21

39755846

-
3UTR-3CDSENST00000474990ENST00000398907FUSchr16

31198158

+ERGchr21

39755846

-
3UTR-3CDSENST00000474990ENST00000398905FUSchr16

31198158

+ERGchr21

39755846

-
3UTR-3CDSENST00000474990ENST00000288319FUSchr16

31198158

+ERGchr21

39755846

-
3UTR-3CDSENST00000474990ENST00000398897FUSchr16

31198158

+ERGchr21

39755846

-
3UTR-3CDSENST00000474990ENST00000398911FUSchr16

31198158

+ERGchr21

39755846

-
3UTR-3CDSENST00000474990ENST00000398910FUSchr16

31198158

+ERGchr21

39755846

-
3UTR-3CDSENST00000474990ENST00000417133FUSchr16

31198158

+ERGchr21

39755846

-
3UTR-3CDSENST00000474990ENST00000442448FUSchr16

31198158

+ERGchr21

39755846

-
3UTR-3CDSENST00000474990ENST00000453032FUSchr16

31198158

+ERGchr21

39755846

-
3UTR-3CDSENST00000474990ENST00000398919FUSchr16

31198158

+ERGchr21

39755846

-
3UTR-intronENST00000474990ENST00000429727FUSchr16

31198158

+ERGchr21

39755846

-
3UTR-intronENST00000474990ENST00000485493FUSchr16

31198158

+ERGchr21

39755846

-
intron-intronENST00000254108ENST00000398907FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000254108ENST00000398905FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000254108ENST00000288319FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000254108ENST00000398897FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000254108ENST00000398911FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000254108ENST00000398910FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000254108ENST00000417133FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000254108ENST00000442448FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000254108ENST00000453032FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000254108ENST00000398919FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000254108ENST00000429727FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000254108ENST00000485493FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000380244ENST00000398907FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000380244ENST00000398905FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000380244ENST00000288319FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000380244ENST00000398897FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000380244ENST00000398911FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000380244ENST00000398910FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000380244ENST00000417133FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000380244ENST00000442448FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000380244ENST00000453032FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000380244ENST00000398919FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000380244ENST00000429727FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000380244ENST00000485493FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000568685ENST00000398907FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000568685ENST00000398905FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000568685ENST00000288319FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000568685ENST00000398897FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000568685ENST00000398911FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000568685ENST00000398910FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000568685ENST00000417133FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000568685ENST00000442448FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000568685ENST00000453032FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000568685ENST00000398919FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000568685ENST00000429727FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000568685ENST00000485493FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000474990ENST00000398907FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000474990ENST00000398905FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000474990ENST00000288319FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000474990ENST00000398897FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000474990ENST00000398911FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000474990ENST00000398910FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000474990ENST00000417133FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000474990ENST00000442448FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000474990ENST00000453032FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000474990ENST00000398919FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000474990ENST00000429727FUSchr16

31198569

+ERGchr21

39758163

-
intron-intronENST00000474990ENST00000485493FUSchr16

31198569

+ERGchr21

39758163

-

Top

FusionProtFeatures for FUS_ERG


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FUS

P35637

ERG

P11308

Binds both single-stranded and double-stranded DNA andpromotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-strandedDNA. May play a role in maintenance of genomic integrity. Transcriptional regulator. May participate intranscriptional regulation through the recruitment of SETDB1histone methyltransferase and subsequent modification of localchromatin structure.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for FUS_ERG


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000398897_chr21_39755846_-_440aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNTGTGTQSTPQGTGSTGGTGSSQSSQSS
YGQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQD
QSSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQ
IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQ

>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000398911_chr21_39755846_-_440aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNTGTGTQSTPQGTGSTGGTGSSQSSQSS
YGQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQD
QSSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQ
IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQ

>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000398910_chr21_39755846_-_440aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNTGTGTQSTPQGTGSTGGTGSSQSSQSS
YGQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQD
QSSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQ
IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQ

>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000417133_chr21_39755846_-_440aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNTGTGTQSTPQGTGSTGGTGSSQSSQSS
YGQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQD
QSSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQ
IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQ

>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000453032_chr21_39755846_-_440aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNTGTGTQSTPQGTGSTGGTGSSQSSQSS
YGQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQD
QSSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQ
IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQ

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000398897_chr21_39755846_-_439aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNSTGTQSTPQGTGSTGGTGSSQSSQSSY
GQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQDQ
SSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQI
QLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQP

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000398911_chr21_39755846_-_439aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNSTGTQSTPQGTGSTGGTGSSQSSQSSY
GQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQDQ
SSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQI
QLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQP

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000398910_chr21_39755846_-_439aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNSTGTQSTPQGTGSTGGTGSSQSSQSSY
GQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQDQ
SSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQI
QLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQP

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000417133_chr21_39755846_-_439aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNSTGTQSTPQGTGSTGGTGSSQSSQSSY
GQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQDQ
SSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQI
QLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQP

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000453032_chr21_39755846_-_439aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNSTGTQSTPQGTGSTGGTGSSQSSQSSY
GQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQDQ
SSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQI
QLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQP

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000398897_chr21_39755846_-_440aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNTGTGTQSTPQGTGSTGGTGSSQSSQSS
YGQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQD
QSSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQ
IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQ

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000398911_chr21_39755846_-_440aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNTGTGTQSTPQGTGSTGGTGSSQSSQSS
YGQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQD
QSSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQ
IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQ

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000398910_chr21_39755846_-_440aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNTGTGTQSTPQGTGSTGGTGSSQSSQSS
YGQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQD
QSSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQ
IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQ

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000417133_chr21_39755846_-_440aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNTGTGTQSTPQGTGSTGGTGSSQSSQSS
YGQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQD
QSSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQ
IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQ

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000453032_chr21_39755846_-_440aa
MASNDTTQQATQSTGAYPTQPGQGTSQQSSQPYGQQSYSGTSQSTDTSGTGQSSTSSTGQSQNTGTGTQSTPQGTGSTGGTGSSQSSQSS
YGQQSSYPGTGQQPAPSSTSGSYGSSSQSSSTGQPQSGSYSQQPSTGGQQQSTGQQQSTNPPQGTGQQNQYNSSSGGGGGGGGGGNTGQD
QSSMSSGGGSGGGTGNQDQSGGGGSGGTGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGTEPRGRGGGRGGRGGMGGSDRGGFNKFGGSGQ
IQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYTDKNIMTKVHGKRYAYKFDFHGIAQALQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000398897_chr21_39755846_-_1320nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCT
TACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGC
AGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAAT
CCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGAT
CAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAG
CAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAA
CCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAG
ATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAG
ATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGT
TACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAG
CCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTT
GTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATA

>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000398911_chr21_39755846_-_1320nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCT
TACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGC
AGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAAT
CCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGAT
CAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAG
CAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAA
CCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAG
ATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAG
ATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGT
TACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAG
CCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTT
GTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATA

>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000398910_chr21_39755846_-_1320nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCT
TACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGC
AGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAAT
CCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGAT
CAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAG
CAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAA
CCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAG
ATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAG
ATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGT
TACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAG
CCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTT
GTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATA

>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000417133_chr21_39755846_-_1320nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCT
TACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGC
AGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAAT
CCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGAT
CAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAG
CAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAA
CCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAG
ATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAG
ATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGT
TACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAG
CCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTT
GTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATA

>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000453032_chr21_39755846_-_1320nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCT
TACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGC
AGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAAT
CCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGAT
CAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAG
CAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAA
CCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAG
ATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAG
ATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGT
TACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAG
CCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTT
GTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATA

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000398897_chr21_39755846_-_1317nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACAGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTAC
GGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGC
TATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCC
CCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAA
TCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAG
GACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCC
AGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATC
CAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATG
ACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTAC
TACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCC
CACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTG
GCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATAC

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000398911_chr21_39755846_-_1317nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACAGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTAC
GGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGC
TATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCC
CCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAA
TCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAG
GACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCC
AGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATC
CAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATG
ACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTAC
TACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCC
CACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTG
GCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATAC

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000398910_chr21_39755846_-_1317nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACAGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTAC
GGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGC
TATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCC
CCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAA
TCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAG
GACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCC
AGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATC
CAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATG
ACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTAC
TACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCC
CACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTG
GCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATAC

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000417133_chr21_39755846_-_1317nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACAGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTAC
GGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGC
TATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCC
CCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAA
TCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAG
GACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCC
AGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATC
CAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATG
ACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTAC
TACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCC
CACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTG
GCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATAC

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000453032_chr21_39755846_-_1317nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACAGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTAC
GGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGC
TATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCC
CCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAA
TCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAG
GACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCC
AGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATC
CAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATG
ACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTAC
TACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCC
CACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTG
GCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATAC

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000398897_chr21_39755846_-_1320nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCT
TACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGC
AGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAAT
CCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGAT
CAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAG
CAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAA
CCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAG
ATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAG
ATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGT
TACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAG
CCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTT
GTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATA

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000398911_chr21_39755846_-_1320nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCT
TACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGC
AGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAAT
CCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGAT
CAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAG
CAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAA
CCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAG
ATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAG
ATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGT
TACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAG
CCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTT
GTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATA

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000398910_chr21_39755846_-_1320nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCT
TACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGC
AGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAAT
CCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGAT
CAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAG
CAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAA
CCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAG
ATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAG
ATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGT
TACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAG
CCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTT
GTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATA

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000417133_chr21_39755846_-_1320nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCT
TACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGC
AGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAAT
CCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGAT
CAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAG
CAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAA
CCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAG
ATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAG
ATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGT
TACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAG
CCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTT
GTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATA

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000453032_chr21_39755846_-_1320nt
ATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGT
CAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAG
AGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCT
TACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGC
AGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAAT
CCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGAT
CAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAG
CAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAA
CCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAG
ATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAG
ATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGT
TACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAG
CCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTT
GTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATA


* Fusion transcript sequences (Full-length transcript).
>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000398897_chr21_39755846_-_4801nt
ACTTAAGCTTCGACGCAGGAGGCGGGGCTGCTCAGTCCTCCAGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTG
CGCGCGTGCGCGGACATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTAT
TCCCAGCAGAGCAGTCAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTAT
TCTTCTTATGGCCAGAGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAG
AGCTCCCAATCGTCTTACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGC
AGTTCTCAGAGCAGCAGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAG
CAGCAAAGCTATAATCCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGT
AACTATGGCCAAGATCAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGC
GGTGGCTATGGACAGCAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGC
AGTGGTGGCTATGAACCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTT
GGTGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACC
AACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTC
AGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATC
GCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCA
CAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCA
CCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGC
TTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGC
TTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGAT
GCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAG
TGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATA
GAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACA
AGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACA
TTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAAC
TAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGA
GACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGG
GTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAA
AAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTAT
GTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGC
CTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTA
TATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAAT
TTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATG
GCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTT
TGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAG
GTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATG
CCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTA
TGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCT
GCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTA
GTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGT
TTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAA
AAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTT
CAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCT
TTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAG
CCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGT
GCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAA
TCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCA
TTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAG
TTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTC
ATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACT
CCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACT
GTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCT
TCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATG
GCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAG
AGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAA

>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000398911_chr21_39755846_-_4801nt
ACTTAAGCTTCGACGCAGGAGGCGGGGCTGCTCAGTCCTCCAGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTG
CGCGCGTGCGCGGACATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTAT
TCCCAGCAGAGCAGTCAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTAT
TCTTCTTATGGCCAGAGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAG
AGCTCCCAATCGTCTTACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGC
AGTTCTCAGAGCAGCAGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAG
CAGCAAAGCTATAATCCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGT
AACTATGGCCAAGATCAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGC
GGTGGCTATGGACAGCAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGC
AGTGGTGGCTATGAACCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTT
GGTGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACC
AACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTC
AGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATC
GCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCA
CAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCA
CCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGC
TTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGC
TTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGAT
GCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAG
TGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATA
GAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACA
AGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACA
TTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAAC
TAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGA
GACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGG
GTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAA
AAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTAT
GTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGC
CTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTA
TATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAAT
TTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATG
GCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTT
TGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAG
GTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATG
CCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTA
TGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCT
GCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTA
GTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGT
TTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAA
AAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTT
CAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCT
TTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAG
CCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGT
GCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAA
TCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCA
TTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAG
TTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTC
ATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACT
CCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACT
GTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCT
TCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATG
GCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAG
AGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAA

>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000398910_chr21_39755846_-_4801nt
ACTTAAGCTTCGACGCAGGAGGCGGGGCTGCTCAGTCCTCCAGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTG
CGCGCGTGCGCGGACATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTAT
TCCCAGCAGAGCAGTCAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTAT
TCTTCTTATGGCCAGAGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAG
AGCTCCCAATCGTCTTACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGC
AGTTCTCAGAGCAGCAGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAG
CAGCAAAGCTATAATCCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGT
AACTATGGCCAAGATCAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGC
GGTGGCTATGGACAGCAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGC
AGTGGTGGCTATGAACCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTT
GGTGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACC
AACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTC
AGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATC
GCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCA
CAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCA
CCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGC
TTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGC
TTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGAT
GCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAG
TGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATA
GAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACA
AGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACA
TTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAAC
TAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGA
GACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGG
GTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAA
AAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTAT
GTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGC
CTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTA
TATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAAT
TTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATG
GCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTT
TGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAG
GTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATG
CCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTA
TGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCT
GCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTA
GTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGT
TTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAA
AAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTT
CAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCT
TTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAG
CCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGT
GCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAA
TCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCA
TTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAG
TTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTC
ATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACT
CCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACT
GTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCT
TCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATG
GCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAG
AGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAA

>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000417133_chr21_39755846_-_4801nt
ACTTAAGCTTCGACGCAGGAGGCGGGGCTGCTCAGTCCTCCAGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTG
CGCGCGTGCGCGGACATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTAT
TCCCAGCAGAGCAGTCAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTAT
TCTTCTTATGGCCAGAGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAG
AGCTCCCAATCGTCTTACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGC
AGTTCTCAGAGCAGCAGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAG
CAGCAAAGCTATAATCCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGT
AACTATGGCCAAGATCAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGC
GGTGGCTATGGACAGCAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGC
AGTGGTGGCTATGAACCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTT
GGTGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACC
AACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTC
AGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATC
GCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCA
CAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCA
CCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGC
TTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGC
TTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGAT
GCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAG
TGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATA
GAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACA
AGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACA
TTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAAC
TAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGA
GACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGG
GTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAA
AAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTAT
GTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGC
CTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTA
TATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAAT
TTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATG
GCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTT
TGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAG
GTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATG
CCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTA
TGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCT
GCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTA
GTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGT
TTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAA
AAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTT
CAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCT
TTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAG
CCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGT
GCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAA
TCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCA
TTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAG
TTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTC
ATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACT
CCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACT
GTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCT
TCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATG
GCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAG
AGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCTCATTAATTCATTCAAATAAAGTCGTGAGGTGACTAATTAGAGAATAAAA

>In-frame_FUS_ENST00000254108_chr16_31198158_+_ERG_ENST00000453032_chr21_39755846_-_1702nt
ACTTAAGCTTCGACGCAGGAGGCGGGGCTGCTCAGTCCTCCAGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTG
CGCGCGTGCGCGGACATGGCCTCAAACGATTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTAT
TCCCAGCAGAGCAGTCAGCCCTACGGACAGCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTAT
TCTTCTTATGGCCAGAGCCAGAACACAGGCTATGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAG
AGCTCCCAATCGTCTTACGGGCAGCAGTCCTCCTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGC
AGTTCTCAGAGCAGCAGCTATGGGCAGCCCCAGAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAG
CAGCAAAGCTATAATCCCCCTCAGGGCTATGGACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGT
AACTATGGCCAAGATCAATCCTCCATGAGTAGTGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGC
GGTGGCTATGGACAGCAGGACCGTGGAGGCCGCGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGC
AGTGGTGGCTATGAACCCAGAGGTCGTGGAGGTGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTT
GGTGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACC
AACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTC
AGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATC
GCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCA
CAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCA
CCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGC
TTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGC
TTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGAT

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000398897_chr21_39755846_-_4769nt
GCTCAGTCCTCCAGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTGCGCGCGTGCGCGGACATGGCCTCAAACGA
TTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGTCAGCCCTACGGACA
GCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAGAGCCAGAACAGCTA
TGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTACGGGCAGCAGTCCTC
CTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGCTATGGGCAGCCCCA
GAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCCCCTCAGGGCTATGG
ACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAATCCTCCATGAGTAG
TGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAGGACCGTGGAGGCCG
CGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCCAGAGGTCGTGGAGG
TGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATCCAGCTTTGGCAGTT
CCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGA
GGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAA
CATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTC
ATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCC
AGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCT
CCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATC
GCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAG
AGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATC
TGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAA
ACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTT
TATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCAT
CAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCA
AACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTG
AGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAA
TGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGT
GTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATG
AAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAA
GAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTG
CGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGA
TCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATG
AAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTG
CACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGT
GCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTT
CTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGG
TTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAA
GCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAA
CGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGT
GGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGG
GCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGC
GCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTT
TGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTC
CTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCC
TTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTG
GAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATG
AGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAG
GTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTC
AAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTG
TTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTG
TCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGT
CCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCT
GCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGG
CACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTAT

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000398911_chr21_39755846_-_4769nt
GCTCAGTCCTCCAGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTGCGCGCGTGCGCGGACATGGCCTCAAACGA
TTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGTCAGCCCTACGGACA
GCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAGAGCCAGAACAGCTA
TGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTACGGGCAGCAGTCCTC
CTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGCTATGGGCAGCCCCA
GAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCCCCTCAGGGCTATGG
ACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAATCCTCCATGAGTAG
TGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAGGACCGTGGAGGCCG
CGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCCAGAGGTCGTGGAGG
TGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATCCAGCTTTGGCAGTT
CCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGA
GGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAA
CATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTC
ATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCC
AGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCT
CCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATC
GCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAG
AGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATC
TGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAA
ACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTT
TATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCAT
CAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCA
AACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTG
AGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAA
TGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGT
GTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATG
AAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAA
GAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTG
CGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGA
TCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATG
AAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTG
CACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGT
GCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTT
CTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGG
TTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAA
GCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAA
CGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGT
GGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGG
GCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGC
GCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTT
TGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTC
CTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCC
TTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTG
GAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATG
AGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAG
GTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTC
AAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTG
TTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTG
TCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGT
CCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCT
GCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGG
CACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTAT

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000398910_chr21_39755846_-_4769nt
GCTCAGTCCTCCAGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTGCGCGCGTGCGCGGACATGGCCTCAAACGA
TTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGTCAGCCCTACGGACA
GCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAGAGCCAGAACAGCTA
TGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTACGGGCAGCAGTCCTC
CTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGCTATGGGCAGCCCCA
GAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCCCCTCAGGGCTATGG
ACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAATCCTCCATGAGTAG
TGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAGGACCGTGGAGGCCG
CGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCCAGAGGTCGTGGAGG
TGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATCCAGCTTTGGCAGTT
CCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGA
GGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAA
CATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTC
ATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCC
AGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCT
CCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATC
GCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAG
AGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATC
TGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAA
ACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTT
TATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCAT
CAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCA
AACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTG
AGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAA
TGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGT
GTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATG
AAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAA
GAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTG
CGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGA
TCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATG
AAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTG
CACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGT
GCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTT
CTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGG
TTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAA
GCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAA
CGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGT
GGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGG
GCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGC
GCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTT
TGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTC
CTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCC
TTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTG
GAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATG
AGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAG
GTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTC
AAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTG
TTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTG
TCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGT
CCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCT
GCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGG
CACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTAT

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000417133_chr21_39755846_-_4769nt
GCTCAGTCCTCCAGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTGCGCGCGTGCGCGGACATGGCCTCAAACGA
TTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGTCAGCCCTACGGACA
GCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAGAGCCAGAACAGCTA
TGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTACGGGCAGCAGTCCTC
CTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGCTATGGGCAGCCCCA
GAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCCCCTCAGGGCTATGG
ACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAATCCTCCATGAGTAG
TGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAGGACCGTGGAGGCCG
CGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCCAGAGGTCGTGGAGG
TGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATCCAGCTTTGGCAGTT
CCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGA
GGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAA
CATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTC
ATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCC
AGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCT
CCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATC
GCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAG
AGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATC
TGTGGACTGACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAA
ACTTTAGAGTAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTT
TATAATGCCATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCAT
CAACAGACGTTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCA
AACTGTGAAGATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTG
AGCGTGTGATTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAA
TGAAGACTGGACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGT
GTTAGGAGAAAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATG
AAAATTTTAACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAA
GAGATGGCCTTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTG
CGTTTGTCAGAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGA
TCTCGGCCAGCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATG
AAGTTATTAGTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTG
CACTTTTTTTAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGT
GCAAGGGAGAGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTT
CTAGCCCCTTTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGG
TTGTCATTGAGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAA
GCTACCACTCGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAA
CGTCTAGATTTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGT
GGCTTGGGATTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGG
GCATCTTTTCTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGC
GCTAGCCGAAACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTT
TGCTATGATTATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTC
CTGACACCCCGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCC
TTAGGGAAAATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTG
GAATGCAAAGTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATG
AGCAAGATCATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAG
GTTATTAGCAAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTC
AAAATGGCATTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTG
TTTGTCCCTGTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTG
TCTTCAATTGGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGT
CCCGGAGGGGTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCT
GCAACCCAGGAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGG
CACAGGGAAAGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTAT

>In-frame_FUS_ENST00000380244_chr16_31198158_+_ERG_ENST00000453032_chr21_39755846_-_1670nt
GCTCAGTCCTCCAGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTGCGCGCGTGCGCGGACATGGCCTCAAACGA
TTATACCCAACAAGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGTCAGCCCTACGGACA
GCAGAGTTACAGTGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAGAGCCAGAACAGCTA
TGGAACTCAGTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTACGGGCAGCAGTCCTC
CTACCCTGGCTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGCTATGGGCAGCCCCA
GAGTGGGAGCTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCCCCTCAGGGCTATGG
ACAGCAGAACCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAATCCTCCATGAGTAG
TGGTGGTGGCAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAGGACCGTGGAGGCCG
CGGCAGGGGTGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCCAGAGGTCGTGGAGG
TGGCCGTGGAGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATCCAGCTTTGGCAGTT
CCTCCTGGAGCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGA
GGTGGCCCGGCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAA
CATCATGACCAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTC
ATCTCTGTACAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCC
AGCCCTCCCCGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCT
CCCCACCAGCCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATC
GCCACAAACTCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAG
AGATCCAAAGACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATC

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000398897_chr21_39755846_-_4760nt
AGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTGCGCGCGTGCGCGGACATGGCCTCAAACGATTATACCCAACA
AGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGTCAGCCCTACGGACAGCAGAGTTACAG
TGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAGAGCCAGAACACAGGCTATGGAACTCA
GTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTACGGGCAGCAGTCCTCCTACCCTGG
CTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGCTATGGGCAGCCCCAGAGTGGGAG
CTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCCCCTCAGGGCTATGGACAGCAGAA
CCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAATCCTCCATGAGTAGTGGTGGTGG
CAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAGGACCGTGGAGGCCGCGGCAGGGG
TGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCCAGAGGTCGTGGAGGTGGCCGTGG
AGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGA
GCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCG
GCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGAC
CAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTA
CAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCC
CGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAG
CCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAAC
TCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAA
GACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTG
ACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAG
TAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCC
ATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACG
TTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAA
GATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGA
TTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTG
GACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGA
AAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTA
ACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCC
TTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCA
GAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCA
GCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTA
GTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTT
TAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAG
AGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCT
TTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTG
AGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACT
CGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGAT
TTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGA
TTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTT
CTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGA
AACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGAT
TATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCC
CGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAA
ATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAA
GTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATC
ATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGC
AAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCA
TTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCT
GTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATT
GGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGG
GTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAG
GAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAA
AGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCT

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000398911_chr21_39755846_-_4760nt
AGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTGCGCGCGTGCGCGGACATGGCCTCAAACGATTATACCCAACA
AGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGTCAGCCCTACGGACAGCAGAGTTACAG
TGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAGAGCCAGAACACAGGCTATGGAACTCA
GTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTACGGGCAGCAGTCCTCCTACCCTGG
CTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGCTATGGGCAGCCCCAGAGTGGGAG
CTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCCCCTCAGGGCTATGGACAGCAGAA
CCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAATCCTCCATGAGTAGTGGTGGTGG
CAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAGGACCGTGGAGGCCGCGGCAGGGG
TGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCCAGAGGTCGTGGAGGTGGCCGTGG
AGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGA
GCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCG
GCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGAC
CAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTA
CAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCC
CGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAG
CCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAAC
TCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAA
GACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTG
ACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAG
TAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCC
ATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACG
TTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAA
GATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGA
TTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTG
GACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGA
AAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTA
ACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCC
TTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCA
GAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCA
GCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTA
GTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTT
TAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAG
AGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCT
TTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTG
AGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACT
CGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGAT
TTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGA
TTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTT
CTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGA
AACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGAT
TATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCC
CGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAA
ATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAA
GTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATC
ATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGC
AAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCA
TTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCT
GTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATT
GGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGG
GTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAG
GAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAA
AGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCT

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000398910_chr21_39755846_-_4760nt
AGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTGCGCGCGTGCGCGGACATGGCCTCAAACGATTATACCCAACA
AGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGTCAGCCCTACGGACAGCAGAGTTACAG
TGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAGAGCCAGAACACAGGCTATGGAACTCA
GTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTACGGGCAGCAGTCCTCCTACCCTGG
CTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGCTATGGGCAGCCCCAGAGTGGGAG
CTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCCCCTCAGGGCTATGGACAGCAGAA
CCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAATCCTCCATGAGTAGTGGTGGTGG
CAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAGGACCGTGGAGGCCGCGGCAGGGG
TGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCCAGAGGTCGTGGAGGTGGCCGTGG
AGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGA
GCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCG
GCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGAC
CAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTA
CAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCC
CGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAG
CCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAAC
TCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAA
GACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTG
ACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAG
TAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCC
ATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACG
TTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAA
GATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGA
TTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTG
GACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGA
AAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTA
ACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCC
TTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCA
GAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCA
GCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTA
GTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTT
TAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAG
AGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCT
TTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTG
AGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACT
CGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGAT
TTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGA
TTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTT
CTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGA
AACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGAT
TATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCC
CGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAA
ATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAA
GTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATC
ATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGC
AAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCA
TTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCT
GTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATT
GGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGG
GTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAG
GAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAA
AGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCT

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000417133_chr21_39755846_-_4760nt
AGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTGCGCGCGTGCGCGGACATGGCCTCAAACGATTATACCCAACA
AGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGTCAGCCCTACGGACAGCAGAGTTACAG
TGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAGAGCCAGAACACAGGCTATGGAACTCA
GTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTACGGGCAGCAGTCCTCCTACCCTGG
CTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGCTATGGGCAGCCCCAGAGTGGGAG
CTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCCCCTCAGGGCTATGGACAGCAGAA
CCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAATCCTCCATGAGTAGTGGTGGTGG
CAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAGGACCGTGGAGGCCGCGGCAGGGG
TGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCCAGAGGTCGTGGAGGTGGCCGTGG
AGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGA
GCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCG
GCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGAC
CAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTA
CAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCC
CGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAG
CCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAAC
TCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAA
GACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTG
ACCTTGTAAAAGACAGTGTATGTAGAAGCATGAAGTCTTAAGGACAAAGTGCCAAAGAAAGTGGTCTTAAGAAATGTATAAACTTTAGAG
TAGAGTTTGGAATCCCACTAATGCAAACTGGGATGAAACTAAAGCAATAGAAACAACACAGTTTTGACCTAACATACCGTTTATAATGCC
ATTTTAAGGAAAACTACCTGTATTTAAAAATAGAAACATATCAAAAACAAGAGAAAAGACACGAGAGAGACTGTGGCCCATCAACAGACG
TTGATATGCAACTGCATGGCATGTGCTGTTTTGGTTGAAATCAAATACATTCCGTTTGATGGACAGCTGTCAGCTTTCTCAAACTGTGAA
GATGACCCAAAGTTTCCAACTCCTTTACAGTATTACCGGGACTATGAACTAAAAGGTGGGACTGAGGATGTGTATAGAGTGAGCGTGTGA
TTGTAGACAGAGGGGTGAAGAAGGAGGAGGAAGAGGCAGAGAAGGAGGAGACCAGGGCTGGGAAAGAAACTTCTCAAGCAATGAAGACTG
GACTCAGGACATTTGGGGACTGTGTACAATGAGTTATGGAGACTCGAGGGTTCATGCAGTCAGTGTTATACCAAACCCAGTGTTAGGAGA
AAGGACACAGCGTAATGGAGAAAGGGGAAGTAGTAGAATTCAGAAACAAAAATGCGCATCTCTTTCTTTGTTTGTCAAATGAAAATTTTA
ACTGGAATTGTCTGATATTTAAGAGAAACATTCAGGACCTCATCATTATGTGGGGGCTTTGTTCTCCACAGGGTCAGGTAAGAGATGGCC
TTCTTGGCTGCCACAATCAGAAATCACGCAGGCATTTTGGGTAGGCGGCCTCCAGTTTTCCTTTGAGTCGCGAACGCTGTGCGTTTGTCA
GAATGAAGTATACAAGTCAATGTTTTTCCCCCTTTTTATATAATAATTATATAACTTATGCATTTATACACTACGAGTTGATCTCGGCCA
GCCAAAGACACACGACAAAAGAGACAATCGATATAATGTGGCCTTGAATTTTAACTCTGTATGCTTAATGTTTACAATATGAAGTTATTA
GTTCTTAGAATGCAGAATGTATGTAATAAAATAAGCTTGGCCTAGCATGGCAAATCAGATTTATACAGGAGTCTGCATTTGCACTTTTTT
TAGTGACTAAAGTTGCTTAATGAAAACATGTGCTGAATGTTGTGGATTTTGTGTTATAATTTACTTTGTCCAGGAACTTGTGCAAGGGAG
AGCCAAGGAAATAGGATGTTTGGCACCCAAATGGCGTCAGCCTCTCCAGGTCCTTCTTGCCTCCCCTCCTGTCTTTTATTTCTAGCCCCT
TTTGGAACAGAAGGACCCCGGGTTTCACATTGGAGCCTCCATATTTATGCCTGGAATGGAAAGAGGCCTATGAAGCTGGGGTTGTCATTG
AGAAATTCTAGTTCAGCACCTGGTCACAAATCACCCTTAATTCCTGCTATGATTAAAATACATTTGTTGAACAGTGAACAAGCTACCACT
CGTAAGGCAAACTGTATTATTACTGGCAAATAAAGCGTCATGGATAGCTGCAATTTCTCACTTTACAGAAACAAGGGATAACGTCTAGAT
TTGCTGCGGGGTTTCTCTTTCAGGAGCTCTCACTAGGTAGACAGCTTTAGTCCTGCTACATCAGAGTTACCTGGGCACTGTGGCTTGGGA
TTCACTAGCCCTGAGCCTGATGTTGCTGGCTATCCCTTGAAGACAATGTTTATTTCCATAATCTAGAGTCAGTTTCCCTGGGCATCTTTT
CTTTGAATCACAAATGCTGCCAACCTTGGTCCAGGTGAAGGCAACTCAAAAGGTGAAAATACAAGGTGACCGTGCGAAGGCGCTAGCCGA
AACATCTTAGCTGAATAGGTTTCTGAACTGGCCCTTTTCATAGCTGTTTCAGGGCCTGTTTTTTTCACGTTGCAGTCCTTTTGCTATGAT
TATGTGAAGTTGCCAAACCTCTGTGCTGTGGATGTTTTGGCAGTGGGCTTTGAAGTCGGCAGGACACGATTACCAATGCTCCTGACACCC
CGTGTCATTTGGATTAGACGGAGCCCAACCATCCATCATTTTGCAGCAGCCTGGGAAGGCCCACAAAGTGCCCGTATCTCCTTAGGGAAA
ATAAATAAATACAATCATGAAAGCTGGCAGTTAGGCTGACCCAAACTGTGCTAATGGAAAAGATCAGTCATTTTTATTTTGGAATGCAAA
GTCAAGACACACCTACATTCTTCATAGAAATACACATTTACTTGGATAATCACTCAGTTCTCTCTTCAAGACTGTCTCATGAGCAAGATC
ATAAAAACAAGACATGATTATCATATTCAATTTTAACAGATGTTTTCCATTAGATCCCTCAACCCTCCACCCCCAGTCCAGGTTATTAGC
AAGTCTTATGAGCAACTGGGATAATTTTGGATAACATGATAATACTGAGTTCCTTCAAATACATAATTCTTAAATTGTTTCAAAATGGCA
TTAACTCTCTGTTACTGTTGTAATCTAATTCCAAAGCCCCCTCCAGGTCATATTCATAATTGCATGAACCTTTTCTCTCTGTTTGTCCCT
GTCTCTTGGCTTGCCCTGATGTATACTCAGACTCCTGTACAATCTTACTCCTGCTGGCAAGAGATTTGTCTTCTTTTCTTGTCTTCAATT
GGCTTTCGGGCCTTGTATGTGGTAAAATCACCAAATCACAGTCAAGACTGTGTTTTTGTTCCTAGTTTGATGCCCTTATGTCCCGGAGGG
GTTCACAAAGTGCTTTGTCAGGACTGCTGCAGTTAGAAGGCTCACTGCTTCTCCTAAGCCTTCTGCACAGATGTGGCACCTGCAACCCAG
GAGCAGGAGCCGGAGGAGCTGCCCTCTGACAGCAGGTGCAGCAGAGATGGCTACAGCTCAGGAGCTGGGAAGGTGATGGGGCACAGGGAA
AGCACAGATGTTCTGCAGCGCCCCAAAGTGACCCATTGCCTGGAGAAAGAGAAGAAAATATTTTTTAAAAAGCTAGTTTATTTAGCTTCT

>In-frame_FUS_ENST00000568685_chr16_31198158_+_ERG_ENST00000453032_chr21_39755846_-_1661nt
AGGCGTCGGTACTCAGCGGTGTTGGAACTTCGTTGCTTGCTTGCCTGTGCGCGCGTGCGCGGACATGGCCTCAAACGATTATACCCAACA
AGCAACCCAAAGCTATGGGGCCTACCCCACCCAGCCCGGGCAGGGCTATTCCCAGCAGAGCAGTCAGCCCTACGGACAGCAGAGTTACAG
TGGTTATAGCCAGTCCACGGACACTTCAGGCTATGGCCAGAGCAGCTATTCTTCTTATGGCCAGAGCCAGAACACAGGCTATGGAACTCA
GTCAACTCCCCAGGGATATGGCTCGACTGGCGGCTATGGCAGTAGCCAGAGCTCCCAATCGTCTTACGGGCAGCAGTCCTCCTACCCTGG
CTATGGCCAGCAGCCAGCTCCCAGCAGCACCTCGGGAAGTTACGGTAGCAGTTCTCAGAGCAGCAGCTATGGGCAGCCCCAGAGTGGGAG
CTACAGCCAGCAGCCTAGCTATGGTGGACAGCAGCAAAGCTATGGACAGCAGCAAAGCTATAATCCCCCTCAGGGCTATGGACAGCAGAA
CCAGTACAACAGCAGCAGTGGTGGTGGAGGTGGAGGTGGAGGTGGAGGTAACTATGGCCAAGATCAATCCTCCATGAGTAGTGGTGGTGG
CAGTGGTGGCGGTTATGGCAATCAAGACCAGAGTGGTGGAGGTGGCAGCGGTGGCTATGGACAGCAGGACCGTGGAGGCCGCGGCAGGGG
TGGCAGTGGTGGCGGCGGCGGCGGCGGCGGTGGTGGTTACAACCGCAGCAGTGGTGGCTATGAACCCAGAGGTCGTGGAGGTGGCCGTGG
AGGCAGAGGTGGCATGGGCGGAAGTGACCGTGGTGGCTTCAATAAATTTGGTGGCAGTGGCCAGATCCAGCTTTGGCAGTTCCTCCTGGA
GCTCCTGTCGGACAGCTCCAACTCCAGCTGCATCACCTGGGAAGGCACCAACGGGGAGTTCAAGATGACGGATCCCGACGAGGTGGCCCG
GCGCTGGGGAGAGCGGAAGAGCAAACCCAACATGAACTACGATAAGCTCAGCCGCGCCCTCCGTTACTACTATGACAAGAACATCATGAC
CAAGGTCCATGGGAAGCGCTACGCCTACAAGTTCGACTTCCACGGGATCGCCCAGGCCCTCCAGCCCCACCCCCCGGAGTCATCTCTGTA
CAAGTACCCCTCAGACCTCCCGTACATGGGCTCCTATCACGCCCACCCACAGAAGATGAACTTTGTGGCGCCCCACCCTCCAGCCCTCCC
CGTGACATCTTCCAGTTTTTTTGCTGCCCCAAACCCATACTGGAATTCACCAACTGGGGGTATATACCCCAACACTAGGCTCCCCACCAG
CCATATGCCTTCTCATCTGGGCACTTACTACTAAAGACCTGGCGGAGGCTTTTCCCATCAGCGTGCATTCACCAGCCCATCGCCACAAAC
TCTATCGGAGAACATGAATCAAAAGTGCCTCAAGAGGAATGAAAAAAGCTTTACTGGGGCTGGGGAAGGAAGCCGGGGAAGAGATCCAAA
GACTCTTGGGAGGGAGTTACTGAAGTCTTACTACAGAAATGAGGAGGATGCTAAAAATGTCACGAATATGGACATATCATCTGTGGACTG


Top

FusionGenePPI for FUS_ERG


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FUSEIF6, USF2, PRMT1, PTBP2, SRRM1, SPI1, YBX1, ILF3, SF1, SRSF10, THRA, RXRA, RELA, OTUB1, ZMYM2, SARNP, TARDBP, DGCR8, PCM1, SF3A2, SIRT7, SQSTM1, TDRD3, CUL3, CUL4A, CUL4B, CUL5, CUL2, CDK2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, ARHGEF28, PA2G4, UBE2I, ATXN1L, GRB2, PIK3R2, HNRNPA3, NONO, EEF1A1, DYNC1H1, GSE1, MBD3, MRPS18B, SAP30BP, RPLP1, ESR1, FN1, VCAM1, TP63, IL7R, UBL4A, ITGA4, CTNNB1, UPF1, LMNA, EWSR1, RBMX, PSMB7, ESRRA, MDH1, TAF15, SRSF9, SAFB2, TNIP1, KHDRBS3, NKD2, MAX, PARK2, SUV39H1, WBP4, HNRNPU, LARS, RPA3, RPA2, RPA1, WWOX, HSPA5, VCP, SFPQ, YWHAZ, YWHAQ, PFN1, FASN, PGK1, CKB, ENO1, LDHB, PAICS, PHGDH, LDHA, GAPDH, PKM, ATXN2L, MTHFD1, ACACA, CA2, ALDOA, GPI, PYCRL, PFKL, PGM1, ABCA1, HPRT1, PM20D2, TKT, UBA1, PSMD12, CDH4, ANXA2P2, GNAS, PLCE1, TRPM4, SLC1A5, UBAP2, UBAP2L, LYZ, CKAP4, YPEL1, HIST4H4, H3F3A, H3F3B, HIST2H2BE, DDX42, HNRNPD, SYNCRIP, DHX40, SF3A1, SF3B3, SF3B4, SERBP1, FANCM, RAD54B, PCNA, PHB, TP73, RPL18, RPL9, RPS9, TBPL1, TRIP4, DNAJC10, SAE1, DLD, GOT2, ATP5A1, GSTP1, HARS2, SLC25A3, KPNA2, RAB7A, SPATA6, UACA, STATH, ANXA5, MAP3K3, UBC, TUBB, CFL1, TUBA1A, ACTB, HNRNPF, HNRNPH1, DHX15, CPSF6, SF3A3, HNRNPK, PSPC1, HNRNPL, RPS5, RPS8, RPL12, RPN2, EEF2, EEF1G, HSP90AA1, CCT5, CCT6A, HSP90AB1, CCT2, CCT4, HSP90B1, CCT3, CCT7, CCT8, HSPA8, PPIL4, TCP1, PDIA3, PPIA, SSBP1, GLUD1, ATP5B, HSPA9, ERAL1, TUFM, HSPD1, PYCR1, MDH2, ABCF2, KPNB1, PRDX1, ERP44, F7, ALB, ARMC6, ADCK5, CCDC88A, GPR101, ITK, DGKA, SLC22A11, HERC6, TUBA1B, MTSS1L, CEP112, COL18A1, SEC13, NAP1L1, SNRPD2, NCAPG2, RBBP4, FLJ22447, LSM12, NUDT21, DDX1, C14orf166, DDX5, HIVEP3, NCOA6, RAVER1, TCEB1, TXNL4B, TTI2, GEN1, RPL14, RPS14, NPM1, RPL11, RPL4, EIF4A1, PCBP2, ST13, NSDHL, MTAP, MAT2A, AHCY, OAT, BCS1L, SLC25A5, TIMM50, MYH10, GOLIM4, CSE1L, RAN, KLHL40, KLHL5, IGKV1-5, C6, GIMAP8, CDC5L, CEP78, DBF4B, AMOT, FAM71F1, MFGE8, FAM98A, C11orf70, RTCB, UFL1, LRRIQ4, NUPR1, CUL7, OBSL1, EZH2, SUZ12, BMI1, ABL1, CHEK1, SIK2, SRPK1, LUZP4, UPF2, UPF3A, FAM58A, YEATS4, RPS6KB2, HNRNPA1, FBXW11, ACAT1, ARMC1, C2orf49, DDX17, DNAJC7, EIF4H, AURKA, PTBP1, TOMM34, TXLNA, UFD1L, HNRNPDL, MEF2D, NAA50, NPLOC4, PFKP, PICALM, TARS, NTRK1, SCARNA22, TCF7L2, KIF22, EMC2, MATR3, MCM2, SNW1, RC3H1, EGFR, TRAF6, CRBN, KCTD6, RPS27, PSRC1, SMCO3, CYLD, TRIM25, BRCA1, HDAC6ERGJUN, ETS2, AR, HSPA4, HSPA8, NEDD4, PRKDC, XRCC5, XRCC6, PARP1, XRCC4, NME1, DDX3X, PCBP1, HNRNPA2B1, DDX5, TRIM21, TPM1, HNRNPM, EIF2S1, RPLP0, PRPF8, RPL7A, HNRNPDL, TUBB, CAD, ACTB, ATP5A1, RPS18, HNRNPU, SPTAN1, DNAJA1, DNAJA2, DNAJA4, APP, USP9X, ADAR, CDC5L, CLTC, DDX21, DDX23, DKC1, EEF1A2, ELAVL1, FBL, HNRNPA1, HNRNPAB, HNRNPC, HNRNPD, HNRNPF, HNRNPH1, HNRNPH3, HNRNPUL1, HNRNPUL2, HSPD1, ILF2, ILF3, LANCL1, MATR3, NCL, NOLC1, NONO, NPM1, NUMA1, POLR2A, PRPF40A, PUF60, RCC2, SF3B1, SF3B2, SF3B3, SFPQ, SNRNP200, SYN1, TOP1, TOP2B, XRN2, CUL3, SPOP, TRIM25, UBR5, TRIM33, RING1, UBR4, RNF2, TRIP12, HUWE1, STUB1, UHRF1, HERC2, BRD4, BRD2, BRD3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FUS_ERG


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FUS_ERG


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneFUSC1842675AMYOTROPHIC LATERAL SCLEROSIS 6 (disorder)6UNIPROT
HgeneFUSC0206634Liposarcoma, Myxoid2CTD_human;ORPHANET
HgeneFUSC3539195TREMOR, HEREDITARY ESSENTIAL, 41UNIPROT
TgeneERGC0033578Prostatic Neoplasms5CTD_human
TgeneERGC0023418leukemia1CTD_human
TgeneERGC0023467Leukemia, Myelocytic, Acute1CTD_human
TgeneERGC1961102Precursor Cell Lymphoblastic Leukemia Lymphoma1CTD_human